BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2025 (285 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158360899 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs63673 66 3e-13 >Cs63673 Length = 206 Score = 66.2 bits (160), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 43/193 (22%), Positives = 95/193 (49%), Gaps = 31/193 (16%) Query: 48 SIYKDGAGCGSCFQIRCKNATLCTKQGTKVITSD--------LNHNNQ-------TDFVL 92 +++ +G CGSC++++C+N G+ ++T+ L+++N F + Sbjct: 25 ALFNNGXSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDM 84 Query: 93 SSRAFMAMAQKGLGQDILKHGIVDVEYKRVPCEYKNQNLALRVEESSQKPHYLAVKVLYQ 152 + AF+ +AQ + GIV + ++R+PC K +R + ++ V + Sbjct: 85 AEPAFLQIAQ-------YRAGIVPISFRRIPCAKKG---GIRFTVNGHS-YFNLVLITNV 133 Query: 153 GGQTEIVAIDVAQVGSSNWSFLTRNYGAVWDTSRVPAG-ALQFRFVVTGGFDGKMVWAKN 211 GG ++ ++ + + + W ++RN+G W ++ G +L F+ + DG+ V + N Sbjct: 134 GGAGDVHSVSI-KGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTAS---DGRTVTSNN 189 Query: 212 VLPADWKPGMVYD 224 V+P +W+ G ++ Sbjct: 190 VVPGNWQFGQTFE 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158380033 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5378 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548426 (250 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4047 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542775 (117 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158351412 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3735 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1742 (369 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67272 109 4e-26 >Cs67272 Length = 229 Score = 109 bits (273), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 81/174 (46%), Positives = 97/174 (55%), Gaps = 39/174 (22%) Query: 193 GKPITSTVAEKLSPVYGKVAGAGTAVMSKFKGGSTASTGRDTSTEAVGEAGKDKRGSVKD 252 GK I TV EKLSPVY KVAGAG+ +MSK G T +TG S + G +DK SVKD Sbjct: 20 GKKIGVTVTEKLSPVYEKVAGAGSTLMSKIPG--TTNTG---SEKEHGVGAQDKGVSVKD 74 Query: 253 YLVEKLSPGEEDRALSKVISEKLQIHKPG----------VKEQGGDSA----------SA 292 Y EKL PGEEDRALS+VI+E L+ K V E D+ ++ Sbjct: 75 YFAEKLRPGEEDRALSQVITEALRKKKAKQENKSTSSRPVTEVVSDALHNRNEEPEEITS 134 Query: 293 KPMGKVTESEEVRQRLGSTE-------------GNDNY-VVNKIEDSVGSMLGG 332 +PMGKVTESEEV +RLG+TE N N VV KI+ +VGS GG Sbjct: 135 RPMGKVTESEEVARRLGTTEHDTSNEGIDSSFVNNSNMGVVGKIKGAVGSWFGG 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5029 (421 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3566 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs87016 163 1e-42 >Cs87016 Length = 154 Score = 163 bits (412), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 82/158 (51%), Positives = 107/158 (67%), Gaps = 8/158 (5%) Query: 15 EKPVMVAVDESECSHYALMWVIDNLKESINTNSPLLIFMAQPPPANNITFAAPLGSARMY 74 +K VMVA+DESEC HYAL W ++NL ++I + S L+IF A+P + A M+ Sbjct: 3 KKKVMVAIDESECRHYALQWALENLGDAI-SKSDLIIFTARPTEFIYV-------QASMF 54 Query: 75 CPPTPEFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEIGDAKTAICAAVLKHNVK 134 P+ ++QEN +K ALL RAK+ICA HGV A+T+TE+GD K IC A KH ++ Sbjct: 55 GAAPPDLLMSIQENQKKAALALLGRAKEICAKHGVVAETMTEMGDPKIVICEAAEKHKIQ 114 Query: 135 LLVLGERGLGKIKRAILGSVSNYCVLNAKCPVLVVKKP 172 LL++G G I+RA LGSVSNYCV NAKCPVLVV+KP Sbjct: 115 LLIVGSHSRGPIQRAFLGSVSNYCVHNAKCPVLVVRKP 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 260658896 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89550719 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2908 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158370739 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs194106183 271 3e-75 >Cs194106183 Length = 182 Score = 271 bits (693), Expect = 3e-75, Method: Compositional matrix adjust. Identities = 124/165 (75%), Positives = 145/165 (87%), Gaps = 2/165 (1%) Query: 15 NRAPV-QASMVAPFNGLKSASAFPVTRKAN-DITTLASNGGRVQCMQVWPPVGLKKFETL 72 NRA + QASMVAPF GLKS+SAFP T+K N DIT++ASNGGRVQCM+VWPP GLKKFETL Sbjct: 15 NRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETL 74 Query: 73 SYLPPLSVESLAKEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGYYDGRYWTMWKLPMF 132 SYLPPLS E+L KE+ YLLR+ W+PCLEFELE G+VYREH +SPGYYDGRYWTMWKLPM+ Sbjct: 75 SYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMY 134 Query: 133 GCTDASQVIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKP 177 GCTDA+QV+ E+ E +K YP +F+RIIGFDN RQVQC+SF+A KP Sbjct: 135 GCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5896 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46148 84 1e-18 >Cs46148 Length = 148 Score = 83.6 bits (205), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 46/147 (31%), Positives = 71/147 (48%), Gaps = 14/147 (9%) Query: 16 DLCKNPVDGFSAGLVDENNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFT 75 DL K+P SAG V E+ +F W TI+GPPD+ Y GG F + FP +YP PP V F Sbjct: 12 DLQKDPPTSCSAGPVAED-MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFR 70 Query: 76 SELWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVEXXXXXXXXXXXXPNDES 135 ++++HPN+ +G +C+ IL E+W+P T+ PN + Sbjct: 71 TKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDD 117 Query: 136 PANVEAAKEWRDRRDDFKKKVGRCVRK 162 P E A ++ + ++ +K Sbjct: 118 PLVPEIAHMYKSDKAKYEATARSWTQK 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89543424 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89545582 (255 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4306 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48074 368 e-104 >Cs48074 Length = 257 Score = 368 bits (944), Expect = e-104, Method: Compositional matrix adjust. Identities = 171/255 (67%), Positives = 211/255 (82%), Gaps = 1/255 (0%) Query: 22 DMAYEDAIAGLSKLLSEKADLEGVAAAKIKQLTAELE-EAGSNQFDPVEKLKSGFVHFRT 80 + +YE+AI L KLL EK DL+ VAAAK++Q+TA+L+ + + FD VE++K GF+HF+ Sbjct: 3 NQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITAQLQTPSDTKAFDSVERIKDGFIHFKR 62 Query: 81 EKFEKDVDLYGKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIANMVPPFDTT 140 EK+EK+ LY +LA GQSPK+MVFACSDSRVCPSH+L+FQPGEAFVVRN+AN+VPP+D T Sbjct: 63 EKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQT 122 Query: 141 KHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFIENWVQICAPAK 200 K++GVGAA+EYAVLHLKV NIVVIGHS CGGIKGLMS P DG ++DFIE+WV+I PAK Sbjct: 123 KYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFPFDGNNSTDFIEDWVKIGIPAK 182 Query: 201 NKIKSSCGDLSFADQCTSLEKEAVNVSLGNLLTYPFVREAVVNNTLALKGGHYDFVGGGF 260 +K+ + GD F DQCT EKEAVNVSL NLLTYPFVRE +VN TLALKGG+YDFV G F Sbjct: 183 SKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSF 242 Query: 261 ELWDLDFNITPNLTL 275 ELW LDF ++P L++ Sbjct: 243 ELWGLDFGLSPPLSV 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363625 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361279 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 238017486 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 285809273 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4618 (228 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1094 (249 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36721 124 1e-30 >Cs36721 Length = 287 Score = 124 bits (310), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 59/142 (41%), Positives = 86/142 (60%), Gaps = 4/142 (2%) Query: 112 RPLEEGLPEAIDDGRIGPRDDPKIRSKILAEEFGWDKDLAKKIWCFGPETTGPNMVVDMC 171 RPL GL E I++G + K ++ WD A+ IW FGP+ GPN+++D Sbjct: 4 RPLVTGLAEDIENGVVSIDWSRKTLGDFFKTKYDWDLLAARSIWAFGPDKQGPNILLDDT 63 Query: 172 KGVQ----YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVI 227 + LN +KDS+V GFQW ++EG L +E +R + F++ D + + +HRG GQ+I Sbjct: 64 LPTEVDKSLLNAVKDSIVQGFQWGAREGPLCDEPIRNVKFKIVDARIAPEPLHRGSGQII 123 Query: 228 PTARRVIYASQLTAKPRLLEPV 249 PTARRV Y++ L A PRL+EPV Sbjct: 124 PTARRVAYSAFLMATPRLMEPV 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5220 (647 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88680 152 9e-39 >Cs88680 Length = 213 Score = 152 bits (384), Expect = 9e-39, Method: Compositional matrix adjust. Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 5/158 (3%) Query: 10 IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPIN 68 IGIDLGTT SCV + + ++I N +G+RTTPS VAF E L+G AK Q NP N Sbjct: 60 IGIDLGTTNSCVALMEGKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAVTNPTN 119 Query: 69 TVFDAKRLIGRRFTDASVQGDMKLWPFKVTSGPAEKPMIGVQYKGEEKQFAAEEISSMVL 128 T+F KRLIGR+F D Q +M++ +K+ P + + +Q++ +I + VL Sbjct: 120 TLFGTKRLIGRKFDDPQTQKEMQMVSYKIVRAPNGDAWV----EANGQQYSPSQIGAFVL 175 Query: 129 IKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAG 166 KM+E AE+YLG ++ AV+TVPAYFND+QRQATKDAG Sbjct: 176 TKMKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAG 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363092 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2685 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1248 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3126 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89541679 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89557249 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3297 (73 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363934 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig392 (80 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2467 (274 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3332 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3414 (368 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 118496051 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig150 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3257 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1874 (302 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33726 416 e-118 >Cs33726 Length = 316 Score = 416 bits (1068), Expect = e-118, Method: Compositional matrix adjust. Identities = 204/245 (83%), Positives = 213/245 (86%), Gaps = 2/245 (0%) Query: 1 MATTTAAPPRQLSDKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWE 60 MAT TA PRQLS KEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWE Sbjct: 1 MATGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWE 60 Query: 61 KLQLAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGVNAIAGRHTPGTFTNQLQTSF 120 KLQ+AARVIVAIENP DIIVQSARPYGQRAVLKFA++T +AIAGRHTPGTFTNQ+QTSF Sbjct: 61 KLQMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSF 120 Query: 121 NEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFW 180 NEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFW Sbjct: 121 NEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFW 180 Query: 181 LLARMVLQMRGSLRPGHKWDVMVDLFFYRXXXXXXXXXXXXXXXX-XXYLEYSGGL-GGD 238 LLARMVLQMRG++RPGHKWDVMVDLFFYR EYS L G+ Sbjct: 181 LLARMVLQMRGTIRPGHKWDVMVDLFFYREPEETKQAEEEETAAIDYATAEYSMNLTSGE 240 Query: 239 QWPTQ 243 QWP+Q Sbjct: 241 QWPSQ 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5089 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548708 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1668 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1709 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3221 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5015 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4695 (382 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73025 754 0.0 >Cs73025 Length = 382 Score = 754 bits (1948), Expect = 0.0, Method: Compositional matrix adjust. Identities = 381/382 (99%), Positives = 382/382 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 Query: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT Sbjct: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240 Query: 241 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 300 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR Sbjct: 241 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 300 Query: 301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 360 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL Sbjct: 301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 360 Query: 361 ADYNIQKESTLHLVLRLRGGDF 382 ADYNIQKESTLHLVLRLRGG+F Sbjct: 361 ADYNIQKESTLHLVLRLRGGEF 382 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5205 (347 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7027 84 2e-18 >Cs7027 Length = 345 Score = 84.3 bits (207), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 53/170 (31%), Positives = 78/170 (45%), Gaps = 19/170 (11%) Query: 30 VVYKTDMHCEGCAKKIKRAVKNFPGVEQVKTDAGANKLTVTG-KMDPAALKARLEEKIKK 88 +V K MHCEGCA+K++R +K F GVE V TD +K+ V G K DP + R++ K + Sbjct: 63 IVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRVQRKSHR 122 Query: 89 KVDLVSPQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVPL 148 +V+L+SP P V L Sbjct: 123 QVELLSPIP------------------KPTAAEEEKKAEEKAPPKPEEKKEEPQVIIVVL 164 Query: 149 KIRLHCEGCIQKMRSKILKYKGVSTVSFDMAKDLVTVVGTMDTKTLVPYL 198 K+ +HCEGC +++ +IL+ +GV + D+ VTV G D LV Y+ Sbjct: 165 KVHMHCEGCSLEIKKRILRMEGVESAEPDLKNSQVTVKGVFDPPKLVDYV 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158371589 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10194 157 3e-41 >Cs10194 Length = 251 Score = 157 bits (397), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 80/102 (78%), Positives = 84/102 (82%), Gaps = 1/102 (0%) Query: 1 MTFGLVYTVYATAVDPKRGSVGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVS 60 MTFGLVYTVYATA+DPK+GS+GTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVS Sbjct: 151 MTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVS 210 Query: 61 WSWENHWVYWXXXXXXXXXXXXXYEFFFINNSGHEPLPGGEY 102 WSW+NHWVYW YEFFFIN S HE LP EY Sbjct: 211 WSWDNHWVYWVGPLIGGGLAGIVYEFFFINQS-HEQLPTTEY 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5844 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41343 221 3e-60 >Cs41343 Length = 166 Score = 221 bits (563), Expect = 3e-60, Method: Compositional matrix adjust. Identities = 104/155 (67%), Positives = 131/155 (84%) Query: 4 DRRIGVAMDFSKSSKNALQWAIDNLVDKGDTLHIIHINNNKHDESRNVLWAKSGSPLIPL 63 +R IGVA+DFSK SK AL+WAIDNL++KGDTL+IIHI + DESRN+LW+ +GSPLIPL Sbjct: 5 NRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQDDESRNLLWSDTGSPLIPL 64 Query: 64 SEFRELEVMKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYWGDAREKLLQAVEDLKLDSL 123 EFR+ EVMK+Y V D +VLDMLD S+QK V+++ K+YWGDAR+KL +AVE +KLDSL Sbjct: 65 EEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSL 124 Query: 124 VMGSRGLGTLKRIVLGSVSNYVMTQAPIPVTIVKD 158 VMGSRGLGT++R++LGSVSN+V+ A PVTIVKD Sbjct: 125 VMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKD 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24 (471 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84538 398 e-113 >Cs84538 Length = 216 Score = 398 bits (1023), Expect = e-113, Method: Compositional matrix adjust. Identities = 186/216 (86%), Positives = 199/216 (92%) Query: 219 MCCLFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKQENPRVPII 278 MCCL INDLDAGAGR+GGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNK+ENPRVPII Sbjct: 1 MCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPII 60 Query: 279 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCTGIFKTDNVPTDDIVKLVDAFPGQS 338 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIF+ DNV DDIVKLVD FPGQS Sbjct: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQS 120 Query: 339 IDFFGALRARVYDDEVRKWVASVGVEGVGKRLVNSKEGPPTFEQPKMTLAKLLEYGNMLV 398 IDFFGALRARVYDDEVR W++ +GV +GK LVNSKE PTFEQP+MT+ KLLEYGNM+V Sbjct: 121 IDFFGALRARVYDDEVRNWISGIGVGSIGKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIV 180 Query: 399 QEQENVKRVQLSDKYLKEAALGDANDDAIKSGNFYG 434 QEQENVKRVQL+DKYL EAALG+AN DAI+SGNFYG Sbjct: 181 QEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2427 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78299 449 e-128 >Cs78299 Length = 259 Score = 449 bits (1154), Expect = e-128, Method: Compositional matrix adjust. Identities = 214/256 (83%), Positives = 232/256 (90%), Gaps = 1/256 (0%) Query: 6 LRLLCIASLA-SLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQG 64 R+LC S+A SL ANA+IPG + GGPWQ AHATFYGGSDASGTMGGACGYGNLYSQG Sbjct: 4 FRMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQG 63 Query: 65 YGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNG 124 YGVNTAALSTALFNNGLSCGACFE+KCG DP+WC G P+I +TATNFCPPNFAQPSDNG Sbjct: 64 YGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNG 123 Query: 125 GWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTN 184 GWCNPPR HFDLAMPMFLK+A+Y+AGIVPVSYRRVPC K+GGIRFTING +YFNLVLVTN Sbjct: 124 GWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTN 183 Query: 185 VAGAGDIVSVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAP 244 VAGAGDIV VSVKG NT W+ MSRNWGQNWQSNS LVGQALSFRV GSDRR+ST++NVAP Sbjct: 184 VAGAGDIVRVSVKGANTQWLSMSRNWGQNWQSNSQLVGQALSFRVTGSDRRTSTSWNVAP 243 Query: 245 ANWQFGQTYSGKNFRV 260 ANWQFGQT+SGKNFRV Sbjct: 244 ANWQFGQTFSGKNFRV 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89546967 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2062 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57896167 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89551201 (249 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 97 2e-22 >Cs47542 Length = 355 Score = 96.7 bits (239), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 59/212 (27%), Positives = 107/212 (50%), Gaps = 12/212 (5%) Query: 42 PNVDQREGGDDDARFSIPTIDLQGGKIQADSALRAEVMEKVRHACEKWGFFQVVNHGIPV 101 P+ D DD IP ID+Q + ++ ++ +E + K+ AC++WGFFQ+VNHG+ Sbjct: 31 PDEDSPLNSDDTLISQIPVIDMQS--LLSEESMDSE-LAKLDFACKEWGFFQLVNHGVSS 87 Query: 102 NVLDEVIRGIREFHEQDSELKKEFYTRTPGKKVYYHSNYDLYQASSTDWRDTLGCFMAP- 160 L++V + ++ F E KK+++ + PG + + + + DW D P Sbjct: 88 AFLEKVKKEVKGFFNLSMEEKKKYW-QHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPV 146 Query: 161 ---NPPKPEELPSVCRDIVIEYSKHVMEVGLTLFEILSESLGLNPNHLKDM--NCAEGLL 215 P +LP + RD + YS + + + L + + L + L++ N + + Sbjct: 147 HLRKPHLFPKLPPLLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFENGFQSMR 206 Query: 216 LLGHCYPACPEPDLTFGASKHTDGTFITILLQ 247 + + YP CP+P+ G + H+DG+ +TILLQ Sbjct: 207 M--NYYPPCPQPEKVMGLTPHSDGSALTILLQ 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5653 (653 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88680 162 1e-41 >Cs88680 Length = 213 Score = 162 bits (409), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 80/158 (50%), Positives = 106/158 (67%), Gaps = 5/158 (3%) Query: 10 IGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPQN 68 IGIDLGTT SCV + + ++I N +G+RTTPS VAF E L+G AK Q NP N Sbjct: 60 IGIDLGTTNSCVALMEGKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAVTNPTN 119 Query: 69 TVFDAKRLIGRRFSDPSVQADMKLWPFKVVAGPGDKPMIVVTYKGEEKQFSAEEISSMVL 128 T+F KRLIGR+F DP Q +M++ +K+V P + + +Q+S +I + VL Sbjct: 120 TLFGTKRLIGRKFDDPQTQKEMQMVSYKIVRAPNGDAWV----EANGQQYSPSQIGAFVL 175 Query: 129 IKMKEIAEAYLGQTIKNAVVTVPAYFNDSQRQATKDAG 166 KMKE AE+YLG+++ AV+TVPAYFND+QRQATKDAG Sbjct: 176 TKMKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAG 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4034 (239 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362653 (43 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4492 (495 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89551100 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89551566 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65961 76 3e-16 >Cs65961 Length = 210 Score = 75.9 bits (185), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 56/177 (31%), Positives = 86/177 (48%), Gaps = 13/177 (7%) Query: 9 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYI 68 GK++ + + FE+ PTIGV+ K++ WDTAGQE+F L YY Sbjct: 26 GKSSLLLSFTSDNFEE-LSPTIGVDFKVKYVDVGGKKLKLAIWDTAGQERFRTLTSSYYR 84 Query: 69 HGQCAIIMFDVTARLTYKNVP-TWHR--DLCRVCENIPIVLCGNKVDVKNRQVKAKQ--V 123 Q I+++DVT R T+ N+ W + DL ++ +L GNKVD ++ +V K+ + Sbjct: 85 GAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGI 144 Query: 124 TFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPAL-------APPE 173 F R+ + E SAK+ N ++ F L K+ +L S L PPE Sbjct: 145 NFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPE 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2233 (595 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs82072 128 2e-31 >Cs82072 Length = 267 Score = 128 bits (321), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 93/281 (33%), Positives = 141/281 (50%), Gaps = 19/281 (6%) Query: 310 LIQKCPNLIVLETRNVIGDRGLEVLAQNCKKLRRLRI-ERGADEQEMEDEDGVVSQRGLM 368 LI+ C L L + IGDRGL V+A CK+L+ LR+ G D + V++ GL+ Sbjct: 3 LIRFCRKLERLWILDSIGDRGLRVVAFTCKELQELRVFPSGVD-------NAAVTEEGLV 55 Query: 369 AIAQGCLELEYLAVYVSDITNTSLECIGTHSKNLTDFRLVLLDRE--EIVSDLPLDNGVR 426 AI+ GC +L L + +TN +L + ++ N T FRL +LDRE + V+ PLD G Sbjct: 56 AISAGCPKLHSLLYFCQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFG 115 Query: 427 ALLRGCQKLRRFALYLRPGGLTDKGLFYVGQYSPNVRWMLLGYVGETDTGLEDFSRGCPS 486 A+++ C++LRR +L LTD+ Y+G Y+ + + + + G +D G+ GC Sbjct: 116 AIVQSCKRLRRLSLSGL---LTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKK 172 Query: 487 LQKLEMRGCCFSERALANAVMQLPSLRYLWVQGYRGSGTGHDLLGMARPYWNIELIPPRR 546 L+KLE+R F AL V + ++R LW+ + G L P N+E+I Sbjct: 173 LRKLEIRDSPFGNTALLTDVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIIN--- 229 Query: 547 VDVSDQSGEAETVVVEHPAHILAYYSLAGPRTDFPDSVIPL 587 D E + + Y +L GPR D PD V L Sbjct: 230 ---EDDQMEFSLDDRQKVGKMYLYRTLVGPRKDAPDFVWTL 267 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3947 (58 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57895483 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104404 191 4e-51 >Cs104404 Length = 158 Score = 191 bits (484), Expect = 4e-51, Method: Compositional matrix adjust. Identities = 93/127 (73%), Positives = 102/127 (80%), Gaps = 2/127 (1%) Query: 9 GGRRSNVFDPFSLDIWDPFQGF--GPLMNSSSTAGETSAFAQTRIDWKETPEAHVFKADL 66 GGRR+NVFDPFSLD+WDPF GF L N+ S+A ETS FA RIDWKETP+AHVFKADL Sbjct: 9 GGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADL 68 Query: 67 PGXXXXXXXXXXXXGNVLQISGERSKEQEEKNDKWHRVERSSVKFMRRFRLPDNAKVDQV 126 PG G +LQISGERSKEQEEKNDKWHRVERSS KF+RRFRLPDNAKV+QV Sbjct: 69 PGLRKEEVKVEVEEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQV 128 Query: 127 KAAMENG 133 KA+MENG Sbjct: 129 KASMENG 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2154 (343 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1387 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2367 (649 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88680 157 4e-40 >Cs88680 Length = 213 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 78/158 (49%), Positives = 104/158 (65%), Gaps = 5/158 (3%) Query: 10 IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPVN 68 IGIDLGTT SCV + + ++I N +G+RTTPS VAF E L+G AK Q NP N Sbjct: 60 IGIDLGTTNSCVALMEGKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAVTNPTN 119 Query: 69 TVFDAKRLIGRRFSDSSVQGDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFAAEEISSMVL 128 T+F KRLIGR+F D Q +M++ +K+V P + + +Q++ +I + VL Sbjct: 120 TLFGTKRLIGRKFDDPQTQKEMQMVSYKIVRAPNGDAWV----EANGQQYSPSQIGAFVL 175 Query: 129 VKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAG 166 KM+E AE+YLG +V AV+TVPAYFND+QRQATKDAG Sbjct: 176 TKMKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAG 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77982401 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33540 326 1e-91 >Cs33540 Length = 185 Score = 326 bits (835), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 161/185 (87%), Positives = 168/185 (90%) Query: 1 MGLLSXXXXXXXXXXXXXXLMVGLDNSGKTTIVLRINGEDTSVVSPTLGFNIKTLTYQKY 60 MGLLS LMVGLDNSGKTTIVL+INGEDTSV+SPTLGFNIKT+TYQKY Sbjct: 1 MGLLSIIRKIKKKEKEMRILMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTVTYQKY 60 Query: 61 TLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGSSL 120 TLNIWDVGGQ+TIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSG+SL Sbjct: 61 TLNIWDVGGQRTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGASL 120 Query: 121 LILANKQDIKGALTPEEIAKVLNLQAMDKTRHWNIVGCSAYTGEGLLEGFDWLVQDIASR 180 LILANKQDI GALTP EIAKVLNL+AMDKTRHW IVGCSAYTGEGLLEGFDWLVQDIASR Sbjct: 121 LILANKQDINGALTPTEIAKVLNLEAMDKTRHWKIVGCSAYTGEGLLEGFDWLVQDIASR 180 Query: 181 IYVLD 185 IY+LD Sbjct: 181 IYLLD 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3724 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64862 125 4e-31 >Cs64862 Length = 266 Score = 125 bits (314), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 58/81 (71%), Positives = 71/81 (87%) Query: 170 IDTLKLGACVDLLGGLVHIGLGDPVVNECCPVLSGLVELEAAVCLCTALKIKLLNLNIFV 229 I+ LKLG C+D+LGGLVHIGLG+PV N CCPVL GL+ELEAA+CLCT +++KLLNLNIF+ Sbjct: 170 INALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFI 229 Query: 230 PIALQLLVTCGKSPPPGFTCS 250 P+AL L+TCGK+PPPGF C Sbjct: 230 PLALPALITCGKTPPPGFVCP 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4517 (333 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89554763 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3070 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96763 77 1e-16 >Cs96763 Length = 192 Score = 77.4 bits (189), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 1/70 (1%) Query: 15 PAHPPFSEMITEAIVALKERTGSSQYAITKFVEEKHK-QLPQSFRXXXXXXXXXXVASGK 73 P+HPP+ +MITEA++AL++++GSS YAI K++EEKHK +LP +FR A G Sbjct: 49 PSHPPYFQMITEALMALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGN 108 Query: 74 LVKVKASFKL 83 L+K++AS+KL Sbjct: 109 LIKIRASYKL 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig908 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59461 307 5e-86 >Cs59461 Length = 248 Score = 307 bits (787), Expect = 5e-86, Method: Compositional matrix adjust. Identities = 156/215 (72%), Positives = 172/215 (80%), Gaps = 2/215 (0%) Query: 1 MAS-AAPMASQLKSTFTSPVSRALLAPKGLSASPLKLFPSKRSSSFTIKATQTDKP-FQV 58 MAS ++PMASQLKS+FTSPVSR+LL P+G+S SP ++ PSKRS F +KA Q++KP +QV Sbjct: 1 MASVSSPMASQLKSSFTSPVSRSLLTPRGISGSPFRVVPSKRSPRFIVKAIQSEKPTYQV 60 Query: 59 IQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFVK 118 IQPINGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHG+LLVGPFVK Sbjct: 61 IQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPFVK 120 Query: 119 AGPLRNTEXXXXXXXXXXXXXXXXXXXCLTMYGIASFKEGEPSTAPSLTLTGRKKEPDQL 178 AGPLRNTE CLT+YGIASF EGEPSTAP LTLTGRKKEPDQL Sbjct: 121 AGPLRNTEIAGPAGSLAAGGLVVILSICLTIYGIASFNEGEPSTAPGLTLTGRKKEPDQL 180 Query: 179 QTAEGWAKXXXXXXXXXISGVTWAYFLLYVLNLPY 213 QTA+GWAK ISGV WAYFLLYVLN Y Sbjct: 181 QTADGWAKFTGGFFFGGISGVIWAYFLLYVLNXXY 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4283 (582 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3834 (273 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12987 304 7e-85 >Cs12987 Length = 204 Score = 304 bits (779), Expect = 7e-85, Method: Compositional matrix adjust. Identities = 148/203 (72%), Positives = 166/203 (81%) Query: 71 PLTGVLFEPFEEVKKELDLVPTLPQVSLARQKYSEDSEAAVNEQINVEYNVSYVYHAMYA 130 PLTGV+F+PFEEVKKE+ VP P +SLARQKY ++ EAA+NEQINVEYNVSYVYHA+YA Sbjct: 2 PLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYA 61 Query: 131 YFDRDNVALRGLAKFFKESSEEERGHAEKLMEYQNKRGGRVKLQSILMPVSEFDHAEKGD 190 YFDRDN+ALRGLAKFFKESSEEER HAEK MEYQN RGG+VKL SI+ P SEFDHAEKGD Sbjct: 62 YFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGD 121 Query: 191 ALYAMELAXXXXXXXXXXXXXXQHVADKNKDVQLTDFVESEFLAEQVEAIKKISEYVAQL 250 ALYAMELA VAD+N D Q+ +FVESEFL EQVEAI KI++YV+QL Sbjct: 122 ALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQVEAINKIAKYVSQL 181 Query: 251 RRVGKGHGVWHFDQMLLHDEVAA 273 R VGKGHGVWHFDQMLLH+ AA Sbjct: 182 RMVGKGHGVWHFDQMLLHEGDAA 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359594 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3402 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93621 196 2e-52 >Cs93621 Length = 220 Score = 196 bits (497), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 107/186 (57%), Positives = 122/186 (65%), Gaps = 16/186 (8%) Query: 23 RGLRLELALSQEPD-SDSDSSNHRLVLTLYDALSSRDVATVHTIVAADLEWWFHGPPTHQ 81 R R ELA SQ+ + DS++ N R+VL LYDAL SRDV TVH I+A DLEWWFHGPPTHQ Sbjct: 35 RLFRQELANSQQKNPEDSENKNQRVVLALYDALKSRDVETVHKILAPDLEWWFHGPPTHQ 94 Query: 82 FLMRMLTGEKNDES-----FVFRPQSVCSVGPVVLVEGSDPAKEISWVHAWTVTDGIVTQ 136 F+M +LTG S FVF P S+ S GP+VL EG D +++ISWVHAWTV DGI+TQ Sbjct: 95 FMMHLLTGSTTASSASQSSFVFVPLSITSFGPIVLAEGCDHSRQISWVHAWTVADGIITQ 154 Query: 137 VREYFNTSLTVTRLGNXXXXXXXXXX--------XXXXXXYHCPSVWES--SNPVGKSVP 186 VREYFNTSLTVTR G HCPSVWES SN GKSVP Sbjct: 155 VREYFNTSLTVTRFGKDLSGQSQRKKSPPSDFPSTAEINPVHCPSVWESSVSNRDGKSVP 214 Query: 187 GLVLAI 192 GLVLA+ Sbjct: 215 GLVLAL 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1483 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4660 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542277 (231 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs105279 121 6e-30 >Cs105279 Length = 292 Score = 121 bits (304), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 82/235 (34%), Positives = 123/235 (52%), Gaps = 21/235 (8%) Query: 7 PAAECQIISKP---EVVRRTANFKPSVWGDRFTNYAEDIRTQAQMQEQVEELKQVVRKEV 63 P A KP ++RR+A++ P++W + + Q+E+LK+ V + Sbjct: 39 PMAASTTSIKPVDQTIIRRSADYGPTIWSFDYIQSLDSKYKGESYARQLEKLKEQVSAML 98 Query: 64 FTDAAA---DSSRQLKLIAAIQRLGVAYHFETEIEQALERIHATYQDIHDDDGDLYNVAL 120 D D QL LI + RLGV+YHFE EI++ L+RIH + + LY AL Sbjct: 99 QQDNKVVDLDPLHQLDLIDNLHRLGVSYHFEDEIKRTLDRIHNK-----NTNKSLYATAL 153 Query: 121 RFRLLRRHGYNVSC-DVFNKFKDTNGDFKKSLVTD-VSGMLCFYEAAHLRVHGE-TLLEE 177 +FR+LR++GYN + F++F D G FK S +D GML YEAA+L V E ++ + Sbjct: 154 KFRILRQYGYNTPVKESFSRFMDEKGSFKLSSHSDECKGMLALYEAAYLLVEEESSIFRD 213 Query: 178 ALVFTTTHLESASAISSL-------LKTPITEALERPLLKTMERLGARRYMSIYQ 225 A+ FTT +L+ A + L T + ALE PL M RL AR ++ +Y+ Sbjct: 214 AIRFTTAYLKEWVAKHDIDKNDDEYLCTLVKHALELPLHWRMRRLEARWFIDVYE 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2880 (405 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs130106184 722 0.0 >Cs130106184 Length = 411 Score = 722 bits (1863), Expect = 0.0, Method: Compositional matrix adjust. Identities = 349/404 (86%), Positives = 374/404 (92%), Gaps = 6/404 (1%) Query: 1 MSSKERPTLGGTRIKTRKRNIAA------FADAVVQIYLDNAGDLELIAKSIESSDLNFS 54 MSSKE+PTLGGTRIK RKRNIAA F+DAVVQIYLDNAGDLELIAK IESSDLNFS Sbjct: 1 MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSDLNFS 60 Query: 55 RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSVLESEPRREVIIPFVIYIQKILRRRPFL 114 RYGDTFFEVVFTGGRTQPGTTKPDEGERH YS+++ EP+RE I+P VIYIQKILRRRPFL Sbjct: 61 RYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFL 120 Query: 115 IKNLENVMRRFLQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPMLKDNLVGKGL 174 IKNLENV RRF+QSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQP+LKDNLVGKGL Sbjct: 121 IKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGL 180 Query: 175 VLSFITEFFKEYLIDNSLDDLISILKRGKVEDNLLDFFPAAKRTEECFSEHFTKEGLVAL 234 VLSFIT+FFKEYL+DNSLDDLI+ILKRGK+EDNLLDFFP++KR+ E FSEHFTKEGL+ L Sbjct: 181 VLSFITDFFKEYLVDNSLDDLIAILKRGKMEDNLLDFFPSSKRSAEGFSEHFTKEGLIPL 240 Query: 235 VEYNEKKIFEVKLKDMKSALTTQITEETDIAEVIETVKQRVKDAKLPDVEVVRILWDVIM 294 VEYNEKKIFEVKLKDMKS LTTQI EET+++EVIE+VKQRVKDAKLPD+EVVRILWD++M Sbjct: 241 VEYNEKKIFEVKLKDMKSTLTTQIAEETEMSEVIESVKQRVKDAKLPDIEVVRILWDILM 300 Query: 295 DAVQWSGKXXXXXXXXXLRQVKTWAQLLNAFCTNGKLELELMYKVQMQCYEDAKLMKLFS 354 DAVQWSGK LRQVKTWAQLLN FCTN KLELELMYKVQMQCYEDAKLMKLF Sbjct: 301 DAVQWSGKNQQQNANAALRQVKTWAQLLNTFCTNAKLELELMYKVQMQCYEDAKLMKLFP 360 Query: 355 EIVRSLYDQDVLAEDTILHWFRKGTNPKGRQTFVKALEPFVKWL 398 EIVRSLYDQDVLAEDTIL+WFRKGTNPKGRQTFVKALEPFVKWL Sbjct: 361 EIVRSLYDQDVLAEDTILYWFRKGTNPKGRQTFVKALEPFVKWL 404 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5502 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89545838 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3502 (337 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158354890 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158350521 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158376540 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1576 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs97733 103 1e-24 >Cs97733 Length = 197 Score = 103 bits (256), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 51/137 (37%), Positives = 89/137 (64%), Gaps = 4/137 (2%) Query: 1 SCPYQSGTLLITGPFLDWFLTNQNVFSFKYTTQVLVFIVLSCLISVSVNFSTFLVIGKTS 60 + P Q+ TLL+ GPFLD +LT++ ++++ Y ++F++LSC I+V N S F+ IG+ + Sbjct: 55 TAPAQAATLLVIGPFLDNWLTDKRIYAYDYNIASVIFLILSCTIAVGTNLSQFICIGRFT 114 Query: 61 PVTYQVLGHLKTCLVLTFGYTLL-HDPFDWRNILGILVALMGMVLYSYFCTREG--QKKV 117 V++QVLGH+KT LVL G+ + ++ +LG+++A+ GM+ YS T+ G +++ Sbjct: 115 AVSFQVLGHMKTILVLIMGFLFFGKEGLNFHVVLGMIIAVFGMIWYSNASTKPGGKERRS 174 Query: 118 AEEATQVLKAGE-GESD 133 + T+ K G GES+ Sbjct: 175 SLPTTRPQKHGNLGESN 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158380176 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363512 (76 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1700 (296 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3037 (313 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 67 3e-13 >Cs36939 Length = 275 Score = 66.6 bits (161), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 26/40 (65%), Positives = 34/40 (85%) Query: 77 LIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKL 116 +II L +LLGN+W+ IA LP RTDN+IKNYWNTH+K+K+ Sbjct: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKV 40 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158365572 (238 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1418 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig303 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs49303 102 2e-24 >Cs49303 Length = 116 Score = 102 bits (254), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 48/61 (78%), Positives = 51/61 (83%) Query: 128 DCIPLCEQRCSLHSRKRTCMRACMTCCDRCKCVPPGTSGNRERCGKCYTDMTTHGNRSKC 187 DC LC+QRCSLHSR C RAC TCC RCKCVPPGT+GNRE CG CYTDMTTHGNR+KC Sbjct: 56 DCGGLCKQRCSLHSRPNLCNRACGTCCVRCKCVPPGTAGNRELCGSCYTDMTTHGNRTKC 115 Query: 188 P 188 P Sbjct: 116 P 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89555729 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5479 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2976 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74790 131 3e-33 >Cs74790 Length = 135 Score = 131 bits (330), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 68/122 (55%), Positives = 79/122 (64%), Gaps = 1/122 (0%) Query: 1 MASFTASTPTSSVTRAALVHKPSVGAPSSTILALPSIGNKGKLRCSMEAKPPMKESNSNI 60 MA+ TAS TSS+T + LVHKPS+ A SS +L LP+ KGK+RCSME KP +ES +N+ Sbjct: 1 MAAITASVGTSSITPSVLVHKPSIVASSSPVLGLPAKAVKGKVRCSMEEKPSKQESKTNV 60 Query: 61 GXXXXXXXXXXXXXXXXXXXXXXVDDRLSTEGTGLPFGLSNNLLGWILLGVFALIWTFYF 120 G VDDR+STEGTGLPFGLSNNLLGWILLGVF LIW Y Sbjct: 61 GMSASLLAAACAATMSSPAMAL-VDDRMSTEGTGLPFGLSNNLLGWILLGVFGLIWALYI 119 Query: 121 TY 122 Y Sbjct: 120 PY 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1991 (284 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs98448 281 5e-78 >Cs98448 Length = 294 Score = 281 bits (719), Expect = 5e-78, Method: Compositional matrix adjust. Identities = 151/286 (52%), Positives = 189/286 (66%), Gaps = 11/286 (3%) Query: 5 GQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVRILYTALCHTDAYTWGGKD--PEGL 62 G+VI CKAA+ P KPLVIE+++V PP+A EVR++IL T+LCH+D W P+ Sbjct: 11 GKVIRCKAAICRIPGKPLVIEEIEVEPPKAWEVRIKILCTSLCHSDVTFWKSSTDLPKLP 70 Query: 63 FPCILGHEAAGIVESVGEGVTTVQPGDHVIPCYQAECGECKFCKSGKTNLCGKVRAATGV 122 P I GHEA G+VESVGE V V+ D V+P +Q +CGEC+ CKS K+N C K G Sbjct: 71 LPVIFGHEAVGVVESVGEYVEEVKERDLVLPIFQRDCGECRDCKSSKSNTCSKF----GR 126 Query: 123 GV---MMSDRQSRF-SINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCG 178 G M D SRF + G I+HF+ S+F++YTVV V KI P PL CLL CG Sbjct: 127 GYRPNMPRDGTSRFRELKGDVIHHFLNISSFTEYTVVDITHVVKITPHIPLGIACLLTCG 186 Query: 179 VPTGLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKTAGASRIIGVDIDSKKFDIAKNF 238 V TG+GA W A VE GS VAIFGLG VGLAVAEGA+ AS+IIGVDI+ +KF+I K F Sbjct: 187 VSTGVGAAWKVAGVEVGSTVAIFGLGAVGLAVAEGARLNRASKIIGVDINPEKFEIGKKF 246 Query: 239 GVTEFVNPKD-HEKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALE 283 G+T+F+NP +K + QV+ ++TDGG DY FECIG SVM A Sbjct: 247 GITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLASVMNDAFN 292 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2922 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33129 211 7e-57 >Cs33129 Length = 225 Score = 211 bits (536), Expect = 7e-57, Method: Compositional matrix adjust. Identities = 111/220 (50%), Positives = 150/220 (68%), Gaps = 3/220 (1%) Query: 3 QVTVLGAWSSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAGK 62 +V +L WSSP+ R W LKLKGV +++++ED L NKS LL+ NPV+KKVPVL+H GK Sbjct: 4 EVKLLKTWSSPFGLRAFWILKLKGVQFDFIDED-LSNKSPLLLQSNPVYKKVPVLIHNGK 62 Query: 63 PIAESAVILEYIEETWPQNPLLPKDPHQRALARFWIKFGEDK-FGALFGFFMTEGEQQVK 121 PI+ES VILEY++ETW QNPLLP+DP++RA ARFW KFGEDK +++ F+ +G++Q + Sbjct: 63 PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKEQEE 122 Query: 122 ATKERQEQLTILEEQGLGDKKFFGGDELGMADLEFGWLAWWMDVMSELAGVKGIEAETFP 181 A E L LEE+ L K+FFGG+++G+ADL GWLA + V E+ GVK IE E P Sbjct: 123 AIGLAIETLKFLEEE-LKGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKERVP 181 Query: 182 RLHAWIQRFKDIPTIKEHLPDRSAMLTYFKGGRAILLASA 221 L AW+Q + P IKE P ++T + R A+A Sbjct: 182 LLAAWMQEVAEAPVIKESWPPHEKLVTKIRAIREAYGAAA 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158374503 (62 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3949 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1166 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54924 124 3e-31 >Cs54924 Length = 140 Score = 124 bits (312), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 66/107 (61%), Positives = 82/107 (76%), Gaps = 2/107 (1%) Query: 27 RPVSRSSRAGIQFPVGRIHRQLKQRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASK 86 + VSRS +AG+QFPVGRI R LK A RVGA A VYL+++LEYL AEVLELAGNA++ Sbjct: 19 KSVSRSHKAGLQFPVGRIARFLKAGKYAE-RVGAGAPVYLSAVLEYLAAEVLELAGNAAR 77 Query: 87 DLKVKRITPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINK 132 D K RI PRH+QLA+R DEEL L+ TIA GGV+P+IH++L+ K Sbjct: 78 DNKKNRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLPK 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3744 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5214 (355 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 285809009 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89541813 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158373278 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33185 189 7e-51 >Cs33185 Length = 141 Score = 189 bits (480), Expect = 7e-51, Method: Compositional matrix adjust. Identities = 89/97 (91%), Positives = 93/97 (95%) Query: 2 YPLTLQFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQ 61 +PLTL FSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQ Sbjct: 32 FPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQ 91 Query: 62 DLLDQPNAADPAQTEGYQLFIQEPAEYKRRVKQQAKQ 98 DLLDQPN ADPAQT+GYQLFIQ+PAEYKRRV+QQAK Sbjct: 92 DLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKH 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig98 (472 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89544682 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48074 138 6e-35 >Cs48074 Length = 257 Score = 138 bits (347), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 68/146 (46%), Positives = 96/146 (65%), Gaps = 2/146 (1%) Query: 81 MKDRFLSFKKQKFLRESEHFQNLAQVQDPKFMVIACADSRVCPSNILGFQPGEAFMIRNV 140 +KD F+ FK++K+ + + LA+ Q PK+MV AC+DSRVCPS++L FQPGEAF++RNV Sbjct: 53 IKDGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNV 112 Query: 141 ANLVPPFE-NGASETNAALEFAVNTLEVENIFVIGHSSCAGIETLMTMQDDGDSSS-FTH 198 AN+VPP++ + AA+E+AV L+V NI VIGHS+C GI+ LM+ DG++S+ F Sbjct: 113 ANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFPFDGNNSTDFIE 172 Query: 199 RWVVNAKVAKLRTKAAAPHLSFDQQC 224 WV AK + F QC Sbjct: 173 DWVKIGIPAKSKVLTEHGDKPFGDQC 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5612 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158364404 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 238016222 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33540 70 6e-15 >Cs33540 Length = 185 Score = 69.7 bits (169), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 36/82 (43%), Positives = 44/82 (53%) Query: 1 GQTSIRPYWRCYFPNTQAIIYVVDSSDTDRLVIAKXXXXXXXXXXXLKGAVVLIFANKQD 60 GQ +IR YWR YF T +++VVDSSD RL K L GA +LI ANKQD Sbjct: 69 GQRTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGASLLILANKQD 128 Query: 61 LPGALDDAAITEALELHKIKKP 82 + GAL I + L L + K Sbjct: 129 INGALTPTEIAKVLNLEAMDKT 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89555242 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89540494 (290 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26081 514 e-148 >Cs26081 Length = 399 Score = 514 bits (1325), Expect = e-148, Method: Compositional matrix adjust. Identities = 244/279 (87%), Positives = 259/279 (92%), Gaps = 2/279 (0%) Query: 12 IVNPWKVEAKEGGKIDYDKLIDQFGCQRIDQSLVDRVRRLTSRPPHVFLRRDVFFAHRDL 71 +V+PW+V + GKIDYDKLID+FGCQR+DQSLVDRV+RLT RPPHVFLRR VFFAHRDL Sbjct: 16 VVSPWEVSS--SGKIDYDKLIDKFGCQRLDQSLVDRVQRLTGRPPHVFLRRGVFFAHRDL 73 Query: 72 NEILDAYERGDKFYLYTGRGPSSEALHLGHLIPFMFTKYLQDAFKVPLVIQLTDDEKCMW 131 N+ILDAYE+G+KFYLYTGRGPSSEALHLGHL+PFMFTKYLQDAFKVPLVIQLTDDEKCMW Sbjct: 74 NDILDAYEKGEKFYLYTGRGPSSEALHLGHLVPFMFTKYLQDAFKVPLVIQLTDDEKCMW 133 Query: 132 KNISVEESQRLARENAKDIIACGFDVTRTFIFSDFDYVGGAFYKNMVKVGKCVTYNKVVG 191 KN+SVEESQRLARENAKDIIACGFDVT+TFIFSDFDYVGGAFYKNMVKV KCVTYNKVVG Sbjct: 134 KNLSVEESQRLARENAKDIIACGFDVTKTFIFSDFDYVGGAFYKNMVKVAKCVTYNKVVG 193 Query: 192 IFGFTGEDHIGKVSFPPVQAVXXXXXXXXXXXXGQDNLRCLIPCAIDQDPYFRMTRDVAP 251 IFGFTGEDHIGKVSFPPVQAV G+D+LRCLIPCAIDQDPYFRMTRDVAP Sbjct: 194 IFGFTGEDHIGKVSFPPVQAVPSFPSSFPHLFSGKDHLRCLIPCAIDQDPYFRMTRDVAP 253 Query: 252 RIGYHKPALIESLFFPALQGETGKMSASDPNSAIYVTDS 290 RIGYHKPALIES FFPALQGETGKMSASDPNSAIYVTDS Sbjct: 254 RIGYHKPALIESSFFPALQGETGKMSASDPNSAIYVTDS 292 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3762 (261 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76516 256 2e-70 >Cs76516 Length = 291 Score = 256 bits (653), Expect = 2e-70, Method: Compositional matrix adjust. Identities = 121/220 (55%), Positives = 161/220 (73%), Gaps = 4/220 (1%) Query: 1 MAKIYALALVMFFKILVAASAGNFNQDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKS 60 M+ I++L + + +LV S+ F+ + +W + + L L LD SG+GF S Sbjct: 4 MSLIFSLFVGLLMVVLV--SSAKFDDLYQTSWAFDHVQY--DGDTLKLNLDNYSGAGFAS 59 Query: 61 RNQYLFGKIDMQIKLVPGNSAGTVTSYYLSSLGSAHDEIDFEFLGNLSGDPYTLHTNVFT 120 +++YLFGK+ +QIKLV G+SAGTVT++Y+SS G H+E DFEFLGN +G+PY + TNV+ Sbjct: 60 KSKYLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYV 119 Query: 121 QGKGNREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAM 180 G GNREQ+ LWFDPTK+FHTYS+LWN + ++F VD TPIR NLE +GIPFPK+QAM Sbjct: 120 NGVGNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKDQAM 179 Query: 181 WIYSSLWNADDWATRGGLVKTDWSKAPFTASYRNFNAQAC 220 +YSS+WNADDWAT+GG VKTDWS APF ASY+ F+ AC Sbjct: 180 GVYSSIWNADDWATQGGRVKTDWSHAPFIASYKGFDIDAC 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2204 (342 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542245 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4775 (399 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs86545 561 e-162 >Cs86545 Length = 400 Score = 561 bits (1447), Expect = e-162, Method: Compositional matrix adjust. Identities = 266/383 (69%), Positives = 301/383 (78%), Gaps = 10/383 (2%) Query: 27 EDEGPRTPQSXXXXXXXXXXXXNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEY 86 EDE R+ QS NSLAEILPL DTPGGPWKVYGVARRP+PNWNADH VEY Sbjct: 18 EDEPARSYQSVGLIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNWNADHLVEY 77 Query: 87 IQCDVSDADDAKGKLSPLTDVTHIFYVTWTNRSTEAENCEANAAMLRNVLGSVIPNAPNL 146 +QCDVSD ++ + LS L DVTHIFYVTWTNRSTEAENC+ N +M RNVL +VIPNAPNL Sbjct: 78 VQCDVSDPEETQAMLSQLIDVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAPNL 137 Query: 147 KHICLQTGAKHYIGSFESWGKIQPHDSPFTEDLPRLDVPNFYYTQEDLLFEEVEKREELT 206 +H+CLQTG KHY+G FE++GKI+P+D PFTED+PRLD PNFYYT ED+LFEEVEK+EEL+ Sbjct: 138 RHVCLQTGTKHYLGPFEAFGKIKPYDPPFTEDMPRLDAPNFYYTLEDILFEEVEKKEELS 197 Query: 207 WSVHRPDTIFGFSPYSMMNIVGSLCVYAAICKHEGVLLRFPGTKAAWNCLSTASDADLIA 266 WSVHRPDTIFGFSPYS+MN+VG+LCVYAA+CKHEG+ LRFPGTKAAW C S ASDADLIA Sbjct: 198 WSVHRPDTIFGFSPYSLMNLVGALCVYAAVCKHEGIPLRFPGTKAAWECYSIASDADLIA 257 Query: 267 EQHIWAAVDPYARNEAFNINNGDVFKWKQFWKVLAXX----------XXXXXXXXXXXXX 316 E IWAAVDPYA+NEAFN NNGDVFKWK WKVLA Sbjct: 258 EHQIWAAVDPYAKNEAFNCNNGDVFKWKHLWKVLAEQFGIEDYGLSEEEEEEEEGGGGTQ 317 Query: 317 VVGLQKLMEGKSGVWEEIVKENQLVPTKLEEVGVWWFVDAVLSGESMFGCMNKSKEHGFV 376 V L + M+GK GVWEEIV+ENQL PT+L+EVG WWFVD VL+GE+ MNKSKEHGF Sbjct: 318 RVKLAEFMKGKEGVWEEIVRENQLQPTRLDEVGAWWFVDLVLTGEAKLASMNKSKEHGFS 377 Query: 377 GFRNSRNSLVTWIDKMKAYKIVP 399 GFRNS+NS +TWIDK K YKIVP Sbjct: 378 GFRNSKNSFITWIDKAKGYKIVP 400 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig839 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig914 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1161 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46148 303 8e-85 >Cs46148 Length = 148 Score = 303 bits (775), Expect = 8e-85, Method: Compositional matrix adjust. Identities = 144/148 (97%), Positives = 147/148 (99%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRSKYETTARSWTQKYAMG 148 PEIAHMYK+D++KYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKSDKAKYEATARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 260659647 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12861 138 3e-35 >Cs12861 Length = 334 Score = 138 bits (347), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 68/148 (45%), Positives = 97/148 (65%) Query: 3 LEQSRPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDNLK 62 + +R +DEV+M++S F +L++LKNLR QLYSAAEY E SY + +QKQ+V++ LK Sbjct: 10 IPMTRDVSNYDEVAMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLK 69 Query: 63 DYAVRALVNAVDHLGTVAYKXXXXXXXXXXXVSTMDLKVTCLNQKLFTCKTFMDKEGARQ 122 DYAV+ALVN VDHLG+V YK VS + +V+C+ Q+L TC+ ++D EG Q Sbjct: 70 DYAVKALVNTVDHLGSVTYKVNDLLDEKVDEVSDTEHRVSCIEQRLRTCQEYIDHEGLSQ 129 Query: 123 QQLLPFIPRHHKHYILPNSVNKEGTFQS 150 Q L+ P++HK YILP G ++ Sbjct: 130 QSLVINTPKYHKRYILPVGETMHGAIRT 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361150 (55 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5929 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig980 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4725 (393 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89540286 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs55446 65 5e-13 >Cs55446 Length = 212 Score = 65.5 bits (158), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 37/82 (45%), Positives = 49/82 (59%), Gaps = 2/82 (2%) Query: 83 YGSSKEETPAEPDLTTFFQGQDLQQKGKTVTLRLLKPTSNKATLLSRQVAKSIPFSSSKL 142 Y +++ + +P+ FF +DL G + L + TSN AT LSRQ AKS PFSS KL Sbjct: 129 YAANENQLHDDPNTALFFLEKDLH-PGMKMNLHFTQ-TSNGATFLSRQAAKSTPFSSDKL 186 Query: 143 PEILTYFGVKPNSLAAGLMKQT 164 PEI F VKP S+ A +M+ T Sbjct: 187 PEIFNQFSVKPGSVEAEIMQNT 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4624 (321 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65208 114 1e-27 >Cs65208 Length = 95 Score = 114 bits (285), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 3/96 (3%) Query: 1 MPRGTLEVVLADARGLDNNDFLAKISPYAVLTVKTQEKKSTVLTGKGSNPEWNQSFLFTI 60 MPRGTLEV+L +GL+++DFL + PY VLT +TQE+KS++ G GS PEWN++F+FTI Sbjct: 1 MPRGTLEVLLVGCKGLEDSDFLGSVDPYVVLTCRTQEQKSSI--GSGSGPEWNETFVFTI 58 Query: 61 SDDEVKELHLTIMDKDNFSADDYVGEATIPLLPAFV 96 + D V EL L IMDKD FS DDY+GEAT + F+ Sbjct: 59 TGD-VTELTLKIMDKDTFSNDDYLGEATSVVFSLFI 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57896472 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357709 (36 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158353405 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3667 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4729 (303 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2740 (270 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548249 (231 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2230 (375 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89550843 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2437 (408 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1652 (238 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89557926 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3262 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158378709 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359332 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4811 (440 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357974 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18552 65 2e-13 >Cs18552 Length = 97 Score = 64.7 bits (156), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 43/98 (43%), Positives = 53/98 (54%), Gaps = 12/98 (12%) Query: 1 MARSFSNAKLLSALVSN----TIARRGYAAGSPGLAAVRGEVAAASVTRSVNLEKKSGED 56 MARS AKLL A V++ +I RRGYAA +P G ++ + +L ED Sbjct: 1 MARSLFKAKLLLAPVADGISLSIGRRGYAAAAP-----LGTISRTGIMEKNDLTPAVRED 55 Query: 57 KVGSVFKVSWVPNPKTGVYGPENRADEIDVAELRNALL 94 S +W P+P TG Y PENRA EID AELR LL Sbjct: 56 SGASS---AWAPDPITGYYRPENRAVEIDPAELREMLL 90 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig258 (254 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101477 298 4e-83 >Cs101477 Length = 242 Score = 298 bits (763), Expect = 4e-83, Method: Compositional matrix adjust. Identities = 166/249 (66%), Positives = 185/249 (74%), Gaps = 21/249 (8%) Query: 20 LINFEETELRLGLPGALKDGDQGV--------KSCSSGKRGFSETV-DLKLNFSSENDDV 70 +INFE TELRLGLPG +G + + KRGF++TV DLKLN S++ Sbjct: 1 MINFEATELRLGLPGGNGGSSEGGGGGEKAKNNNINGMKRGFADTVVDLKLNLSTK---- 56 Query: 71 SRSGRDGQVEIKKEKDXXXXXXX-----XXXXQVVGWPPVRSFRKNIVAVQKKSTDQDQA 125 SG +E K K QVVGWPPVRSFRKNI+AVQK + + D Sbjct: 57 -ESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQKDNEEGDNK 115 Query: 126 AEKSGSTSTSAAFVKVSMDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGMK 185 A S +S++ AFVKVSMDGAPYLRKVDLKLY+SYQELS ALGKMFSSFTIGNCGSQGMK Sbjct: 116 ASSS--SSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMK 173 Query: 186 DFMNESKLIDLLNGSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPR 245 DFMNESKLIDLLNGS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPR Sbjct: 174 DFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPR 233 Query: 246 AVEKFKNRS 254 AVEK KNRS Sbjct: 234 AVEKCKNRS 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4253 (304 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158373803 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3439 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89549845 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4278 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16666 406 e-115 >Cs16666 Length = 253 Score = 406 bits (1043), Expect = e-115, Method: Compositional matrix adjust. Identities = 201/256 (78%), Positives = 218/256 (85%), Gaps = 5/256 (1%) Query: 2 AATTGAMLNGLNSTFLCGGKRSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSWIPAVK 61 AAT+GA+LNGL S+F+ GGK+SQ SWIPAVK Sbjct: 3 AATSGAVLNGLGSSFINGGKKSQALLAGTNRVTSSKKSVVVAALPPKK-----SWIPAVK 57 Query: 62 GGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMTAVVGIFVGQAW 121 GGGN I+PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAM AVVGIFVGQ W Sbjct: 58 GGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQTW 117 Query: 122 SGVPWFQAGADPSAVAPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSKTA 181 SG+PWF+AGADP A+APFSFGSLLGTQLLLMGWVESKRWVDF+NPESQSVEWATPWS+TA Sbjct: 118 SGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTA 177 Query: 182 ENFSNFTGEQGYPGGKFFDPLGLAGTIKDGVYIPDTEKLERLQLAEIKHSRLAMLAMLIF 241 ENF+N TGEQGYPGGKFFDPL LAGTIKDGVYIPDTEKL+RL++AEIKH+RLAM+AMLIF Sbjct: 178 ENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIF 237 Query: 242 YFEAGQGKTPLGALGL 257 YFEAGQGKTPLGALGL Sbjct: 238 YFEAGQGKTPLGALGL 253 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362347 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78980 63 2e-12 >Cs78980 Length = 276 Score = 63.2 bits (152), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 60/194 (30%), Positives = 96/194 (49%), Gaps = 9/194 (4%) Query: 12 GRTVLITGVSKGLGRALAVELAKRGHTVIGCSRSQDKLTSLQSELSSDNHLFLAA--DVS 69 G T L+TG ++G+G A ELA+ G V CSR+Q +L + E + + D+S Sbjct: 17 GMTALVTGGTRGIGHATVEELARFGAIVHTCSRNQIELDARLHEWKNKGFKVTGSVCDLS 76 Query: 70 SNSSIQELARIVME-KKGVPDIIVNNAGVINSNNKLWEVPADEFDGVIDTNVKGVANVLR 128 S ++L V +G +I++NNA + + ++ A++ V TN + V ++ + Sbjct: 77 SREQREKLIETVTSIFQGKLNILINNAAIAFVKPTV-DITAEDMSTVSSTNFESVFHLSQ 135 Query: 129 HFIPLMLKRDPAPATGIIVNMSSGWGRSGAAHVAPYCASKWAVEGLTRSVAKELPKD-MA 187 PL A G IV +SS G G V+ Y A K A+ LT+++A E KD + Sbjct: 136 LAHPLF----KASGNGSIVFISSVGGVRGIPSVSLYGAYKGAMNQLTKNLACEWAKDNIR 191 Query: 188 IVALNPGVIHTDML 201 + P VI T M+ Sbjct: 192 TNTVAPWVIKTSMI 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3036 (79 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89557269 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1759 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89543790 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158358365 (266 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1499 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361786 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4628 (524 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95618 98 2e-22 >Cs95618 Length = 131 Score = 97.8 bits (242), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 58/135 (42%), Positives = 78/135 (57%), Gaps = 13/135 (9%) Query: 314 MTEATHL--MC----SNPLPEDGAHKPGSVGKPV-GQELAILN-ENGVVQPSDVSGEVCI 365 MTEA + MC P P K GS G V EL +++ E G P + GE+CI Sbjct: 1 MTEAGPVLSMCLGFAKQPFPT----KSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICI 56 Query: 366 RGPNVTKGYKNNPEANKAAFTF-GWFHTGDVGFLDSDGYLHLVGRIKELINRGGEKISPI 424 RGP + KGY N+PEA A GW HTGD+G++D D + +V R+KE+I G ++ P Sbjct: 57 RGPQIMKGYLNDPEATAATIDVEGWLHTGDIGYVDDDDEVFIVDRVKEIIKFKGFQVPPA 116 Query: 425 EVDAVLLSHPEICQA 439 E++A+LLSHP I A Sbjct: 117 EIEALLLSHPSIGDA 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1630 (139 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158376124 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2708 (543 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4661 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11667 453 e-130 >Cs11667 Length = 250 Score = 453 bits (1166), Expect = e-130, Method: Compositional matrix adjust. Identities = 222/252 (88%), Positives = 235/252 (93%), Gaps = 4/252 (1%) Query: 1 MATVTTQASA-VYRPQITSKSRFLTGSSGKLTREVAFRPVTSPSASSFKVEAKKGEWLPG 59 MATVTTQASA V+RP SKSRFLTGSSGKL REVA +PV+S ++SFKVEAKKGEWLPG Sbjct: 1 MATVTTQASAAVFRP-CASKSRFLTGSSGKLNREVALKPVSS--SASFKVEAKKGEWLPG 57 Query: 60 LPSPGYLTGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIG 119 L SP YL GSLPGDNGFDPL LAEDPENLKW+VQAELVN RWAMLGV GMLLPEV T IG Sbjct: 58 LASPTYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIG 117 Query: 120 IINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 179 IINVP+WYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP Sbjct: 118 IINVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 177 Query: 180 NEVGYPGGIFNPLNFAPTEEAKEKEIANGRLAMLAFLGFVVQHNVTGKGPFDNLVQHLSD 239 NEVGYPGGIFNPLNFAPT+EAKEKE+ANGRLAMLAFLGF+VQHNVTGKGPF+NL+QH+SD Sbjct: 178 NEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISD 237 Query: 240 PWHNTIVQTLRG 251 PWHNTIVQTL G Sbjct: 238 PWHNTIVQTLSG 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2717 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig479 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64862 75 4e-16 >Cs64862 Length = 266 Score = 75.1 bits (183), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 38/81 (46%), Positives = 55/81 (67%), Gaps = 1/81 (1%) Query: 78 DALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINLNIP 137 +ALKLG+C +VL L+++ +G P CC +++GL +LEAA+CLCT IR +L +N+ IP Sbjct: 171 NALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFIP 230 Query: 138 IALSLLLNACGNQVPRGFQCS 158 +AL L+ CG P GF C Sbjct: 231 LALPALI-TCGKTPPPGFVCP 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4022 (357 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5234 (270 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65106187 89 7e-20 >Cs65106187 Length = 201 Score = 88.6 bits (218), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 58/171 (33%), Positives = 92/171 (53%), Gaps = 5/171 (2%) Query: 9 SLSSPLIPVCEEDEERSHEK---WFKRXXXXX--XXKRQLWLAGPLICVSILQYSIQIIA 63 S S + PV E EE + +F+R K LA P I V +L + + Sbjct: 19 SNGSEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAILVYMLNNLVAMST 78 Query: 64 VMFVGHLGELSLSGATMALSFTSVTGFSLLMGMSSALDTFSGQCYGAKQYHMMGIHMQRA 123 +F GHLG L L+ ++ + V + L++GM SA +T GQ YGA++Y M+G+++QR+ Sbjct: 79 QIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQKYDMLGVYLQRS 138 Query: 124 MFVLLLVCIPLAIISANTRIILIALGQDADISTEAGKFARFNIPSLFAYAL 174 +L IPL +I ++ IL+ LG+ + I++ A F IP +FAYA+ Sbjct: 139 AVILTATGIPLMVIYICSKQILLLLGESSAIASAAAIFVFGLIPQIFAYAV 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2521 (137 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548447 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158352629 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361895 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4472 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1849 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89558065 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158358371 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2549 (341 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3413 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 120 5e-30 >Cs169106187 Length = 148 Score = 120 bits (302), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 54/139 (38%), Positives = 85/139 (61%), Gaps = 1/139 (0%) Query: 6 AQLRLMSDLKTIINEPPEGCSASPMSDDNLFVWSATIFGPDETPWEGGVFSLRLTFSERY 65 A R++ +LK + +PP CSA P+++D +F W ATI GP ++P+ GGVF + + F Y Sbjct: 2 ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 60 Query: 66 PEKPPRVRFTSEMFHPNVYHDGALCMDIIQDAWSPCHNVSTILTSVQSLLTDXXXXXXXX 125 P KPP+V F +++FHPN+ +G++C+DI+++ WSP +S +L S+ SLLTD Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 126 XXXXQLYQHDIKAYNKRVR 144 +Y+ D Y R Sbjct: 121 PEIAHMYKSDKAKYESTAR 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1900 (451 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs34689 518 e-149 >Cs34689 Length = 264 Score = 518 bits (1334), Expect = e-149, Method: Compositional matrix adjust. Identities = 246/252 (97%), Positives = 250/252 (99%) Query: 177 VSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 236 VSTSVVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS Sbjct: 1 VSTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 60 Query: 237 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF 296 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF Sbjct: 61 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF 120 Query: 297 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN 356 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGIN Sbjct: 121 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAAIKTKRTIQFVDWCPTGFKCGIN 180 Query: 357 YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG 416 YQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY+KRAFVHWYVGEGMEEG Sbjct: 181 YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEG 240 Query: 417 EFSEAREDLAAL 428 EFSEAREDLAAL Sbjct: 241 EFSEAREDLAAL 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig982 (534 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4657 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1785 (483 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig119 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs3951 289 2e-80 >Cs3951 Length = 185 Score = 289 bits (740), Expect = 2e-80, Method: Compositional matrix adjust. Identities = 139/188 (73%), Positives = 157/188 (83%), Gaps = 4/188 (2%) Query: 113 LEMDEEYEGNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDV 172 LEMD+EYEGN+EATGED+SVEP ++RRPFRALLDVGL++TTTGNRVFGALKGALDGG+D+ Sbjct: 2 LEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDI 61 Query: 173 PHSEKRFAGFSKDSKSLDAETHRKYIYGGHVAAYMGTLIEDEPEKYQTHFSXXXXXXXXX 232 PHS+KRFAGFSKD K LDAE HRKYIYGGHVAAYM TL+EDEPEKYQ+HF+ Sbjct: 62 PHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDA 121 Query: 233 XXXXXLYKKVHAAIRADPLEKKTAKPEPKQHKRFNLKKLTYEERKNKLIERLNAFNSAAQ 292 LYKKVHAAIRADP KK+ KP PK+HKR+NLKKLTYEERK KL+ERLNA NSA Sbjct: 122 DGLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV- 180 Query: 293 GDEDSDDE 300 D +DE Sbjct: 181 ---DEEDE 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4299 (462 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5776 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 191 9e-51 >Cs66150 Length = 305 Score = 191 bits (484), Expect = 9e-51, Method: Compositional matrix adjust. Identities = 107/249 (42%), Positives = 142/249 (57%), Gaps = 13/249 (5%) Query: 31 PVVKGLSWSFYDSSCPKLDSIVRKQLKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLD 90 P LS SFY S+CP + + + LKK F DI A L+RLHFHDCFV GCD S+LLD Sbjct: 29 PSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLD 88 Query: 91 GSASGPSEQQAPPNLSLRAKAFQIINDLREIVHSKCGRVVSCADLTALAARDAVFLSGGP 150 + + SE+ A PN + A+ F++I++++ V C RVVSCAD+ +AA +V LSGGP Sbjct: 89 STNTIDSEKFAAPN-NNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSGGP 147 Query: 151 EYEVPLGRKDGLNFATRNETLA--NLPAPTSNTTKLLTDLAKKNL-DATDVVALSGGHTI 207 + VPLGR+D T N LA NLP P +L + L D D+VALSG HT Sbjct: 148 SWAVPLGRRDS---RTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTF 204 Query: 208 GLGHCTSFTGRLYP-----TQDASMDKTFANDLKQVCPAADTNATTV-LDIRSPDTFDNK 261 G C F GRLY D ++D TF L+++CP D+ +PD FDNK Sbjct: 205 GRAQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNK 264 Query: 262 YYVDLMNRQ 270 Y+ +L R+ Sbjct: 265 YFSNLRGRK 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1052 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89544763 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 118 3e-29 >Cs169106187 Length = 148 Score = 118 bits (296), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 60/147 (40%), Positives = 88/147 (59%), Gaps = 4/147 (2%) Query: 7 RLFKEYKEVQREKVADPDIQLVCDDSNIFKWTALIKGPSETPFEGGIFQLAFAVPEQYPL 66 R+ KE K++Q++ V +D +F W A I GPS++P+ GG+F + P YP Sbjct: 5 RILKELKDLQKDPPTSCSAGPVAED--MFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPF 62 Query: 67 QPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNC 126 +PP+V F TK+FHPN++ G ICLDILK WSPA T+ V +I +L+ P PD PL Sbjct: 63 KPPKVAFRTKVFHPNIN-SNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVP 121 Query: 127 DSGNLLRAGDIKGYHSMARMYTRLAAM 153 + ++ ++ K Y S AR +T+ AM Sbjct: 122 EIAHMYKSDKAK-YESTARSWTQKYAM 147 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158365522 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93789 234 6e-64 >Cs93789 Length = 294 Score = 234 bits (596), Expect = 6e-64, Method: Compositional matrix adjust. Identities = 105/137 (76%), Positives = 122/137 (89%) Query: 75 MHCHGWRSVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLK 134 MH GWRS+YCMPKRPAFKGSAPINLSDRL+QVLRWALGSVEIL SRHCPIWYGYG LK Sbjct: 1 MHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEILFSRHCPIWYGYGGRLK 60 Query: 135 SLERFSYINSVVYPLTSIPLIAYCSLPAVCLLTGKFIVPEISNYASIIFMALFLSIAATS 194 LERF+Y+N+ +YPLT+IPL+ YC+LPAVCLLT KFI+P+ISN ASI+F++LFLSI AT Sbjct: 61 FLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQISNLASIVFISLFLSIFATG 120 Query: 195 VLEMQWGHVGIHDWWRN 211 +LEM+W VGI +WWRN Sbjct: 121 ILEMRWSGVGIDEWWRN 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372667 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10194 242 3e-66 >Cs10194 Length = 251 Score = 242 bits (617), Expect = 3e-66, Method: Compositional matrix adjust. Identities = 125/233 (53%), Positives = 159/233 (68%), Gaps = 4/233 (1%) Query: 1 MAKIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKL---GADTTVALFFIA 57 + IA G EA P+ RA + EF++T +F+FAG GS MA +KL GA+T L + Sbjct: 3 IRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVAAS 62 Query: 58 ITHALVVAVMISAG-HISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCXXXX 116 + HA + V ++ G +ISGGH+NPAVT G GG+I+L R +LYWI QLL + +C Sbjct: 63 VAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLK 122 Query: 117 XXXXXXXXPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGFV 176 +L+SGVG V++EI++TF L++TVYAT +DPKKGSL + P GF+ Sbjct: 123 FVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFI 182 Query: 177 VGANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYE 229 VGANILAGGAF GASMNPA SFGPALVSW W +HWVYWVGPLIGGGLAG +YE Sbjct: 183 VGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYE 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89540794 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60106184 143 1e-36 >Cs60106184 Length = 168 Score = 143 bits (360), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 67/85 (78%), Positives = 77/85 (90%) Query: 1 MASAEIEFRCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEK 60 MAS ++EFRCFVGGLAWAT + +L AF +G+I+ESKIINDRETGRSRGFGFVTF +EK Sbjct: 1 MASGDVEFRCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEK 60 Query: 61 AMRDAIEGMNGQDLDGRNITVNEAQ 85 +MRDAIEGMNGQ+LDGRNITVNEAQ Sbjct: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226877846 (48 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158350965 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3077 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67731 216 9e-59 >Cs67731 Length = 187 Score = 216 bits (551), Expect = 9e-59, Method: Compositional matrix adjust. Identities = 101/127 (79%), Positives = 111/127 (87%) Query: 39 ASGPKWAQKTITLPPQTRGCHLITPQIMNGIRQDLSGFNCGLAHLFLQHTSASLTINENY 98 AS P+WAQKT+TLPP RGCHLITP+I+ I QDLS F CGLAHLFL HTSASLTINENY Sbjct: 2 ASNPRWAQKTVTLPPLRRGCHLITPKIVKEIAQDLSEFKCGLAHLFLLHTSASLTINENY 61 Query: 99 DCDVRTDTETFLNRIVPEGNSAPWRHTLEGPDDMPAHIKSSMFGCQLSIPITNGKLNMGT 158 D DVR DTETFLN+IVPEG SAPW+HTLEGPDDMPAHIKSSMFGC L+IPIT+G+LNMGT Sbjct: 62 DSDVRDDTETFLNKIVPEGRSAPWKHTLEGPDDMPAHIKSSMFGCTLTIPITDGQLNMGT 121 Query: 159 WQGIWLC 165 WQ + C Sbjct: 122 WQELHGC 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4218 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs72108 226 2e-61 >Cs72108 Length = 189 Score = 226 bits (575), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 105/190 (55%), Positives = 135/190 (71%), Gaps = 2/190 (1%) Query: 1 MAFAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP 60 M+F GT QKC C+KTVY V++L+AD ++HK+CF+C HCKGTLKLSNY+S EGVLYC+P Sbjct: 1 MSFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFDQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAASKASGMFGGTRDKCFGCKNTVYPT 120 HF+QLFK +G+ +K+F+ K + P + P SKA+ MF GT++KC C TVYP Sbjct: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSP--SKAASMFSGTQEKCASCSKTVYPL 118 Query: 121 EKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIREKGNLSQLEGGGD 180 EKV V YHK CFKC+HGGC+ISPSNY A EG LYCKHH +QL +EKG+ + L Sbjct: 119 EKVAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSAS 178 Query: 181 NEKATAVAAE 190 ++A A E Sbjct: 179 MKRAAASVPE 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77981379 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1241 (276 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89550254 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs8154 136 1e-34 >Cs8154 Length = 173 Score = 136 bits (343), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 71/125 (56%), Positives = 81/125 (64%), Gaps = 35/125 (28%) Query: 130 ATVPDPDDLELWL-----------------------------------KVDGEVRQKGST 154 + VPDP +LELWL +VDGE+RQKGST Sbjct: 48 SAVPDPHNLELWLTVHNHYSLLSYFFMAFVKASNLFFTGWINFKCVSLQVDGEIRQKGST 107 Query: 155 KDMIFKIPFLISHISSIMTLLEGDVILTGTPKGVGPVKAGQKITAGITNLVDVQFNVEKR 214 KDMIF IP+LISHISSIMTL EGDVILTGTP+GVGPVK GQKITAGIT L+DV F++EKR Sbjct: 108 KDMIFMIPYLISHISSIMTLFEGDVILTGTPQGVGPVKVGQKITAGITGLLDVHFDIEKR 167 Query: 215 RQGSS 219 R+ S Sbjct: 168 RRPGS 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89545624 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4460 (431 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs113106184 554 e-160 >Cs113106184 Length = 384 Score = 554 bits (1427), Expect = e-160, Method: Compositional matrix adjust. Identities = 262/341 (76%), Positives = 289/341 (84%) Query: 75 TDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGDDSEVILYPQ 134 TDKIIAEYIWIGGSG+D+RSK+RT+ PV PS+LPKWNYDGSSTGQAPG+DSEVILYPQ Sbjct: 44 TDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 103 Query: 135 AIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAQVFSNQKVIDEVPWYGIEQEYTLL 194 AIFKDPFR GNNILV+CD+YTP GEPIPTNKRH AA++FS+ V+ E PWYGIEQEYTLL Sbjct: 104 AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYTLL 163 Query: 195 QSSVKWPLXXXXXXXXXXXXXXXXXXXADKSFGRDISDAHYKACLYAGINISGTNGEVMP 254 Q VKWPL ADK++GRDI D+HYKACLYAGINISG NGEVMP Sbjct: 164 QKDVKWPLGWPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP 223 Query: 255 GQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTK 314 GQWE+QVGP+VGI AGD +W +RYILERITE AGVVLS DPKPI+GDWNGAG H NYSTK Sbjct: 224 GQWEFQVGPAVGISAGDQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHANYSTK 283 Query: 315 SMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGLHETQNINKFSWGVANRGASI 374 SMR +GGFEVIKKAI L LRH EHI+AYGEGNERRLTG HET +IN F WGVANRGASI Sbjct: 284 SMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGNERRLTGKHETADINTFKWGVANRGASI 343 Query: 375 RVGRDTEKEGKGYLEDRRPASNMDPYTVTALLAETTILWEP 415 RVGRDTEKEGKGY EDRRPASNMDPY VT+++AETTILW+P Sbjct: 344 RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 384 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158378857 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158354686 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2876 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7970 191 7e-51 >Cs7970 Length = 119 Score = 191 bits (485), Expect = 7e-51, Method: Compositional matrix adjust. Identities = 90/114 (78%), Positives = 100/114 (87%) Query: 124 MKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYYE 183 MKGDYYRYLAEFK GD+RK A+ +M +Y+AA A TDL PTHPIRLGLALNFSVFYYE Sbjct: 1 MKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYE 60 Query: 184 ILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPE 237 ILNS E+AC +AKQAF+EAI+ELDTL EESYKDSTLIMQLLRDNLTLWTSD+ E Sbjct: 61 ILNSSEKACTMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQE 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2870 (408 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69106190 224 2e-60 >Cs69106190 Length = 396 Score = 224 bits (570), Expect = 2e-60, Method: Compositional matrix adjust. Identities = 111/261 (42%), Positives = 172/261 (65%), Gaps = 11/261 (4%) Query: 104 LVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLISWAVGLPKRAPM 163 L G +F W+ LNV+FNI NKK+ N FPYP+ S + LA G + L+SWA + + Sbjct: 103 LKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIAEAPKT 162 Query: 164 DSNQLKLLIPVAACHALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFILGQSIPLS 223 D K L PVA H +GHV + VS + VAVSFTH IK+ EP F+ S+F+ G+++P+ Sbjct: 163 DLEFWKSLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLFGETLPMP 222 Query: 224 LWLSLAPVVLGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAM--TDMDSTNLYA 281 +++SL P++ G ++A++TEL+FN +GF+ AMISN++F +R+I+SKK M + N YA Sbjct: 223 VYMSLLPIIGGCALAAVTELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYA 282 Query: 282 YISIIALFFCLPPALILEGPQLLKHGFADAIAKVGLVKFITDLVW----VGLFYHLYNQL 337 +S+++L P A+ +EGPQ+ G+ AIA++G + VW +FYHLYNQ+ Sbjct: 283 CLSMMSLLILTPFAIAVEGPQMWAAGWQKAIAQIG-----PNFVWWVAAQSIFYHLYNQV 337 Query: 338 ATNTLERVAPLTHAVGNVLKR 358 + +L++++PLT ++GN +KR Sbjct: 338 SYMSLDQISPLTFSIGNTMKR 358 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3140 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs91748 476 e-136 >Cs91748 Length = 265 Score = 476 bits (1224), Expect = e-136, Method: Compositional matrix adjust. Identities = 231/264 (87%), Positives = 238/264 (90%) Query: 1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE 60 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLI+ILRNRLKYALTYRE Sbjct: 1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE 60 Query: 61 VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK 120 VIAILMQRHVLVD KVRTDKTYP+GFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK Sbjct: 61 VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK 120 Query: 121 FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKVIDFIKFDXXXX 180 FKLCKVRSVQFGQK IPYINTYDGRTIRYPDPLIKANDTIKLDLETNK+ +FIKFD Sbjct: 121 FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNV 180 Query: 181 XXXXXXXXXXXXXXIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPK 240 IKNREKHKGSFETIH+QDA GHEFATRLGNVFTIGKGTKPWVSLPK Sbjct: 181 VMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPK 240 Query: 241 GKGIKLTIIEEARKRQAALQTATA 264 GKGIKL+IIEEARKRQA +A A Sbjct: 241 GKGIKLSIIEEARKRQALATSAAA 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57896440 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17782 67 2e-13 >Cs17782 Length = 216 Score = 67.0 bits (162), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 31/69 (44%), Positives = 43/69 (62%), Gaps = 5/69 (7%) Query: 4 DYYKLLQVEKSATEDELKKAYRKLAMKWHPDK-----NPTNKKEAETKFKQISEAYEVLS 58 ++Y +L + K T EL+ AY+KLA++WHPD+ N EA+ KF+ I AY VLS Sbjct: 10 NFYAVLGLNKECTATELRNAYKKLALRWHPDRCSASGNAKFVDEAKKKFQTIQHAYSVLS 69 Query: 59 DPQKRAIYD 67 D KR +YD Sbjct: 70 DANKRLLYD 78 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3391 (390 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60159 71 2e-14 >Cs60159 Length = 242 Score = 70.9 bits (172), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 33/88 (37%), Positives = 53/88 (60%) Query: 303 MITAGMDTTAISGEWAMAELIKNPRVQQKAQKELDRVIGLERVMTETDFSGLPYLQCVAK 362 +I G DTT+ + WA++ L+ N ++A +ELD+ +G ER + E+D L YLQ + K Sbjct: 32 LILGGSDTTSGTLTWAISLLLNNRHALKRAHEELDQQVGKERAVDESDTQNLVYLQAIIK 91 Query: 363 EALRMHPPTPLMLPHRANANVKIGGYDI 390 E LR++P PL+ P A + + GY + Sbjct: 92 ETLRLYPAGPLLAPREAMEDCTVSGYHV 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359308 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542771 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1993 (585 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs63894 363 e-102 >Cs63894 Length = 219 Score = 363 bits (932), Expect = e-102, Method: Compositional matrix adjust. Identities = 183/251 (72%), Positives = 196/251 (78%), Gaps = 34/251 (13%) Query: 50 SMRISDRNCTGVLCSHPLSRDIRIESLSVTFHGHDLIVDSELEXXXXXXXXXXXXXXCGK 109 +M+ISDR CTGVLCSHPLSRDIRIESLSVTFHGHDLIVDSELE CGK Sbjct: 3 AMQISDRTCTGVLCSHPLSRDIRIESLSVTFHGHDLIVDSELELNYGRRYGLLGLNGCGK 62 Query: 110 STLLTAIGCRELPIPEHMDIFHLSREIEASDMSSLEAVISCDXXXXXXXXXXXXXAAQDD 169 STLLTAIGCRELPIP+HMDI+HLSREIEASDMSSLEAVISCD Sbjct: 63 STLLTAIGCRELPIPDHMDIYHLSREIEASDMSSLEAVISCDE----------------- 105 Query: 170 GGGEQLERIYERLEALDAATAEKRAAEILYGLGFDKQMQAKKTRDFSGGWRMRIALARAL 229 ERL+ ++ AEILYGLGF+K MQAKKTRDFSGGWRMRIALARAL Sbjct: 106 ----------ERLKL-------EKEAEILYGLGFNKTMQAKKTRDFSGGWRMRIALARAL 148 Query: 230 FINPTILLLDEPTNHLDLEACVWLEETLKKFERILVVVSHSQDFLNGVCTNIIHMQSKKL 289 FINPTILLLDEPTNHLDLEACVWLEETLK F+RILVV+SHSQDFLNGVCTNIIHMQ+KKL Sbjct: 149 FINPTILLLDEPTNHLDLEACVWLEETLKNFDRILVVISHSQDFLNGVCTNIIHMQNKKL 208 Query: 290 KIYSGNYDQYV 300 K Y+GN+DQYV Sbjct: 209 KFYTGNFDQYV 219 Score = 76.6 bits (187), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 56/182 (30%), Positives = 89/182 (48%), Gaps = 20/182 (10%) Query: 410 RVALVGPNGAGKSTLLKLMTGELTPLDGMVRRHNHLRIAQFHQHLTEKLDM-ELSALQFM 468 R L+G NG GKSTLL + P+ +H+ I HL+ +++ ++S+L+ + Sbjct: 51 RYGLLGLNGCGKSTLLTAIGCRELPIP------DHMDI----YHLSREIEASDMSSLEAV 100 Query: 469 IKEYPGNEEEKMRAS-----IGKFGLTGKAQVMPMSNLSDGQRSRVIFAWLAFRQPQMLL 523 I +EE+++ + G Q + S G R R+ A F P +LL Sbjct: 101 IS----CDEERLKLEKEAEILYGLGFNKTMQAKKTRDFSGGWRMRIALARALFINPTILL 156 Query: 524 LDEPTNHLDIETIDSLAEALNEWDGGLVLVSHDFRLINQVAHEIWVCENQAVTRWEGDIM 583 LDEPTNHLD+E L E L +D LV++SH +N V I +N+ + + G+ Sbjct: 157 LDEPTNHLDLEACVWLEETLKNFDRILVVISHSQDFLNGVCTNIIHMQNKKLKFYTGNFD 216 Query: 584 QF 585 Q+ Sbjct: 217 QY 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5264 (447 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4974 (423 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158371151 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4717 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs23635 135 3e-34 >Cs23635 Length = 278 Score = 135 bits (341), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 79/227 (34%), Positives = 120/227 (52%), Gaps = 18/227 (7%) Query: 14 LCIAASPQISASTADYKNAYEAQKADRVIGLPGQPPVKFDQYAGYVTVNETHGRALFYWF 73 LC+ + +S+S Q + G G P K + GY+ V + LFY+F Sbjct: 9 LCVGLNMVLSSSQ---------QIITTLPGFDGDLPFKLE--TGYIGVGQNDDVQLFYYF 57 Query: 74 FEAVKTPQDKPLVLWLNGGPGCSSIGYGASEELGPF-FPQKGAK---PKLKYNPYTWNNA 129 E+ ++P+D PLVLWL GGPGCS G E+GP F + +K PK NPY+W Sbjct: 58 IESERSPEDDPLVLWLTGGPGCSGFS-GLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKV 116 Query: 130 ANLLFLESPVGVGFSYTNTTKDISQLGDTITAEDSHKFLINWFKRFPQYKSHDFYITGES 189 AN++FL++PVG GFSY NT + + DT++A ++ FL W P + ++ YI G+S Sbjct: 117 ANIIFLDAPVGTGFSYANTWQGYI-MNDTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDS 175 Query: 190 YGGHYVPQLSELVYDRNKNASKETYINFKGFMIGNAAIDDETDQKGL 236 Y G VP + + + D + +N KG+++GN D +Q + Sbjct: 176 YSGIIVPMIVQHISD-GIDVGHRPRMNLKGYLLGNPLTDSTENQNSV 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5275 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103490 189 3e-50 >Cs103490 Length = 224 Score = 189 bits (479), Expect = 3e-50, Method: Compositional matrix adjust. Identities = 102/200 (51%), Positives = 127/200 (63%), Gaps = 24/200 (12%) Query: 45 NPLRVSISRNVWISGNDELKLMKNKKKSIRRGMSAVCYAAPISVHNIQWIATISLATLMF 104 NPLR+S++ ++E+K M K+ S RG SAVCYA+P++ N+QWI+TIS LM Sbjct: 48 NPLRLSVN-------HEEMK-MVTKRNS--RGFSAVCYASPLTARNLQWISTISSTVLML 97 Query: 105 AKGTAVQKSFLVPLFALQAPGSFITWIKGEYGXXXXXXXXXXXXXXYYPAIHSNHLVSFG 164 AKGTAV KSFLVPLFALQAP I+WIKGEYG + P Sbjct: 98 AKGTAVPKSFLVPLFALQAPADVISWIKGEYGIWAAFLALLVRLFFFIP----------- 146 Query: 165 SYSGXXXXXXXXXXXXXXXXYQVMSLRGKQEGAIVSLVIAGYLAFQHFSRTGSLNQSFDR 224 G +QV++LRG Q+GAI+SLVIAGYLAFQHFSR G+L ++F++ Sbjct: 147 ---GELELPFMALLLVIVAPHQVLTLRGTQQGAIISLVIAGYLAFQHFSRAGNLRKAFEQ 203 Query: 225 GSIVATLAIICITVLSCLFL 244 GS+VATLAIICIT LSCLFL Sbjct: 204 GSVVATLAIICITALSCLFL 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3826 (597 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11568 61 3e-11 >Cs11568 Length = 204 Score = 61.2 bits (147), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 30/84 (35%), Positives = 51/84 (60%) Query: 335 ATPETSGSKTLFAGNLSYNIEQKDVVEFFKNVGQVVDVRLSSDADGNFKGYGHVEFATAE 394 A E S+++F GN+ Y+ ++V + F++ G V V + +D G KGY +VEF +E Sbjct: 68 ANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFGQPKGYAYVEFLQSE 127 Query: 395 EAQKAVGLNGSDLFGRPIRLDLAR 418 Q+A+ LN S+L GR +++ + R Sbjct: 128 AVQEALHLNESELHGRQLKVTVKR 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359037 (52 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig395 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1985 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5748 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42616 471 e-135 >Cs42616 Length = 265 Score = 471 bits (1213), Expect = e-135, Method: Compositional matrix adjust. Identities = 228/265 (86%), Positives = 240/265 (90%) Query: 1 MATSAIQQSAFAGQTALKPSNELVRKIGSLGGGRISMRRTVKSAPESIWYGPDRPKYLGP 60 MATSAIQQSAFAGQTAL+ SNE VRK+G GGRI+MRRTVKSAP+SIWYGPDRPKYLGP Sbjct: 1 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSAPQSIWYGPDRPKYLGP 60 Query: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSK 120 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+LSK Sbjct: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK 120 Query: 121 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVXXXX 180 NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYR+ Sbjct: 121 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGGP 180 Query: 181 XXXXXXXXXXXXAFDPLGLADDPEAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIE 240 AFDPLGLADDP+ FAELKVKE+KNGRLAM SMFGFFVQAIVTGKGPIE Sbjct: 181 LGEGLDPLYPGGAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE 240 Query: 241 NLYDHVADPVANNAWAYATNFVPGK 265 NLYDH+ADPVANNAWAYATNFVPGK Sbjct: 241 NLYDHIADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357238 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4754 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4285 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4401 98 1e-22 >Cs4401 Length = 355 Score = 97.8 bits (242), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 92/307 (29%), Positives = 133/307 (43%), Gaps = 35/307 (11%) Query: 3 VGFLGLGIMGKAIAMNLLRHGFKVTVWNRTLSKCDELAEHGASVAQTPAAVVTKCKYTFA 62 VGF+GLG MG +A NL++ G+K+ V + + ++ G +TP V Sbjct: 48 VGFIGLGNMGFRMASNLMKAGYKMAVHDVNCNVMKMFSDMGVPTKETPFEVAEASDVVIT 107 Query: 63 MLSDPSAALAVVFGKDGIVEHVSGGKG-----YIDMSTVDAATSSKISEAIT------KK 111 ML S L V G +G+++ GG ID ST+D TS IS A++ KK Sbjct: 108 MLPSSSHVLDVYNGPNGLLQ---GGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEKK 164 Query: 112 GGY----FLEAPVSGSKKPAEDGQLVILAAGEQALYDEVLPAFNVIGKKSFYLGQVGNGA 167 + L+APVSG AE G L + G + Y P F +GK + Y G GNGA Sbjct: 165 DSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGA 224 Query: 168 KMKLVVNMIMGSMMNAFSEGLVLAGRSGLDPSVLLDILDLGAIA-------NPMFRMKGP 220 K+ N+ M M SE L L G+ S L IL+ + NP+ P Sbjct: 225 AAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPV-----P 279 Query: 221 TMIQG-----SHPPAFPLKHQQKDMRLALSLGDDTSVSMPVXXXXXXXXXXXRSMGLGEL 275 +++G ++ F K KD+ LAL+ + V P+ G Sbjct: 280 GVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSK 339 Query: 276 DFSAVYE 282 DFS V++ Sbjct: 340 DFSCVFQ 346 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4105 (385 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158378767 (63 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5427 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2099 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs71808 488 e-140 >Cs71808 Length = 264 Score = 488 bits (1256), Expect = e-140, Method: Compositional matrix adjust. Identities = 243/265 (91%), Positives = 250/265 (94%), Gaps = 3/265 (1%) Query: 1 MAASTMALSSPTFAGKAVQLAPT--EVFGTGRISMRKTVGKAVSSGSPWYGPDRVKYLGP 58 MA STMALSS +F GKAV LAP+ E+ GRISMRKT K+VSSGSPWYGPDRVKYLGP Sbjct: 1 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGP 59 Query: 59 FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAR 118 SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLAR Sbjct: 60 LSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR 119 Query: 119 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGP 178 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGP Sbjct: 120 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGP 179 Query: 179 LGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLE 238 LGEV DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLE Sbjct: 180 LGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE 239 Query: 239 NLADHLADPVNNNAWSYATNFVPGK 263 NLADHLADPVNNNAW+YATNFVPGK Sbjct: 240 NLADHLADPVNNNAWAYATNFVPGK 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1429 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2312 (113 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2206 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs71808 485 e-139 >Cs71808 Length = 264 Score = 485 bits (1248), Expect = e-139, Method: Compositional matrix adjust. Identities = 241/265 (90%), Positives = 249/265 (93%), Gaps = 3/265 (1%) Query: 1 MAASTMALSSPTFAGKAVQLAPA--EVFGTGRISMRKTVGKAVSSGSPWYGPDRVKYLGP 58 MA STMALSS +F GKAV LAP+ E+ GRISMRKT K+VSSGSPWYGPDRVKYLGP Sbjct: 1 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGP 59 Query: 59 FSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAR 118 SGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLAR Sbjct: 60 LSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR 119 Query: 119 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGP 178 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGP Sbjct: 120 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGP 179 Query: 179 LGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLE 238 LGEV DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLE Sbjct: 180 LGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE 239 Query: 239 NLADHLADPVNNNAWSYATNFVPGK 263 NLADHLADPVNNNAW+YATNFVPGK Sbjct: 240 NLADHLADPVNNNAWAYATNFVPGK 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2468 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1014 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3157 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1473 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7027 115 5e-28 >Cs7027 Length = 345 Score = 115 bits (288), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 67/163 (41%), Positives = 85/163 (52%) Query: 23 IVLKVDMHCEACARKVARALKGFEGVEEVTTDXXXXXXXXXXXXXDPIKVCERLQKKSGK 82 IVLKV MHCE CARKV R LKGFEGVE+V TD DP+KV +R+Q+KS + Sbjct: 63 IVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRVQRKSHR 122 Query: 83 KVELISPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVTVILKVRMHCEACAQVLQKRIR 142 +VEL+SP+ V+ V+LKV MHCE C+ ++KRI Sbjct: 123 QVELLSPIPKPTAAEEEKKAEEKAPPKPEEKKEEPQVIIVVLKVHMHCEGCSLEIKKRIL 182 Query: 143 KIQGVESXXXXXXXXXXXXXXXXXPAKLADDVYKKTRKPVSIV 185 +++GVES P KL D VYK+T K IV Sbjct: 183 RMEGVESAEPDLKNSQVTVKGVFDPPKLVDYVYKRTGKHAVIV 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4113 (368 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81333 680 0.0 >Cs81333 Length = 370 Score = 680 bits (1754), Expect = 0.0, Method: Compositional matrix adjust. Identities = 329/370 (88%), Positives = 349/370 (94%), Gaps = 2/370 (0%) Query: 1 MGEVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNID 60 MGE+TNV EYEAIAK+KLPKM +DYYASG+EDQWTL ENRNAFS+ILFRPRILIDVS ID Sbjct: 1 MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID 60 Query: 61 MTTTVLGFKISMPIMIAPTAFQKMAHPEGEYXXXXXXXXXGTIMTLSSWATSSVEEVAST 120 M TTVLGFKISMPIMIAPTA QKMAHPEGEY GTIMTLSSW+TSSVEEVAST Sbjct: 61 MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST 120 Query: 121 GPGIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLT 180 GPGIRFFQLYVYKDR+VVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLT Sbjct: 121 GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLT 180 Query: 181 LKNFEGLDLGKMDKANDSGLASYVAGQIDRSLSWKDVQWLQTITKLPILVKGVLTAEDAR 240 LKNF+GLDLGKMD+ANDSGLA+YVAGQIDRSLSWKDV+WLQTITKLPILVKGVLTAEDAR Sbjct: 181 LKNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKDVKWLQTITKLPILVKGVLTAEDAR 240 Query: 241 LSVQSGAAGIIVSNHGARQLDYVPSTIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALA 300 ++VQ+GAAGIIVSNHGARQLDYVP+TIMALEEVVKA QGRIPVFLDGGVRRGTDVFKALA Sbjct: 241 IAVQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALA 300 Query: 301 LGASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITRNHIVADWD 360 LGASGIFIGRPVV+SLAAEGE GVR+VL+MLREEFEL MALSGCRSLKEITR+HIV +WD Sbjct: 301 LGASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWD 360 Query: 361 A--PRPVPRL 368 A PRPVPRL Sbjct: 361 ASLPRPVPRL 370 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51048958 (102 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5788 (224 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78954 107 1e-25 >Cs78954 Length = 207 Score = 107 bits (267), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 68/166 (40%), Positives = 82/166 (49%), Gaps = 19/166 (11%) Query: 39 FNTNAQXXXXXXXXXXXXXXXXTSGSPY-RRRDPI--DVFDPFYDESRSIARSLNQVPRS 95 FNTNA S + RRRD DVFDPF RS Sbjct: 35 FNTNAVHQYDDGGDDRDLDIDRRSARSFPRRRDDFFSDVFDPF------------SPTRS 82 Query: 96 LSQVLNLMDQFMENPXXXXXXXXXXXXXXXXWDVKETEDSLLLRMDMPGLNKEDVKISVE 155 LSQVLN MDQ ENP WD KET+D+L L +DMPGL KEDV++S+E Sbjct: 83 LSQVLNFMDQMTENPFFSGTRGGLRRG----WDAKETDDALNLSIDMPGLGKEDVRVSLE 138 Query: 156 QGTLTVXXXXXXXXXXXXXXRRFSTRLDLPAKIYELNSIKAEMKNG 201 Q TL + RR+++R+DLP K+Y + IKAEMKNG Sbjct: 139 QNTLVIRGEGGKEGEDEESVRRYTSRIDLPEKLYRTDQIKAEMKNG 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2701 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4792 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4826 469 e-134 >Cs4826 Length = 268 Score = 469 bits (1207), Expect = e-134, Method: Compositional matrix adjust. Identities = 229/243 (94%), Positives = 235/243 (96%) Query: 17 RPNTNSLRDVVPMGPGKYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGL 76 R N+L+DVVPMG KYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGL Sbjct: 26 RTTANALKDVVPMGNAKYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGL 85 Query: 77 SADPEAFAKNRALEVIHGRWAMLGAFGCITPEVLEKWVRVDFKEPVWFKAGAQIFSEGGL 136 SADPEAFA+NRALEVIHGRWAMLGA GCITPEVLEKW+RVDFKEPVWFKAGAQIFSEGGL Sbjct: 86 SADPEAFARNRALEVIHGRWAMLGALGCITPEVLEKWLRVDFKEPVWFKAGAQIFSEGGL 145 Query: 137 DYLGNPNLVHAQSILAVLGSQVLLMGLVEGFRINGLDGVGEGNDLYPGGQYFDPLGLADD 196 DYLGNPNLVHAQSILAVLG QV+LMGLVEGFRINGL GVGEGNDLYPGGQYFDPLGLADD Sbjct: 146 DYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLPGVGEGNDLYPGGQYFDPLGLADD 205 Query: 197 PVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFV 256 PVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHL+NPVANNAWVYATKFV Sbjct: 206 PVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLENPVANNAWVYATKFV 265 Query: 257 PGS 259 PGS Sbjct: 266 PGS 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig890 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3836 (408 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89557288 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77980986 (111 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4537 (586 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158371956 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65106187 239 1e-65 >Cs65106187 Length = 201 Score = 239 bits (611), Expect = 1e-65, Method: Compositional matrix adjust. Identities = 120/160 (75%), Positives = 144/160 (90%) Query: 40 YFHRLRRATWVELKILFRLAAPAVVVYLLNNVISMSTQIYCGHLGNLELAASSLGNTGIQ 99 +F R+++ATW+ELK LFRLAAPA++VY+LNN+++MSTQI+CGHLGNLELAA SLGNTGIQ Sbjct: 42 FFQRIKKATWIELKNLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQ 101 Query: 100 VFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTILLMATGIPVMFIYIFSKPLLL 159 VFAYGLMLGMGSA ETLCGQAYGA KY+MLG+YLQRS ++L ATGIP+M IYI SK +LL Sbjct: 102 VFAYGLMLGMGSATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYICSKQILL 161 Query: 160 ALGESSTIASAAAIFVYGLIPQIFAYACNFPIQKFLQAQS 199 LGESS IASAAAIFV+GLIPQIFAYA NFP ++F + ++ Sbjct: 162 LLGESSAIASAAAIFVFGLIPQIFAYAVNFPYKRFYRHKA 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158355803 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73025 303 7e-85 >Cs73025 Length = 382 Score = 303 bits (776), Expect = 7e-85, Method: Compositional matrix adjust. Identities = 152/153 (99%), Positives = 152/153 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF 153 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM 153 Score = 303 bits (776), Expect = 7e-85, Method: Compositional matrix adjust. Identities = 152/153 (99%), Positives = 152/153 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 137 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 196 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF 153 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 197 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM 229 Score = 303 bits (776), Expect = 7e-85, Method: Compositional matrix adjust. Identities = 152/153 (99%), Positives = 152/153 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 213 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 272 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF 153 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 273 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM 305 Score = 303 bits (775), Expect = 8e-85, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 289 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 348 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 152 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 349 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1582 (391 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69506 177 1e-46 >Cs69506 Length = 247 Score = 177 bits (450), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 93/209 (44%), Positives = 131/209 (62%), Gaps = 3/209 (1%) Query: 116 SAASIFAILDRKSKIDASDDSGTTIENLKGEIEFSHVSFKYPNRPNVPIFQDLCLAIRYG 175 ++ +F ++D D G ++ L G I+F VSF+Y +R VP+ Q + +++ G Sbjct: 40 ASEKVFQLMDLMPS-DQFMSKGKKLQRLMGRIDFVDVSFRYSSREMVPVLQHVNISVNPG 98 Query: 176 KTVALVGESGSGKSTVVSLLQRFYDPDSGHITLDGTKLQTLQLKWLRQQMGLVSQEPILF 235 + VA+ G SGSGKST+V+LL R Y+P +G I +DG ++ + +KWLR ++G V QEP LF Sbjct: 99 EVVAIAGLSGSGKSTLVNLLLRLYEPTNGQILIDGFPIKEVDIKWLRGRIGFVGQEPKLF 158 Query: 236 NDTIRANIAYGKEGNVTXXXXXXXXXXXXXHKFISSLQKGYDTLVGERGVQLSGGQKQRV 295 I +NI+YG ++ H FI SL GY+TLV + LSGGQKQR+ Sbjct: 159 RMDISSNISYGCTRDIKQQDIEWAAKQAYAHDFIMSLPSGYETLVDDD--LLSGGQKQRI 216 Query: 296 AIARAIMKAPKILLLDEATSALDAESERV 324 AIARAI+ P IL+LDEATSALDAESE + Sbjct: 217 AIARAILXDPTILILDEATSALDAESEHI 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5016 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2866 (330 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 124 2e-30 >Cs66150 Length = 305 Score = 124 bits (310), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 79/256 (30%), Positives = 114/256 (44%), Gaps = 10/256 (3%) Query: 23 ESNEEDPGLVMNFYSDSCPQAEEIVREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDAXX 82 E + L +FYS +CP + + +K + S +R FHDC V CDA Sbjct: 26 EGSPSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASI 85 Query: 83 XXXXXXXXXXEK-EMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLG 141 EK + R F I+ +K A+ER CP VVSC+DIL ++A V G Sbjct: 86 LLDSTNTIDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSG 145 Query: 142 GPFIPLKTGRRDGRRSRAEILEEYLPDHNESMSTVLEKFSAMGI-DTPGVVALLGAHSVG 200 GP + GRRD R + + + LP +++ + F +G+ D +VAL GAH+ G Sbjct: 146 GPSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFG 205 Query: 201 RTHCVKLVHRLY-----PEVDPALNPDHVPHMLKKCPDAIPDPKAVQYVRNDRGTPMIFD 255 R C RLY + DP L+ + + K CP + D TP +FD Sbjct: 206 RAQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANF---DVTTPDVFD 262 Query: 256 NNYYRNILDNKGLMMV 271 N Y+ N+ K V Sbjct: 263 NKYFSNLRGRKAFCRV 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77980463 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig198 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig268 (394 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1399 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27951 194 3e-52 >Cs27951 Length = 235 Score = 194 bits (493), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 88/144 (61%), Positives = 119/144 (82%), Gaps = 1/144 (0%) Query: 1 MREESKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPSH-SLFDRYNDSYLRRIGSNVL 59 R++SKK T++LV+ME SYLTVDFFRKLPQD+++GGNP+ S DRY + + RRIGSNV Sbjct: 92 FRDDSKKTTMRLVEMESSYLTVDFFRKLPQDMERGGNPTAPSAADRYTEGHFRRIGSNVS 151 Query: 60 AYVNMVCASLRNSIPKSVVYCQVREAKRSLLDRFFTDMGKLDAKQLSSLLNEDPAVMERR 119 +YV MV +L+N+IPK+VV+CQV+EAKRSLLD F+ +GK + KQL+ LL+EDP +MERR Sbjct: 152 SYVGMVSETLKNTIPKAVVHCQVKEAKRSLLDHFYAQLGKKEGKQLAQLLDEDPMLMERR 211 Query: 120 SALAKRLELYRSAQAEMDTVAWSK 143 AKRLELY+SA+ E+D+V+W++ Sbjct: 212 QQCAKRLELYKSARDEIDSVSWTR 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372649 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3495 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89543621 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2143 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158364149 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs194106183 144 3e-37 >Cs194106183 Length = 182 Score = 144 bits (363), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 64/83 (77%), Positives = 76/83 (91%) Query: 27 PFTGLKSASAFPITRKTNSDITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTSESLA 86 PFTGLKS+SAFP T+KTN+DITS+ SNGGRVQCM+VWPP GLKKFETLSYLPPL+ E+L Sbjct: 27 PFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALL 86 Query: 87 KEVDFLLRNKWVPCLEFELEKGF 109 KE+ +LLR+ W+PCLEFELEKG+ Sbjct: 87 KEISYLLRSGWIPCLEFELEKGW 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158352558 (141 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2063 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158360568 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18122 122 8e-31 >Cs18122 Length = 107 Score = 122 bits (307), Expect = 8e-31, Method: Compositional matrix adjust. Identities = 66/92 (71%), Positives = 73/92 (79%) Query: 17 ISMLQTMVMAXXXXXXXXXXXXQYGPGSLKSYQCPSQCTRRCSKTQYHKPCMFFCQKCCS 76 ISMLQTMV+A YGPG++KSYQCP +C RCS+TQY KPC+FFC KCC Sbjct: 16 ISMLQTMVVAANGQGGRHYDSKHYGPGTVKSYQCPGKCDTRCSQTQYRKPCLFFCNKCCK 75 Query: 77 KCLCVPPGFYGNKAVCPCYNNWKTKEGGPKCP 108 KCLCVPPG+YGNKAVCPCYNNWKTKEGGPKCP Sbjct: 76 KCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 285809339 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548891 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3804 (391 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25409 70 4e-14 >Cs25409 Length = 359 Score = 69.7 bits (169), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/85 (43%), Positives = 46/85 (54%), Gaps = 8/85 (9%) Query: 93 GPKTV--KSVECNSQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTX 150 PK V K V N+Q K K YRG+RQR WGKW AEIR P+ R+WLGTF+T Sbjct: 145 SPKAVPMKHV-SNAQVAKPTKL-----YRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTA 198 Query: 151 XXXXXXXXXXXXXIRGKKAKVNFPE 175 +RG+ A++NFP Sbjct: 199 EEAALAYDQAAYKLRGEFARLNFPH 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363939 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3714 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158367455 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5722 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3643 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52926 287 1e-79 >Cs52926 Length = 231 Score = 287 bits (734), Expect = 1e-79, Method: Compositional matrix adjust. Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 1/168 (0%) Query: 1 MGPVLSSHPINIYLIWYGRWSLPQKLLIKDFLLSIS-TTAAPSPSVAEWWRTVSLYTDQT 59 MGPVLSS PINIYL+WYGRW QKLLIKDF+LSIS AA PSV++WWRTVSLYTDQT Sbjct: 63 MGPVLSSSPINIYLVWYGRWPNYQKLLIKDFILSISPAAAAAKPSVSDWWRTVSLYTDQT 122 Query: 60 GANVSRSVVVAGEHADVKYSQGKALTRLSVQQVIGNAVRSAPFPADHKHGIYLVLTSDDV 119 GANVSR+V++AGEH+D YS GK+LTRLSVQQVIG AV SAPFP DHK+GI+L+LT+DDV Sbjct: 123 GANVSRTVLIAGEHSDHLYSHGKSLTRLSVQQVIGTAVESAPFPVDHKNGIFLILTADDV 182 Query: 120 TMQDFCRAVCGFHYFTFPSMVGYTLPYAWIGNSAKQCPEVCAYPFALP 167 TMQD+CRAVCGFHYFTFPSMVGYT+PYAWIGNS KQCPEVC+YPFA+P Sbjct: 183 TMQDYCRAVCGFHYFTFPSMVGYTMPYAWIGNSTKQCPEVCSYPFAVP 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1663 (176 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33157 192 2e-51 >Cs33157 Length = 179 Score = 192 bits (488), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 107/177 (60%), Positives = 122/177 (68%), Gaps = 8/177 (4%) Query: 2 VGQSTVTKPSRSDHVLDADEQLRISTQIKAQFESAAPKRPMKPNRSEPD--SPTPALSIV 59 V Q TVTKPSRSD VLDA EQ+RI+ Q++AQ +S APKRP KPNRSEPD +PT S Sbjct: 6 VDQWTVTKPSRSDEVLDAVEQVRIANQVRAQIDSMAPKRPTKPNRSEPDFIAPTNDQSAA 65 Query: 60 DQPNIPELHKLRTLQSQSHV-IISDEGANSLVQDEFVDTQYYKELNSIDKQHHMTGTGFI 118 + NIPEL KLR+LQSQSHV +I N+ QDEFV+TQYY +L SIDK HH TGTGFI Sbjct: 66 NG-NIPELDKLRSLQSQSHVGVIYSAEVNNTAQDEFVETQYYNQLVSIDKDHHTTGTGFI 124 Query: 119 RVEREEEGSNDIQLTGIHGGSNGIVRAGFRSNPATNDWIPKTDEDLVFISSKPNRSE 175 RV E G N G G R ++SNPATNDWIP + D FISSKPNRSE Sbjct: 125 RVANEGNGYNIRVGKGCDSGD----RPVYKSNPATNDWIPSVEYDQAFISSKPNRSE 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1990 (354 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106190 227 2e-61 >Cs169106190 Length = 361 Score = 227 bits (578), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 129/306 (42%), Positives = 176/306 (57%), Gaps = 20/306 (6%) Query: 41 KHQKVYNGIGEEETRFQIFKDNLKFVDEHNAENRSYKVGMNAFADLTNQEYRARFLGTRP 100 ++ K+Y + E + RF F NL + N + SY++G+N FAD + +E++ LG Sbjct: 68 RYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRHRLGAAQ 127 Query: 101 DPKRRVMKAKNPSLRYVVLPDDKLPESVDWRALGAVNPIKNQGSCGSCWAFSTVAAVEGI 160 + L D LPE+ DWR G V+P+K+QG CGSCW FST ++E Sbjct: 128 NCSATTKGNHK-------LTADVLPETKDWRESGIVSPVKDQGHCGSCWTFSTTGSLEAA 180 Query: 161 NKIATGELVSLSEQELVDCDRKY-NAGCNGGLMDYAFEFIIKNGGMDTESDYPYKAVNQQ 219 A G+ +SLSEQ+LVDC + + N GCNGGL AFE+I NGG+DTE YPY + Sbjct: 181 YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV 240 Query: 220 CDASLENNKVVSIDGYEDVPAFNEEALKKAVAH-QPVSVAIEAGGVALQLYDSGVFTG-E 277 C S EN V +D ++ E+ L+ AV +PVSVA E + Y SGV++ + Sbjct: 241 CKFSSENVGVQVLDSV-NITLGAEDELQHAVGLVRPVSVAFEVVD-GFRFYKSGVYSSTK 298 Query: 278 CGSA---LDHGVVAVGYGTENGVDYWLVRNSWGTNWGEGGYFKIERNVKSTYTGKCGIAM 334 CG+ ++H VVAVGYG E+GV YWL++NSWG NWG+ GYFK+E CGIA Sbjct: 299 CGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMG-----KNMCGIAT 353 Query: 335 EASYPT 340 ASYP Sbjct: 354 CASYPV 359 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig449 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76516 277 7e-77 >Cs76516 Length = 291 Score = 277 bits (708), Expect = 7e-77, Method: Compositional matrix adjust. Identities = 125/155 (80%), Positives = 142/155 (91%) Query: 28 AKFDELFQPYWASDHFTYEGELLHMKLDNYSGAGFSSKNKYMFGKVTVQIKLVEGDSAGT 87 AKFD+L+Q WA DH Y+G+ L + LDNYSGAGF+SK+KY+FGKV++QIKLV GDSAGT Sbjct: 23 AKFDDLYQTSWAFDHVQYDGDTLKLNLDNYSGAGFASKSKYLFGKVSIQIKLVGGDSAGT 82 Query: 88 VTAFYMSSDGPLHNEFDFEFLGNTTGEPYSVQTNIYINGVGNREQRLDLWFDPTKDFHSY 147 VTAFYMSSDGP HNEFDFEFLGNTTGEPY VQTN+Y+NGVGNREQRLDLWFDPTK+FH+Y Sbjct: 83 VTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYVNGVGNREQRLDLWFDPTKEFHTY 142 Query: 148 SIFWNQRQVVFLVDETPIRVHTNMESKGVPFPKDQ 182 S+ WNQRQVVFLVDETPIRVHTN+E KG+PFPKDQ Sbjct: 143 SLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKDQ 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3225 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5857 (276 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89552570 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5766 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103814 98 7e-23 >Cs103814 Length = 211 Score = 97.8 bits (242), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 46/54 (85%), Positives = 46/54 (85%) Query: 12 MTSLPPNTITTEQIQKCLDENKKLILAILDNQNLGKLAECAQYQTQLQKNLMYL 65 M S PP ITTEQIQK LDENKKLILAILDNQNLGKL ECA YQ QLQKNLMYL Sbjct: 11 MPSFPPTNITTEQIQKYLDENKKLILAILDNQNLGKLTECAHYQAQLQKNLMYL 64 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4859 (544 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39278 64 4e-12 >Cs39278 Length = 181 Score = 63.9 bits (154), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 28/48 (58%), Positives = 36/48 (75%) Query: 489 REAALIKFRLKRKDRCFEKKVRYQSRKILAEKRPRVKGQFVHRAHIDS 536 REA ++++R KRK+R FEK +RY SRK AE RPR+KG+F RA DS Sbjct: 106 REARVLRYREKRKNRKFEKTIRYHSRKAYAETRPRIKGRFAKRAEADS 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3999 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103630 615 e-178 >Cs103630 Length = 345 Score = 615 bits (1585), Expect = e-178, Method: Compositional matrix adjust. Identities = 302/332 (90%), Positives = 315/332 (94%), Gaps = 4/332 (1%) Query: 11 PVLDKSEWVKGQTLLRQPSVSSVVRCHPSATSGLTIRA-SYADELVKTAKTVASPGRGIL 69 PVLDKSEWVKGQ + RQ +VS VR PS S LTIRA SYADELVKTAKTVASPGRGIL Sbjct: 14 PVLDKSEWVKGQAI-RQSTVS--VRSLPSGPSALTIRAGSYADELVKTAKTVASPGRGIL 70 Query: 70 AMDESNATCGKRLASIGLENTEANRQAYRTLLVTVPGLGNYVSGAILFEETLYQSTVDGK 129 AMDESNATCGKRLASIGLENTEANRQAYRTLLVT PGLG Y+SGAILFEETLYQST DGK Sbjct: 71 AMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGK 130 Query: 130 KIVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVV 189 K+VDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVV Sbjct: 131 KMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVV 190 Query: 190 SIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHGIDRTFEVAQAVWAEV 249 SIPNGPSALAVKEAAWGLARYAAI+QD+GLVPIVEPEILLDG+HGIDRTFEVA+ VWAEV Sbjct: 191 SIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEV 250 Query: 250 FFYLAQNNVLFEGILLKPSMVTPGAECKERATPEQVADYTLKLLQRRIPPAVPGIMFLSG 309 FFYLA+NNV+FEGILLKPSMVTPGAECKE+ATP+QVA+YTLKLL RRIPPAVPGIMFLSG Sbjct: 251 FFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSG 310 Query: 310 GQSEVEATLNLNAMNQSPNPWHVSFSYARALQ 341 GQSEVEATLNLNAMNQ PNPWHVSFSYARALQ Sbjct: 311 GQSEVEATLNLNAMNQGPNPWHVSFSYARALQ 342 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2950 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 201 5e-54 >Cs99541 Length = 211 Score = 201 bits (511), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 100/209 (47%), Positives = 132/209 (63%), Gaps = 2/209 (0%) Query: 9 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDT 68 Y YLFK ++IGD+GVGKS LL +FT F TIGVEF R I +D+K +K QIWDT Sbjct: 3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDT 62 Query: 69 AGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKAD 128 AGQE +R+IT +YYRGA GALLVYD+TR TF ++ WL++ R H ++N+ IML+GNK D Sbjct: 63 AGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCD 122 Query: 129 LRHLRAVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEVGDDP 188 L H RAVS E+ + FA+ FME SA + NVE AF + IY+ + +V ++ Sbjct: 123 LAHRRAVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSNES 182 Query: 189 AAVPKGQTINVG--GKDDVSAIKKAGCCS 215 + G G G D S+ + GCCS Sbjct: 183 YGIKVGYGGIPGPSGGRDGSSSQAGGCCS 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2686 (408 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4694 (351 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 185 5e-49 >Cs47542 Length = 355 Score = 185 bits (470), Expect = 5e-49, Method: Compositional matrix adjust. Identities = 109/331 (32%), Positives = 178/331 (53%), Gaps = 34/331 (10%) Query: 26 VPLIDLSPLTSADSISDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTARKF 85 +P+ID+ L S +S+ A ++ ACK WGFFQ++NHGV EKV+ + F Sbjct: 47 IPVIDMQSLLSEESMDSELA------KLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGF 100 Query: 86 FAQPLEEKRKIRRDEKCVVGYYD----TEHTKNVRDWKEVYDFLVEEPTLVPSSTEPDDK 141 F +EEK+K + V G+ +E K DW +++ + T P Sbjct: 101 FNLSMEEKKKYWQHPGDVEGFGQAFVVSEEQK--LDWADIFSMI----------TLPVHL 148 Query: 142 EETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQTSFI 201 + F P+ PP LR+ +E YS E++ L++ L+ + L + ++ + +F++ + Sbjct: 149 RKPHLF---PKLPPLLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFENGFQSM 205 Query: 202 RLNHYPPCPSPELALGVGRHKDGGALTVLAQ-DEVGGLEVKRKTDGEWIRVRPTPNAYII 260 R+N+YPPCP PE +G+ H DG ALT+L Q +EV GL++ K DG+WI + P PNA+I+ Sbjct: 206 RMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQI--KNDGKWIPITPLPNAFIV 263 Query: 261 NVGDVIQVWSNDEYESVEHRVMVNSEKERFSVLFFLNPAHYTEVKPLEELTNKQNPAKYT 320 N+GD +++ +N Y S+EHR +VNS +ER S+ F E+ P L +++ PA + Sbjct: 264 NIGDTLEIITNGTYRSIEHRAIVNSLQERLSIATFYTKRLDGEIYPASSLISEKTPALFR 323 Query: 321 PYSWGKFLT------LRKLSNFKKLKAENIQ 345 + ++ LR S L+ +N Q Sbjct: 324 RVTVEEYFRNRYARELRGKSQLDDLRIQNGQ 354 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4398 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs58462 262 2e-72 >Cs58462 Length = 290 Score = 262 bits (670), Expect = 2e-72, Method: Compositional matrix adjust. Identities = 127/207 (61%), Positives = 154/207 (74%), Gaps = 15/207 (7%) Query: 1 DDFHSFVHGRLPYNLLKPDHVLRGLLLSLPVRKVIFTNSDKNHTITVLKRLGIEDCFESI 60 DDFHS+VHGRLPY +LKPD VLR LLLSLP+RKVIFTN+DK H VL RLG+EDCFE I Sbjct: 84 DDFHSYVHGRLPYMMLKPDPVLRNLLLSLPIRKVIFTNADKTHAARVLSRLGLEDCFERI 143 Query: 61 ICFETLNPTNSADGSADAEET------------DFVQQPNTDAVTPRSPVICKPFENAYV 108 I FETLN T+ D + + D+ +PN D PR+PV+CKPFE A+ Sbjct: 144 ISFETLNSTDKGTVLVDQDASESERPTELFDIDDYCSRPNADLELPRTPVVCKPFEEAFE 203 Query: 109 EAFKIANINPQRTLFFDDSIRNLETAKQVGLQTVWVGTSHRTKDVDHALESIHNMREALP 168 + FKIANINP++T+FFDDSIRNLET K++GL TVWVGTSHR + VD+ALESIHN++EALP Sbjct: 204 QVFKIANINPRKTIFFDDSIRNLETGKRLGLHTVWVGTSHRAEGVDYALESIHNIKEALP 263 Query: 169 ELW---AEQSENVIYSREVAIETPVEA 192 ELW E SE++ YS +V+IET V A Sbjct: 264 ELWEVAGENSESISYSGKVSIETSVIA 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158354627 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78980 127 2e-32 >Cs78980 Length = 276 Score = 127 bits (320), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 57/89 (64%), Positives = 71/89 (79%), Gaps = 1/89 (1%) Query: 1 QLAKNLACEWAKDNIRINSVAPWVVRTPLAEPMFTD-DGKSLLEAVISRTPLGRIGEPEE 59 QL KNLACEWAKDNIR N+VAPWV++T + +P +G L+ + +TP+GR GEP+E Sbjct: 176 QLTKNLACEWAKDNIRTNTVAPWVIKTSMIKPFEEGPEGSEFLDGIARQTPIGRAGEPDE 235 Query: 60 VSALVAFLCLPAASYITGQTFCVDGGMTI 88 VS+LVAFLCLPAASYITGQ CVDGG+T+ Sbjct: 236 VSSLVAFLCLPAASYITGQIICVDGGVTV 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89541379 (113 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15336 103 5e-25 >Cs15336 Length = 263 Score = 103 bits (257), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 50/87 (57%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Query: 1 MGTNLESSYSMCQLAHPLLKASGAGKIVLISSIAGVVSVGGCDSIYSASKGAINQLAKVL 60 M TN ES+Y + QLA+PLLKASG G I+ ISS+ GV++V SIY+++KGA+NQL K L Sbjct: 119 MTTNFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVP-LSSIYASTKGAMNQLTKNL 177 Query: 61 ACEWRKDKIRINSVSPGFIRTPLTEDV 87 ACEW KD IR+N+V+P IRT L + + Sbjct: 178 ACEWGKDNIRVNAVAPWIIRTSLIDSI 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1721 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3700 (476 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84538 388 e-110 >Cs84538 Length = 216 Score = 388 bits (997), Expect = e-110, Method: Compositional matrix adjust. Identities = 181/216 (83%), Positives = 199/216 (92%) Query: 224 MCALFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEDNARVPII 283 MC L INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKE+N RVPII Sbjct: 1 MCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPII 60 Query: 284 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCIGIFKTDNIPEEDVVKIVDTFPGQS 343 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIF+ DN+ ++D+VK+VDTFPGQS Sbjct: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQS 120 Query: 344 IDFFGALRARVYDDEVRKWISGVGVDGIGKKLVNSKEGLPTFEQPKMTLEKLLGYGNMLV 403 IDFFGALRARVYDDEVR WISG+GV IGK LVNSKE PTFEQP+MT+EKLL YGNM+V Sbjct: 121 IDFFGALRARVYDDEVRNWISGIGVGSIGKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIV 180 Query: 404 QEQDNVKRVQLAETYLSQAALGDANQDSIKRGDFYG 439 QEQ+NVKRVQLA+ YLS+AALG+AN D+I+ G+FYG Sbjct: 181 QEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158358373 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66047 131 3e-33 >Cs66047 Length = 145 Score = 131 bits (330), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 72/102 (70%), Positives = 82/102 (80%) Query: 46 ETPEAHVFKADIPGLKNEEVKVEIEDDRVLQISGERKIEKEDKNDTWHRVERSSGKFSRR 105 ET EAHVFKAD+PGLK EEVKVE+ED RVLQISGER +EKEDKND WHRVER GKF RR Sbjct: 44 ETREAHVFKADLPGLKKEEVKVEVEDGRVLQISGERSVEKEDKNDKWHRVERGRGKFVRR 103 Query: 106 FRLPENAKVDEIKAAMENGVLSVTXXXXXXXXXXXXSIEISG 147 FRLPENAK+D++KA+MENGVL+VT SI+I+G Sbjct: 104 FRLPENAKIDQVKASMENGVLTVTVPKVEEKKPEVKSIQITG 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89558552 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3886 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5614 (75 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73368 87 3e-20 >Cs73368 Length = 58 Score = 87.4 bits (215), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 41/53 (77%), Positives = 43/53 (81%) Query: 21 KMFPGMFMKKPDKKEALKQLKVHVGMFGAWVVAIRVTPYLLHALCGEKEELKL 73 +MFPGMFMKKPDK ALKQL+ HV MFG WVV IRVTPYLLH EKEELKL Sbjct: 4 RMFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHYFSREKEELKL 56 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158353901 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77982879 (292 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359219 (59 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig702 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3141 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig582 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1231 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2700 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95342 141 4e-36 >Cs95342 Length = 288 Score = 141 bits (356), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 91/235 (38%), Positives = 117/235 (49%), Gaps = 48/235 (20%) Query: 5 WMPGQPRPPYLDGSAPGDFGFDPLRLGEVPE----------------------------- 35 W PG P +LDGS GD+GFDP LG+ E Sbjct: 57 WYPGAKAPEWLDGSLVGDYGFDPFGLGKPAEYLQYDYDSLDQNLAKNPAGDIIGTRIEAS 116 Query: 36 --------------NLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGG 81 L+RF+E ELIH RWAMLA G L E L W A + + G Sbjct: 117 DMQSTPLQPYTEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKVELVEG- 175 Query: 82 QATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGA-FDPLGYSKDPXX 140 ++YLG P+P+ ++ T++ IE L I ++E QR+ E DPEK+ YPGG FDPLG + DP Sbjct: 176 -SSYLGQPLPF-SITTLIWIEVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEK 233 Query: 141 XXXXXXXXXXNGRLALLAFVGFVVQQSAYPGTGPLENLATHLADPWHNNIGDIII 195 + RLA++AF+GF V Q+ G GPL N ATHL+DP H I D I Sbjct: 234 KATLQLAEIKHARLAMVAFLGFAV-QAVVTGKGPLNNWATHLSDPLHTTILDTFI 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3170 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372858 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1803 (76 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542992 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158378696 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57895818 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig469 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2665 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3127 (308 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158369292 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2623 (334 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1245 (358 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106190 550 e-159 >Cs169106190 Length = 361 Score = 550 bits (1418), Expect = e-159, Method: Compositional matrix adjust. Identities = 260/334 (77%), Positives = 293/334 (87%), Gaps = 1/334 (0%) Query: 26 FDESNPIQL-ASEGLRELQDQFVQVLGHGCHVHSFARFAFRYEKKYESLEEMRRRFEIFA 84 FD+SNPI+L +S+GLR+ + +QV+G H SFARFA RY K YES+EEM+ RF F+ Sbjct: 28 FDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFS 87 Query: 85 ENKKLIRSTNRKGLSYKLGVNRFADWTWEEFQRHRLGAAQNCSATTKGNHKLTDAVPPLS 144 +N LIRSTN KGLSY+LG+N+FADW+WEEFQRHRLGAAQNCSATTKGNHKLT V P + Sbjct: 88 KNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRHRLGAAQNCSATTKGNHKLTADVLPET 147 Query: 145 KNWRDEGIVTPVKDQGHCGSCWTFSTTGALEAAYAQAFGKQISLSEQQLVDCAGAFNNFG 204 K+WR+ GIV+PVKDQGHCGSCWTFSTTG+LEAAY QAFGK ISLSEQQLVDCA AFNN G Sbjct: 148 KDWRESGIVSPVKDQGHCGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQG 207 Query: 205 CSGGLPSQAFEYVKYNGGLDTEEGYPYTAKDGACKFSSENVGVQVLDSVNITLGDEEGLK 264 C+GGLPSQAFEY+KYNGGLDTEE YPYT KDG CKFSSENVGVQVLDSVNITLG E+ L+ Sbjct: 208 CNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQ 267 Query: 265 HAVAFVRPVSIAFQVVSDFRLYKSGVYTSETCGNTPMDVNHAVLAVGYGVENGVPYWLIK 324 HAV VRPVS+AF+VV FR YKSGVY+S CGNTPMDVNHAV+AVGYGVE+GVPYWLIK Sbjct: 268 HAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIK 327 Query: 325 NSWGQSWGDNGYFKMEYGKNMCGIATCASYPVVA 358 NSWG++WGD+GYFKME GKNMCGIATCASYPVVA Sbjct: 328 NSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 361 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158367214 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4741 (306 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2632 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158349336 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89552756 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25776 89 3e-20 >Cs25776 Length = 104 Score = 89.0 bits (219), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 2/93 (2%) Query: 90 MAPELLSGKSHMVTEKIDVYSFGIVMWELLTGDEPYTDMHCASIIGGIVNNTLRPQIPTW 149 MAPE L G+ EK DVYSFG+++WEL+T +P+ + A ++G + R IP Sbjct: 1 MAPEFLRGEPS--NEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQN 58 Query: 150 CDPEWKSLMESCWGSEPAQRPSFSEISQKLRNM 182 P SLMESCW +PAQRPSF+ I + L+ + Sbjct: 59 TSPVLASLMESCWADDPAQRPSFANIVESLKKL 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357796 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362734 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 260657597 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4178 (303 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88787 480 e-138 >Cs88787 Length = 354 Score = 480 bits (1236), Expect = e-138, Method: Compositional matrix adjust. Identities = 233/302 (77%), Positives = 255/302 (84%), Gaps = 1/302 (0%) Query: 1 MASEDVKRSERAVSTIVNLAEEAKLAREGVVKAPSLAVLSVCKSLXXXXXXXXXXXXXXX 60 MASEDVK SE AVS IVNLAEEAKLA EGV KAPS AVLS+CKSL Sbjct: 1 MASEDVKTSESAVSKIVNLAEEAKLAGEGV-KAPSYAVLSICKSLVAGGVAGAVSRTAVA 59 Query: 61 PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGFRGLFIGNGTNCARIVPNSAVKFFSY 120 PLER+KILLQVQNPH+IKY+GT+QGLKYIWRTEGFRGLF GNGTNCARIVPNSAVKFFSY Sbjct: 60 PLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY 119 Query: 121 EQASKGILWMYREKTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQTEASP 180 EQASKGIL++Y+ TGNEDA+LTPLLRLGAGACAGIIAMSATYPMDMVRGR+TVQTE SP Sbjct: 120 EQASKGILYLYQHHTGNEDAELTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEKSP 179 Query: 181 YQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSRPFGLV 240 Y+YRG+FHALSTVLREEGPRALY+GW PSVIGVVPYVGLNFAVYESLK WLIK++P GL Sbjct: 180 YRYRGIFHALSTVLREEGPRALYRGWFPSVIGVVPYVGLNFAVYESLKVWLIKTKPLGLA 239 Query: 241 QDTDLSVTTRLXXXXXXXXXXXXXXYPLDVIRRRMQMVGWSHAASVVAGEGRSKAPLEYT 300 +D++LSVTTRL YPLDVIRRRMQMVGW A+SVV G+GR++APLEY Sbjct: 240 EDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKEASSVVIGDGRNRAPLEYN 299 Query: 301 GM 302 GM Sbjct: 300 GM 301 Score = 92.0 bits (227), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 61/187 (32%), Positives = 92/187 (49%), Gaps = 19/187 (10%) Query: 61 PLERMKILLQVQNPHN-IKYSGTVQGLKYIWRTEGFRGLFIGNGTNCARIVPNSAVKFFS 119 P++ ++ L VQ + +Y G L + R EG R L+ G + +VP + F Sbjct: 163 PMDMVRGRLTVQTEKSPYRYRGIFHALSTVLREEGPRALYRGWFPSVIGVVPYVGLNFAV 222 Query: 120 YEQASKGILWMYREKTGN--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-- 175 YE +W+ + K ED++L+ RL GA AG + + YP+D++R R+ + Sbjct: 223 YESLK---VWLIKTKPLGLAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW 279 Query: 176 TEAS-----------PYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVY 224 EAS P +Y GM A +R EG ALYKG +P+ + VVP + L F Y Sbjct: 280 KEASSVVIGDGRNRAPLEYNGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSISLAFVTY 339 Query: 225 ESLKDWL 231 E +KD L Sbjct: 340 EVVKDIL 346 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89543955 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3840 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65605 118 4e-29 >Cs65605 Length = 169 Score = 118 bits (295), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 63/139 (45%), Positives = 85/139 (61%), Gaps = 8/139 (5%) Query: 36 NKLASRHVRVGLATPSAVPRCDICENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHGRYL 95 NKLAS HVR L PS+ +CD+C+ AF +CE G +CL CDMV H+G H R+L Sbjct: 3 NKLASSHVRHDLP-PSSFGKCDLCDREKAFLFCEKGGMCICLTCDMVFHIG----HPRFL 57 Query: 96 VLRQRVQFPGDKPSSNGEDPASQPPIDQGETRRVQHQQPRMTIGDNHQNHRASPVRLADA 155 V+RQ++QFP + P P S+P ++Q E +R Q+ MTIG++ QNH+ P +AD Sbjct: 58 VMRQKIQFPVEDPIWG--KPISRP-LNQAEIKREQNDPLEMTIGEDQQNHKVFPTAVADV 114 Query: 156 NDDGHVKMDNKLIDLNMKP 174 K NK+IDLN KP Sbjct: 115 RATSKAKRGNKMIDLNRKP 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2977 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1279 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3652 (310 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs100466 239 2e-65 >Cs100466 Length = 345 Score = 239 bits (611), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 124/302 (41%), Positives = 184/302 (60%), Gaps = 32/302 (10%) Query: 19 MSSKKKELLTSALKRTSEWIFSQEIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLVSEST 78 M++ + +SA +RT +W+FSQEIP+D+ V VGE +F LHKF LV+K YIRKL+ ES Sbjct: 1 MATPLNKRFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLIIESK 60 Query: 79 DDEISVIELPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVSEYLLMTEEYAIGNLV 138 + +++ I L ++PGG E FE AAKFCYG+NFEI+ N+A LRC +E+L MT++Y NL Sbjct: 61 EADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCENNLA 120 Query: 139 GRTDAYLNEVALKSLAGAVSVLHTAESFLPIAEKVKLVSRCIDAIAYMTCKDSQF-CLSG 197 GRT+ +L++VAL SL+GAV VL + E+ LP+AE + +V RCID C ++ F C Sbjct: 121 GRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCIDVATAKACYEANFPC--- 177 Query: 198 RSDSGNESLSSSAVYQTKPIVDWWAEDLTVLRIDTFQRALIAMMARGFKQYALGPILMLY 257 +T P +WW E+L+++ I+ F R + AM RG K + L+ Y Sbjct: 178 ---------------RTPP--NWWTEELSIIDIEFFSRIIAAMKKRGAKALTIASALITY 220 Query: 258 AQKSLRGNIRQGK----------EKIEPRQEHEKRVVLETIVSLLPREKIQCQLAFFLCC 307 ++SLR +R + + +++R +LE+IVSL+P EK + FLCC Sbjct: 221 TERSLRDLVRDHSAGNGTKSSDAQSTNSQVRYQQRELLESIVSLMPSEKAAFPIN-FLCC 279 Query: 308 FV 309 + Sbjct: 280 LL 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1075 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3203 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88194 132 3e-33 >Cs88194 Length = 241 Score = 132 bits (332), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 72/146 (49%), Positives = 99/146 (67%), Gaps = 15/146 (10%) Query: 57 AEKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQL 116 A +KR L+V+Q + LEK+FEVENKLEPERK++LA++LGLQPRQVA+WFQNRRARWKTKQL Sbjct: 2 ASEKRLLTVDQGQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQL 61 Query: 117 ERDYGVLKANYDSLKISFDSLQHDNQALHKEIKELKAKFQEENTESNHSVKEEQMALANE 176 E+DY VL+ +Y+SLK +D+L + + L E+ +L K Q + ES K ++ + N Sbjct: 62 EKDYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKEKES----KNTELPVVN- 116 Query: 177 SSYKMVIEQSKPQSPETSPPVSGQRA 202 K + P+ S PV+ A Sbjct: 117 ----------KQEPPQISEPVADSAA 132 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5689 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3715 (362 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33343 128 9e-32 >Cs33343 Length = 298 Score = 128 bits (322), Expect = 9e-32, Method: Compositional matrix adjust. Identities = 101/250 (40%), Positives = 126/250 (50%), Gaps = 26/250 (10%) Query: 55 TITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVAKELPG 114 TITKQRE+WTEEEH+KFLEALKL+GR WR+IEEHVGTKTAVQIRSHAQKFFSKV +E G Sbjct: 5 TITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNG 64 Query: 115 --TGEGSLKPIEIXXXXXXXXXXXXXXXXH-------NGSPERRSPSPNFSVAEKGQESP 165 T I H N R S SP SV+E+ +SP Sbjct: 65 CSTSPVEPVEIPPPRPKRKPMHPYPRKLAHPPVKESLNPELSRTSLSPILSVSERENQSP 124 Query: 166 TSVLSVPGSDIIGSPALEQYNRS-RPSTSCTTD-MRSANLSHVEKENDYATSSPSTEKAK 223 TSV+ GSD GS N S P +S + + LSH +SSP + Sbjct: 125 TSVMFAMGSDAFGSSDSNSPNGSLSPVSSAVPEQLGGLTLSH-------PSSSPEERGSP 177 Query: 224 ETMPHVDSTL---DKPLSVVQKDASASGCTSTTEGDAGRVGA-SMSIKLFGRTVLVSDLH 279 + P ++ P V++ S G + + V A S ++KLFG VLV+D Sbjct: 178 SSGPVTPGSVTDEQSPKCVLKMGLSPQGF----DKEVSDVRASSRTLKLFGTIVLVTDSQ 233 Query: 280 KQSSSGTKDC 289 + SS C Sbjct: 234 RLSSPTAGTC 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372035 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig795 (683 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2917 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs79752 62 4e-12 >Cs79752 Length = 267 Score = 61.6 bits (148), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 38/67 (56%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Query: 1 MLARGGNRGPPVTTAAAASNPIPVTEQATSAPAKEN-NLELSYKCSVCDKAFNSYQALGG 59 MLARG TA A P EQ E +L+LSYKCSVC+KAF+SYQALGG Sbjct: 61 MLARGTTT---ANTAPAERTPSLAPEQRPQDQFPEPPSLKLSYKCSVCNKAFSSYQALGG 117 Query: 60 HKASHRK 66 HKASHRK Sbjct: 118 HKASHRK 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3406 (450 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101256 341 9e-96 >Cs101256 Length = 284 Score = 341 bits (874), Expect = 9e-96, Method: Compositional matrix adjust. Identities = 182/279 (65%), Positives = 209/279 (74%), Gaps = 12/279 (4%) Query: 36 AEFSGLRSSSCLTYASNGREAS--LFDAVAAQ---LTPQTSGSAPVKGETVAKLKVAING 90 +EFSGLR+S+ L + GR++S +A Q L +SG V + AKLKVAING Sbjct: 11 SEFSGLRNSASLPF---GRKSSDDFHSVIALQTSALGSSSSGYRKVAAQ--AKLKVAING 65 Query: 91 FGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKADIKIVDNETIS 150 FGRIGRNFLRCWHGRKDSPLEV+ +ND+GGVK ASHLLKYDS LG F+AD+K V + IS Sbjct: 66 FGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGIS 125 Query: 151 VDGKPIKVVSNRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGA 210 VDGK I+VVSNR+P+ LPW ++GID+VIEGTGVFVD GAGKHIQAGAKKV+ITAP KG Sbjct: 126 VDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG- 184 Query: 211 DIPTYVVGVNEKDYGHSVADIVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQ 270 DIPTYVVGVN Y I+SNASCTTNCLAPFVKVLD++FGI+KG MTTTHSYTGDQ Sbjct: 185 DIPTYVVGVNADAYKPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGNMTTTHSYTGDQ 243 Query: 271 XXXXXXXXXXXXXXXXXXNIVPTSTGAAKAVSLVLPQLK 309 NIVPTSTGA KAV+LVLP LK Sbjct: 244 RLLDASHRELRRARAAALNIVPTSTGAGKAVALVLPALK 282 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158377985 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361428 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158360140 (51 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5485 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158370383 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5585 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372750 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1484 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89541905 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2208 (408 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359626 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80871 346 2e-97 >Cs80871 Length = 324 Score = 346 bits (888), Expect = 2e-97, Method: Compositional matrix adjust. Identities = 171/302 (56%), Positives = 201/302 (66%), Gaps = 24/302 (7%) Query: 6 FEEEEFRACCGSTQFAKEMAKASPFSSLEEAVTVARDVWFNKVDVTGWLQAFSAHPQIGX 65 +EEE CCGST+FAKEMA ASPF+SL +AV+ AR +WFN VDV GWL AFSAHPQIG Sbjct: 5 LDEEELLGCCGSTKFAKEMASASPFASLNQAVSAARHIWFNLVDVNGWLDAFSAHPQIGQ 64 Query: 66 XXXXXXXXXXAQWSKGEQXXXXXXXXXXXLQELSQWNARYREKFGFVFLICASGKSTDGI 125 +QWSK EQ QELS WN RYR +FGF+F+ICASG++ I Sbjct: 65 SPS-------SQWSKAEQSTALATANESSSQELSDWNNRYRLRFGFIFIICASGRTAAEI 117 Query: 126 LAELKKRYPNRPIVEFEIAAKEQMKITELRLAKLFSTKEKVPSTG---NVNPSVAAKKVE 182 LAELKKRY NRPI+EFEIAA+EQMKITELRLAKLFS K K S + A +V Sbjct: 118 LAELKKRYTNRPIIEFEIAAQEQMKITELRLAKLFSAKAKASSATFQYSATAKTAEDRVS 177 Query: 183 AVKXXXXXXXXXXX--------------XXHVLDISRGSPGAGIEVCLEMWKGHQPHPVF 228 ++ HVLD+S+GSP AG+EV LEMWKG QP P+F Sbjct: 178 IIEGHLCASTEASAGKISQIPTRTRLPITTHVLDVSQGSPAAGVEVRLEMWKGIQPRPLF 237 Query: 229 GESTTGGWVFQGSSTTNSDGRSGQLLSIFDAVNPGIYRISFNTGKYCPGGFFPYVSIVFE 288 GE+ GWV+QGSSTTN DGR GQL+ + + +NPG Y+I+FNTGKYCP GFFPYVSIVFE Sbjct: 238 GETDVSGWVYQGSSTTNKDGRCGQLMGMIEDLNPGFYKITFNTGKYCPEGFFPYVSIVFE 297 Query: 289 IR 290 IR Sbjct: 298 IR 299 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89556940 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3908 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2603 (401 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18472 681 0.0 >Cs18472 Length = 412 Score = 681 bits (1758), Expect = 0.0, Method: Compositional matrix adjust. Identities = 327/412 (79%), Positives = 349/412 (84%), Gaps = 11/412 (2%) Query: 1 MALVKPMTNFGNVTT---PKFGNTRSSSSG--------KWSTMIRMXXXXXXXXXXXXXX 49 MALVKP++ F + T P+F +++ + K S Sbjct: 1 MALVKPISKFSTIATTTKPRFSYPKATCTSLSTRFCTIKMSATSEQAAAATAQKPSKKSN 60 Query: 50 XXXIKETLLAPRFYTTDFDEMETLFNTEINNNLNQAEFEALLQEFKTDYNQTHFVRNKEF 109 IKETLL PRFYTTDFDEMETLFNTEIN LNQAEFEALLQEFKTDYNQTHFVRNKEF Sbjct: 61 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEF 120 Query: 110 KEAADNLQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR 169 KEAAD +QGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR Sbjct: 121 KEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR 180 Query: 170 HAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKAN 229 HAGFLNKGLSDFN ALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKAN Sbjct: 181 HAGFLNKGLSDFNYALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKAN 240 Query: 230 PEYQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWCRFFCLSVYVTMYLN 289 PE+QCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLW RFFCLSVYVTMYLN Sbjct: 241 PEFQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLN 300 Query: 290 DCQRTAFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINQKLI 349 DCQRTAFYEGIGL+TKEFDMHVIIETNRTTARIFPAVLDVENPEFKR+LDRMVEIN++L+ Sbjct: 301 DCQRTAFYEGIGLDTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRRLDRMVEINERLL 360 Query: 350 AVGESDDIPLVKNLNRIPIVXXXXXXXXXXXXMPPIESGSVDFAEFEPQVVY 401 AVG +DDIPLVKNL RIP++ MPP++SGSVDFAEFEP++VY Sbjct: 361 AVGATDDIPLVKNLKRIPLIAALASELLATYLMPPVDSGSVDFAEFEPELVY 412 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89547331 (69 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3720 (311 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69106190 150 1e-38 >Cs69106190 Length = 396 Score = 150 bits (380), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 77/188 (40%), Positives = 116/188 (61%), Gaps = 2/188 (1%) Query: 93 ARTLQLGAMFGIWYLLNIYFNIYNKQVLKVYPFPATVTAFQFACGTVMIILMWTLNLYPR 152 A+ L++G F W+ LN+ FNIYNK+VL +P+P + ACG++M+++ W + Sbjct: 100 AQRLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIAEA 159 Query: 153 PKITRSQLATILPLAVAHTMGNLLTNISLGKVTVSFTHTIKAMEPFFTVLFSALLLAERP 212 PK ++ P+AVAHT+G++ +S+ KV VSFTH IK+ EP F+VL S L E Sbjct: 160 PKTDLEFWKSLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLFGETL 219 Query: 213 TIWVVSSLVPIVSGVALASFTEASFNWIGFGSAMASNITNQSRNVLSKKFMAKKEECLDN 272 + V SL+PI+ G ALA+ TE +FN IGF AM SN+ RN+ SKK M K + + Sbjct: 220 PMPVYMSLLPIIGGCALAAVTELNFNMIGFMGAMISNLAFVFRNIFSKKGM--KGKSVGG 277 Query: 273 INLFSVIT 280 +N ++ ++ Sbjct: 278 MNYYACLS 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4073 (314 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57011897 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2827 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57896315 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1835 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73025 157 5e-41 >Cs73025 Length = 382 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGM 77 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 137 IQKESTLHLVLRLRGGM 153 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 213 IQKESTLHLVLRLRGGM 229 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 289 IQKESTLHLVLRLRGGM 305 Score = 156 bits (395), Expect = 7e-41, Method: Compositional matrix adjust. Identities = 76/76 (100%), Positives = 76/76 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364 Query: 61 IQKESTLHLVLRLRGG 76 IQKESTLHLVLRLRGG Sbjct: 365 IQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4757 (473 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4544 (447 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2928 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4216 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig288 (499 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92264 347 1e-97 >Cs92264 Length = 486 Score = 347 bits (891), Expect = 1e-97, Method: Compositional matrix adjust. Identities = 191/461 (41%), Positives = 262/461 (56%), Gaps = 42/461 (9%) Query: 33 CMLNQIQAREPDNRIETEAGRIESWDYNQDDFQCAGVAVQRITVERNGLHLPFYTNSPRL 92 C + + A EP ++E+EAG E WD N + QCA VAV R +++ GL +P YTN+P + Sbjct: 48 CNIQNLNALEPRQKVESEAGVTEFWDQNNEQLQCANVAVFRQRIQQRGLLVPAYTNTPEI 107 Query: 93 LYVVQGRGQLGMVIPGCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 152 YVVQGRG G+V PGC Sbjct: 108 FYVVQGRGIHGVVFPGC----------------------------AETFQDSQQQQSFQG 139 Query: 153 XXXLDRHQKVRPVKEGDVIAVPAGVTTWSYNDGDQSLVFVCLQDTSNLHNQLDQIPRRFY 212 D+HQKVR ++EGDVIA+PAG W YN+G LV V L D N NQLDQ R+FY Sbjct: 140 SKSQDQHQKVRQLREGDVIALPAGAAHWIYNNGRDQLVLVALVDVGNSQNQLDQYFRKFY 199 Query: 213 LAGNPQDEFTQQGQSRHSIARQQGKIRHQQQGNNNN---NVFAGFDTRLLADALNIDQQT 269 L GNPQ + QG S+ R QG QG+++ N+F GFD RLLA+A N++ Sbjct: 200 LGGNPQPQL--QGFSQSQGGRSQGS-----QGSDDGRGGNLFRGFDERLLAEAFNVNPDL 252 Query: 270 AQQLQGQNDNRPQIVRVQGRLDFVQPPESMXXXXXXXXXXXXXXXXXVF----CHMKMKQ 325 ++LQ R I+RV+ L + P F C MK++ Sbjct: 253 IRRLQRPQIQRGIIIRVEEELRVLSPQRDREQEQEECEETPSYERDNGFEETICTMKLRH 312 Query: 326 NIGKPSMADVFSPQAGRISVLNGLSMPVLRHLRLSAERGFFYNNAIYSPHWNLNAHEVYY 385 NI KPS ADV++P+AGR++ +N ++P+LR L+LSAE+G Y NA+ +P WNLNAH + Y Sbjct: 313 NIDKPSHADVYNPRAGRVTTVNRFNLPILRDLQLSAEKGNLYPNALLAPQWNLNAHSIVY 372 Query: 386 VIRGSARVQVVNDNGETILDDQVRQGQLFIVPQNHAVLQKAMSNGYEYIAFKTQDNAIIN 445 V RG+ R+Q+V +NGE + D Q+R+GQL +VPQ AV+++A + G E+I+FKT D A+ + Sbjct: 373 VTRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRAGNRGLEWISFKTNDVAMTS 432 Query: 446 TLAGRTSVLRALPDVVLANAYQMDRQQARNLKYNRQETVAL 486 LAGR SVLR LP V+ N++Q+ R +A+ LKYNRQE Sbjct: 433 QLAGRASVLRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVF 473 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3447 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4515 (469 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs171106184 252 5e-69 >Cs171106184 Length = 175 Score = 252 bits (644), Expect = 5e-69, Method: Compositional matrix adjust. Identities = 113/172 (65%), Positives = 130/172 (75%) Query: 282 FQLYSSGVFTGRCGTALDHGVAVVGYGTEHGSDYWIVRNSWGDSWGESGYIRMERNLGNS 341 FQLY SG+FTGRCGT+LDHGV VGYGTE+G+DYWIV+NSWG SWGE GYIRMERN+ + Sbjct: 3 FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGT 62 Query: 342 ATGKCGIAMEPSYPVKXXXXXXXXXXXXXXXXXXXXVCDNYFSCPESNTCCCIYQYQNYC 401 TGKCGIAME SYP+K VCDNY+SCPESNTCCC+++Y N C Sbjct: 63 LTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSC 122 Query: 402 FAWGCCPLEGATCCDDHYSCCPSDYPVCNVNAGTCQLSKGNPMSVKALKRTP 453 FAWGCCPLE ATCCDDHYSCCP DYP+CNV AGTC +SK NP+ + + P Sbjct: 123 FAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGSEGIATHP 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4260 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig403 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1884 (315 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig338 (345 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2102 (485 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5185 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1895 (361 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3040 (280 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158350790 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 74 1e-15 >Cs66150 Length = 305 Score = 74.3 bits (181), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 51/171 (29%), Positives = 74/171 (43%), Gaps = 12/171 (7%) Query: 23 ESNEEDPGLVMNFYSDSCPQAEEIVREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDAXX 82 E + L +FYS +CP + + +K + S +R FHDC V CDA Sbjct: 26 EGSPSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASI 85 Query: 83 XXXXXXXXXXEK-EMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLG 141 EK + R F I+ +K A+ER CP VVSC+DIL ++A V G Sbjct: 86 LLDSTNTIDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSG 145 Query: 142 GP--FIP----DPKAVQYVRNDRGTPMIFDN-----NYYRNILDNKGLMMV 181 GP +P D + ++ P FD + +RN+ N L +V Sbjct: 146 GPSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLV 196 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3590 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5093 (250 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101477 269 2e-74 >Cs101477 Length = 242 Score = 269 bits (688), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 145/254 (57%), Positives = 167/254 (65%), Gaps = 24/254 (9%) Query: 3 TELRLGLPXXXXXXXXXXXXXXXXDQVVVMMRKRVFSETESQITTDDESSACVDLKLNLS 62 TELRLGLP + KR F++T VDLKLNLS Sbjct: 7 TELRLGLPGGNGGSSEGGGGGEKAKNNNINGMKRGFADT------------VVDLKLNLS 54 Query: 63 SKD--GSSTAEKSKSLMMNKNKEKNVDLXXXXXXXXXXXQVVGWPPVRSFRKNMLSAQKS 120 +K+ G EK+K K + QVVGWPPVRSFRKN+++ QK Sbjct: 55 TKESGGIDVIEKTKG------KSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQKD 108 Query: 121 STTDESKAGG----NAALVKVSMDGAPYLRKVDLNMYKTYPQLSDALAKMFSSFTIGNCG 176 + ++KA N A VKVSMDGAPYLRKVDL +YK+Y +LSDAL KMFSSFTIGNCG Sbjct: 109 NEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCG 168 Query: 177 SQGTIDFMNERKLMDLLNDSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAV 236 SQG DFMNE KL+DLLN SDY+PTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKG EA+ Sbjct: 169 SQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAI 228 Query: 237 GLAPRAMEKCKNRS 250 GLAPRA+EKCKNRS Sbjct: 229 GLAPRAVEKCKNRS 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2068 (276 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4096 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361591 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60403 70 2e-14 >Cs60403 Length = 93 Score = 70.5 bits (171), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 41/86 (47%), Positives = 51/86 (59%), Gaps = 6/86 (6%) Query: 5 VTVDVIHTVFSAFGTVQKIAIFEKNCQTQALVQYPDIATAAVAREALEGHCI------YD 58 + V I VFSAFG V KI FEK QALVQ+ D TA+ A+ AL+G I + Sbjct: 8 LKVIFILQVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPEN 67 Query: 59 GGYCKLHLSYSRHTDLNVKAYSDKSR 84 G C L ++YS HTDL+VK S +SR Sbjct: 68 MGPCTLRITYSAHTDLSVKFQSHRSR 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3499 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 293 5e-82 >Cs169106187 Length = 148 Score = 293 bits (751), Expect = 5e-82, Method: Compositional matrix adjust. Identities = 138/148 (93%), Positives = 144/148 (97%) Query: 1 MASKRISKELKDLQKDPPASCSAGPVAEDMFHWQATIMGPGDSPFAGGVFLVSIHFPPDY 60 MASKRI KELKDLQKDPP SCSAGPVAEDMFHWQATIMGP DSP+AGGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRVKYETTARSWTQKYAMG 148 PEIAHMYK+D+ KYE+TARSWTQKYAMG Sbjct: 121 PEIAHMYKSDKAKYESTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4512 (440 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84538 406 e-115 >Cs84538 Length = 216 Score = 406 bits (1043), Expect = e-115, Method: Compositional matrix adjust. Identities = 192/216 (88%), Positives = 201/216 (93%) Query: 225 MCALFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIV 284 MC L INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPI+ Sbjct: 1 MCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPII 60 Query: 285 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCTGIFKADSVPDSDIVKLVDTFPGQS 344 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIF+ D+V D DIVKLVDTFPGQS Sbjct: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQS 120 Query: 345 IDFFGALRARVYDDEVRKWISGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 404 IDFFGALRARVYDDEVR WISG+GV SIGK LVNSKE PTFEQP+MT+EKLLEYGNM+V Sbjct: 121 IDFFGALRARVYDDEVRNWISGIGVGSIGKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIV 180 Query: 405 QEQENVKRVQLADQYLSEAALGDANADAIDRGTFYG 440 QEQENVKRVQLAD+YLSEAALG+ANADAI G FYG Sbjct: 181 QEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89555746 (130 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9986 96 1e-22 >Cs9986 Length = 197 Score = 95.9 bits (237), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 43/100 (43%), Positives = 63/100 (63%) Query: 29 TGAYGINYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTGLDLVVGLPNG 88 TG GINYGR+A+N+PSP+KV LL++ I V+ YD D +VL A + + + +VV PN Sbjct: 6 TGKVGINYGRVANNLPSPEKVVELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNE 65 Query: 89 YVKDMSANQDHALDWVKENVQAFLPDTHIRGIAVGNEVLG 128 + +A+Q +WV+ N+ + P T I +AVGNEV Sbjct: 66 ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFA 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3688 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89554576 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4417 (306 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3358 (250 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47924 232 3e-63 >Cs47924 Length = 209 Score = 232 bits (592), Expect = 3e-63, Method: Compositional matrix adjust. Identities = 129/246 (52%), Positives = 151/246 (61%), Gaps = 44/246 (17%) Query: 1 MALLVPSPEISR--VFSXXXXXXXXXXXXXXXXXDKFGSKSVRVCSGIKDSAVRTSELDR 58 MA LV PE S F+ +K GS++ SGI SE+ R Sbjct: 1 MAFLVSPPEFSTKIFFNPNPHSTSQKSLSVLSNHEKLGSRARVRVSGI-------SEVGR 53 Query: 59 NLRPYGQFSAPVKQGPKPSKEDQEKQEYYVNMGYAIRTXXXXXXXXXXXXXSLNIYRDDI 118 N+R YGQFSAPVK PSKE++EK YYVNMGYAIRT S +IYR Sbjct: 54 NVRLYGQFSAPVK----PSKEEEEKHNYYVNMGYAIRTLREEFPALFYKELSFDIYR--- 106 Query: 119 TFKDPINTFTGIENYKSIFSALRFHGQIFFKALWVDVISVLQPLDNVVMVRWTIHGMPRV 178 IFF+ALW+D+ISV QPL+NV+MVRWTIHG+PRV Sbjct: 107 ---------------------------IFFRALWLDIISVWQPLENVIMVRWTIHGVPRV 139 Query: 179 PWESRGRFDGTSEYKLDKKGKIYEHRVDNIALNS-PPKFQMLGVGDIMQSLGCPSTPKPT 237 PWESRGRFDGTSEYKLD+ GKIYEHRVDNIALNS PPKF++L V D++QS+GCPSTPKPT Sbjct: 140 PWESRGRFDGTSEYKLDRNGKIYEHRVDNIALNSPPPKFRVLAVEDLIQSIGCPSTPKPT 199 Query: 238 FFETSS 243 +FE SS Sbjct: 200 YFEISS 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4985 (517 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158358249 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59973 110 6e-27 >Cs59973 Length = 197 Score = 110 bits (276), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 62/178 (34%), Positives = 100/178 (56%), Gaps = 20/178 (11%) Query: 5 AEKERRILVAVDEGEESMYALSWCLGNVVS----------SKDTLILVYVKPP-KAVYMP 53 +K+ +++VA+DE ES+ AL W L N+ L +V+V+ P + +P Sbjct: 28 GKKKMKVMVAIDESAESVNALKWALDNLYGIVGFTPEAGGGGGILTIVHVQQPFQRFVLP 87 Query: 54 LDGTGRSQSSSGYMFSSDLYATMENYSNEVANSVIEKAKNKCRDVLQEQDVKVETRIENG 113 T SS + +S + ++ E + +++ +A C+D + VK E+ + G Sbjct: 88 ALST-----SSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKM----VKAESLVLEG 138 Query: 114 DPRDVICHLVEQLGAHILVMGSRGYGLIKRAFLGSVSNHCAQNVNCPVLIVKKPKTNN 171 DP+D+IC EQ+ +LV+GSRG G IKRAFLGSVS++CA + CP++IVK PK + Sbjct: 139 DPKDMICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVKPPKEQH 196 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158353766 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3026 (123 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158375176 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs100144 375 e-106 >Cs100144 Length = 274 Score = 375 bits (963), Expect = e-106, Method: Compositional matrix adjust. Identities = 175/242 (72%), Positives = 203/242 (83%) Query: 7 LNAHISLQDSSDGICQNLVTLIGGFETKTGEQWLAFRNDGKYSAADYGKVMSERVSKSRA 66 +N+ + SS G+CQNLV L+GGFETKTGEQWLAFR+DGKYSAADY K+ SE++SK+ + Sbjct: 1 MNSMLMPSSSSKGLCQNLVVLVGGFETKTGEQWLAFRSDGKYSAADYAKLTSEKISKNHS 60 Query: 67 GGGQVWNKFEQEETIKRRRYFVTKLLQGTMRGLAYMHDRERLHQSLGPASVILNTIVERE 126 G WN+FE E+ +K RRYFV KL QG M GLAYMHD +RLHQSLGP+SVILNTIVE++ Sbjct: 61 AGESSWNRFETEQILKCRRYFVIKLFQGAMSGLAYMHDHDRLHQSLGPSSVILNTIVEKD 120 Query: 127 AIYLVPRLRDLAFCVDIRYSNLEGRPGLLSEGLWRRASTAGAFTPMDKRAFGLADDIYEA 186 A YLVPRLRDL+F VDI + NLE PG SEGLWRRA+ AGAFTPM+KRAFG+ADD+YEA Sbjct: 121 AAYLVPRLRDLSFSVDISFQNLEEDPGTFSEGLWRRAAAAGAFTPMEKRAFGIADDVYEA 180 Query: 187 GLFFAYLAFVPFCEAGTMDGLSLQRLLENTFQLDLGATREYCLADDGLLDAVKFLDLGDG 246 GL AYLAFV FCEA MD LSLQRLLE+TF+LDL ATREYCLADD LL+AVKFLDLG+G Sbjct: 181 GLLLAYLAFVTFCEANVMDSLSLQRLLESTFRLDLQATREYCLADDRLLEAVKFLDLGEG 240 Query: 247 AG 248 AG Sbjct: 241 AG 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89547240 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1192 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57895767 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89551636 (44 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1160 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5466 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542221 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158350204 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4581 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1924 (176 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158352035 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3920 (552 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158355199 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs70317 161 1e-42 >Cs70317 Length = 100 Score = 161 bits (408), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 80/97 (82%), Positives = 87/97 (89%), Gaps = 1/97 (1%) Query: 1 MMERVLGPLPQHMVLRADRRAEKYFRRGARLDWPDGAASRESMRAVFKLPRLPNLIMQHV 60 MMERVLGPLPQHM+ R DR AEKY RRG RLDWP+GAASRES+++V KLPRL NLIMQHV Sbjct: 1 MMERVLGPLPQHMLKRVDRHAEKYVRRG-RLDWPEGAASRESIKSVMKLPRLQNLIMQHV 59 Query: 61 DHSAGDLIELLQGLLRYEPTERLKAREALRHPFFTRD 97 DHSAGDL LLQGLLRY+PT+RL AREALRHPFFTRD Sbjct: 60 DHSAGDLTHLLQGLLRYDPTDRLTAREALRHPFFTRD 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig561 (371 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs71989 368 e-104 >Cs71989 Length = 234 Score = 368 bits (945), Expect = e-104, Method: Compositional matrix adjust. Identities = 181/226 (80%), Positives = 198/226 (87%), Gaps = 6/226 (2%) Query: 1 MAVPVSAIGFEGYEKRLEVCFFEPGLFADPKGMGLRSLSRAQINEILNPAECTIVSSLLN 60 MA+PVSAIGFEGYEKRLEV FFEPG+FADP G GLRSLS+ Q++EIL PAECTIVSSL N Sbjct: 1 MALPVSAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSN 60 Query: 61 DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVRSVRYSRGSFIF 120 + LDSYVLSESSLFVYPYKVIIKTCGTTKLL SIPAILKLAE+LSL+VRSVRY+RGSFIF Sbjct: 61 EHLDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPAILKLAESLSLSVRSVRYTRGSFIF 120 Query: 121 PGAQPSPHRSFSEEVAVLDGHFSKLGLASRAYIMGSPDNSQKWHVYSASAELASLFWGTR 180 GAQP PHRSFSEEVAVLDGHF K G+ S A++MGSPDN+++WHVYSASAE S Sbjct: 121 AGAQPFPHRSFSEEVAVLDGHFGKFGMDSTAFVMGSPDNTKRWHVYSASAEAGS------ 174 Query: 181 SSGPTYTLEMCMTGLDRKKASVFYKTNASSAAIMTEDSGIRKILPK 226 P YTLEMCMTGLDRK+ASVFYKTN SSAA+MTEDSGIRKILP Sbjct: 175 HVNPVYTLEMCMTGLDRKRASVFYKTNESSAAMMTEDSGIRKILPN 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5162 (448 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4766 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77982831 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig934 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158352771 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18778 111 1e-27 >Cs18778 Length = 118 Score = 111 bits (278), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 51/66 (77%), Positives = 57/66 (86%) Query: 35 GSLKSSQCPSQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQ 94 GSL+ +C +CT RCSKTQY KPC+FFCQKCCAKCLCVP GFYGNK CPCYNNWKT++ Sbjct: 53 GSLQPQECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKR 112 Query: 95 GGPKCP 100 GGPKCP Sbjct: 113 GGPKCP 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1557 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3572 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs91241 164 3e-43 >Cs91241 Length = 177 Score = 164 bits (414), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 78/106 (73%), Positives = 88/106 (83%) Query: 1 MLDSGGMPSSHSALVTALTVAVGLDQGTGGXXXXXXXXXXXIVMYDATGVRLHAGRQAEL 60 MLDSGGMPSSHSA V+AL VA+GL +G+G IVMYDA+GVRLHAGRQAEL Sbjct: 69 MLDSGGMPSSHSATVSALAVAIGLQEGSGSPSFAIAVVLACIVMYDASGVRLHAGRQAEL 128 Query: 61 LNQILCELPPEHPLSTVRPLRDSLGHTPVQVVAGAILGCVVAFLMR 106 LNQI+CE PP+HPLS+VRPLR+ LGHTP+QVVAG ILGCVVAFLMR Sbjct: 129 LNQIVCEFPPDHPLSSVRPLRELLGHTPLQVVAGGILGCVVAFLMR 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2569 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3361 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4390 (667 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88680 162 9e-42 >Cs88680 Length = 213 Score = 162 bits (410), Expect = 9e-42, Method: Compositional matrix adjust. Identities = 83/160 (51%), Positives = 112/160 (70%), Gaps = 7/160 (4%) Query: 38 VIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTD-SERLIGEAAKNQAAVNHE 96 +IGIDLGTT SCV + + + ++I N +G+R TPS VAF E L+G AK QA N Sbjct: 59 IIGIDLGTTNSCVALMEGKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAVTNPT 118 Query: 97 RTVFDVKRLIGRKFADKEVQRDMKLFPFKIVN-QDGKPYIQVKIKDGETKVFSPEEISAM 155 T+F KRLIGRKF D + Q++M++ +KIV +G +++ +G+ +SP +I A Sbjct: 119 NTLFGTKRLIGRKFDDPQTQKEMQMVSYKIVRAPNGDAWVEA---NGQQ--YSPSQIGAF 173 Query: 156 ILTKMKETAEAFLGKKIQNAVVTVPAYFNDAQRQATKDAG 195 +LTKMKETAE++LGK + AV+TVPAYFNDAQRQATKDAG Sbjct: 174 VLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAG 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5524 (241 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5049 (364 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5164 (389 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27289 121 1e-29 >Cs27289 Length = 413 Score = 121 bits (304), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 88/289 (30%), Positives = 142/289 (49%), Gaps = 24/289 (8%) Query: 22 YVGNIHTQVTEPLLQEVFASTGAVESCKLIRKEKSS----YGFVHYFDRRCAALAIVSLN 77 ++G++ + E L FA TG V + K+IR +++ YGF+ + R A + + N Sbjct: 85 WIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQTFN 144 Query: 78 GRQLFG--QPIKVNWA-YASGQREDTSGHFNIFVGDLSPEVTDATLFACFSV-YSSCSDA 133 G + Q ++NWA + +G++ D + IFVGDL+ +VTD L F Y S A Sbjct: 145 GTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDYMLQETFRARYPSTKGA 204 Query: 134 RVMWDQKTGRSRGFGFVSFRNQQDAQSAINDLNGKWLASRQIRCNWATKGAGTNEDKQSS 193 +V+ D+ TGR++G+GFV F ++ + A+ ++NG + ++R +R AT + +Q Sbjct: 205 KVVIDRLTGRTKGYGFVRFGDESEQLRAMTEMNGVFCSTRPMRIGPATNKKTVSGQQQYP 264 Query: 194 DGKSVVELTNGSSEDGKXXXXXXXXXXXXQYTTVYVGNLAPEVTQLDLHRHFYALGVGVI 253 S +D TTV+VGNL VT L F G V Sbjct: 265 KASYQNSQVAQSDDDPNN-------------TTVFVGNLDSIVTDEHLRELFSQYGQLV- 310 Query: 254 EEVRLQRDKGFGFVRFSTHGEAALAIQMGNTQSNLFGRQIKCSWGSKPT 302 V++ K GFV+F+ A A++M N + L G+ I+ SWG P+ Sbjct: 311 -HVKIPAGKRCGFVQFADRSCAEEALRMLNG-TQLGGQNIRLSWGRSPS 357 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1068 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs20055 59 5e-11 >Cs20055 Length = 98 Score = 58.9 bits (141), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 29/56 (51%), Positives = 37/56 (66%) Query: 54 EPRGFAFVQFVDSYEAAEAQYHMNGKIFAGREISVVLAAETRKRPEEMRQRTRVRG 109 EPRGF FV+F + +AAEA+ +N + GREI +V A E RK P+EMR RV G Sbjct: 11 EPRGFGFVKFRYAEDAAEAKQRLNHSLIGGREIKIVFAEENRKTPQEMRTSARVSG 66 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2315 (241 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs87821 84 1e-18 >Cs87821 Length = 221 Score = 84.0 bits (206), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 57/180 (31%), Positives = 90/180 (50%), Gaps = 26/180 (14%) Query: 1 MEFISPEGLRLDGRRPMEMRQIRAEIGVVSKADGSAMFEMGNTKVIAAVYGPREVQNRSQ 60 ME SP DGR P ++R + ++ +A GSA + G+TKV+AAVYGP+ +++ Sbjct: 1 MEVDSP-----DGRNPNQLRPLACSCSILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNE 55 Query: 61 QLNANAFVRCEYTMANFSTGDRMRKPKGDRRSTEISLVIRQTMEE-CILTNLMPRSQIDI 119 A+ + R + + E +++++T++ CILT + P + Sbjct: 56 NPEK----------ASIEVIWKPRTGQIGKPEKEYEIILKRTLQSICILT-INPNTTTSF 104 Query: 120 FVQVLQADGGTRSACINAATLALADAGIPMRDL---VTSCSA--GYLNNTPLLDLNYIED 174 +QV+ DG INAA AL DAGIPM+ L + CSA GY +LD +E+ Sbjct: 105 IIQVVHDDGALLPCAINAACAALVDAGIPMKHLAVAICCCSAESGYC----ILDPTKLEE 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1666 (421 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs173106183 173 3e-45 >Cs173106183 Length = 286 Score = 173 bits (439), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 83/170 (48%), Positives = 113/170 (66%), Gaps = 5/170 (2%) Query: 1 MGRQSSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKL 60 M Q+S L PGFRFHPTDEEL+ +YL+ + + I VDIYK +PW LP K++ Sbjct: 1 MEAQASTELPPGFRFHPTDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEF 60 Query: 61 KSRDTEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHSSRAVGMKKTLVFHSGR 120 + EWYFFS DRKY N +R NRAT GYWK TG D+ + S+ +G+KK LVF+ GR Sbjct: 61 GEK--EWYFFSPRDRKYPNGTRPNRATVSGYWKATGTDKAIYGGSKYLGVKKALVFYKGR 118 Query: 121 APKGARTNWVMHEYRLDN---QELEKAGIVEKDAYVLCRIFQKSGTGPKN 167 PKG +T+W+MHEYRL++ Q + G ++ D +VLCRI++K TG ++ Sbjct: 119 PPKGIKTDWIMHEYRLNDPTRQPYKHNGSMKLDDWVLCRIYKKRQTGSRS 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig788 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1568 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49513703 (69 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362365 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5225 (321 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4871 (585 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5193 (545 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52071 379 e-107 >Cs52071 Length = 230 Score = 379 bits (974), Expect = e-107, Method: Compositional matrix adjust. Identities = 181/230 (78%), Positives = 206/230 (89%) Query: 237 MKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTADQPGHDYYIVVSSRFSTPILTTTGILH 296 MKLVEVEGTHT+QTTYSSLDVHVGQSYSVLVT DQP D+YI VS+RF+ +LT+TG LH Sbjct: 1 MKLVEVEGTHTIQTTYSSLDVHVGQSYSVLVTMDQPPQDFYIAVSTRFTNKVLTSTGTLH 60 Query: 297 YSGAGGQVSGPIPGGPTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYIL 356 YS + VSGP+PGGPT QIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLIN+++T L Sbjct: 61 YSNSAHPVSGPVPGGPTTQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKL 120 Query: 357 ASAAGQVNGKQRYGINSVSFVPADTPLKLADYFKISGVFRVGSVSDRPTGGNLYLDTSVL 416 S+AGQVNGKQRY +NSVSF+PADTPLKLADYFKI GVFRVGS+ D+PTGGN+YLDTSV+ Sbjct: 121 ESSAGQVNGKQRYAVNSVSFIPADTPLKLADYFKIGGVFRVGSIQDQPTGGNIYLDTSVM 180 Query: 417 GADYRTFVEIVFQNDEDIVQSYHLDGYQFFVVGMDGGKWTTASRNGYNLR 466 GAD+R F+EIVFQN E+IVQS+H+DGY F+VVGM+GG WT ASRN YNLR Sbjct: 181 GADFRGFIEIVFQNHENIVQSWHIDGYNFWVVGMNGGVWTPASRNEYNLR 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 238017991 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158355797 (91 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89558627 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 238018040 (137 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4147 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1968 (414 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362633 (109 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158351738 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 260657394 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158369394 (276 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357520 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs45360 74 2e-15 >Cs45360 Length = 378 Score = 73.9 bits (180), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 68/248 (27%), Positives = 106/248 (42%), Gaps = 33/248 (13%) Query: 19 CDYSDGAWIYDPNASPKYDHTCKEIFKGWNCISGNKSNGRELTKWRWKPNGCDLPTFDPV 78 C+ G W+YD + P Y H C + ++C + + L K+RW+P C +P F+ + Sbjct: 63 CNIFQGKWVYDA-SYPLYSH-CPFVDPEFDCQKYGRPDDIYL-KYRWQPFSCSIPRFNGL 119 Query: 79 RFLHMYRNTSIGFIGDSLNRNMFVALFCSL-----KRVSSEVKKWRPFGADRGFTFLQYN 133 FL +R I F+GDSL+ N + +L C + K S V+ TF ++ Sbjct: 120 YFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWVPKTKYSVVRT----AVLSSITFQEFG 175 Query: 134 VTLAYHRTNLLARYGRWSANANGGVLESLGYKEGYRVDVDIPADTWAESLSFHDILIFNT 193 + + +RT L R A G VL R+D + W D+LIFNT Sbjct: 176 LQILLYRTTYLVDLVREPA---GTVL---------RLDSIKGGNAWRGM----DMLIFNT 219 Query: 194 GHWWWAPAKFDPINSPLLFFENGQPVVPPVLPDVGFDMVLKHMVMFVEKRMKPGAIK-FF 252 HWW + P + + G+ + + V F L +V + P K FF Sbjct: 220 WHWWTHTGRSQPFD----YIREGRKLYKDMNRLVAFYKGLTTWARWVNFNVDPTKTKVFF 275 Query: 253 RTQSPRHF 260 + SP H+ Sbjct: 276 QGISPTHY 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89550571 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48454 89 3e-20 >Cs48454 Length = 244 Score = 89.4 bits (220), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 52/134 (38%), Positives = 83/134 (61%), Gaps = 9/134 (6%) Query: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSSTKD 67 ++++++I+N RQVT+SKRR GLLKKA E+SVLCD E ++I+FS GKL E S+ S + Sbjct: 5 RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME 64 Query: 68 -VITRYESQTGDEGNLDQSSLD------LQHDCIKLSNEIADKSRVLRQMNGEDLEGLNI 120 ++ RYE E L + ++ L++ +K E+ +++ + GEDL L++ Sbjct: 65 RILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQ--KHFMGEDLADLSL 122 Query: 121 DELQRLETKIDGSL 134 ELQ +E +ID L Sbjct: 123 KELQSVEQQIDSGL 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3250 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42555 299 9e-84 >Cs42555 Length = 159 Score = 299 bits (766), Expect = 9e-84, Method: Compositional matrix adjust. Identities = 144/159 (90%), Positives = 149/159 (93%) Query: 1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF 60 MSDEEH FESKADAGASKT+PQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHF Sbjct: 1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF 60 Query: 61 VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 V IDIFNGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD Sbjct: 61 VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 Query: 121 DALLTQLKDGFAEGKDLVVTVMSAMGEEQICALKDIGPK 159 + LL+Q+KDGF GKDLVV+V AMGEEQI ALKDIGPK Sbjct: 121 ENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2005 (422 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158379466 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359113 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158368865 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** Database: orange.as.orf Posted date: Mar 27, 2017 5:37 AM Number of letters in database: 227,106 Number of sequences in database: 1113 Lambda K H 0.320 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1113 Number of Hits to DB: 41,865,033 Number of extensions: 1658885 Number of successful extensions: 5086 Number of sequences better than 1.0e-10: 274 Number of HSP's gapped: 4703 Number of HSP's successfully gapped: 355 Length of database: 227,106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 6.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 134 (56.2 bits)