BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2025 (285 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158360899 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8734 370 e-104 >Contig8734 Length = 260 Score = 370 bits (950), Expect = e-104, Method: Compositional matrix adjust. Identities = 175/245 (71%), Positives = 197/245 (80%) Query: 1 SATACYRCVHQTKAAYFSKAPXXXXXXXXXXXXXXXXXXXXXXXXVPSIYKDGAGCGSCF 60 SATAC RCV Q+KA++FS + VPS++K GAGCG+CF Sbjct: 15 SATACDRCVKQSKASFFSTSSALSSGACGYGSLASGFSGGHLAAGVPSLFKGGAGCGACF 74 Query: 61 QIRCKNATLCTKQGTKVITSDLNHNNQTDFVLSSRAFMAMAQKGLGQDILKHGIVDVEYK 120 Q+RCKN TLCTKQGT V +DLN +NQTDFVLSSRAF AMAQKGL Q IL+ GI+DVEYK Sbjct: 75 QMRCKNTTLCTKQGTIVTLTDLNQSNQTDFVLSSRAFAAMAQKGLDQHILRRGILDVEYK 134 Query: 121 RVPCEYKNQNLALRVEESSQKPHYLAVKVLYQGGQTEIVAIDVAQVGSSNWSFLTRNYGA 180 RVPCEYKNQNL+LRVEESSQKPHYLAVK+LYQGGQTEIVA+DVAQVGSSNWSFL+RN GA Sbjct: 135 RVPCEYKNQNLSLRVEESSQKPHYLAVKILYQGGQTEIVAMDVAQVGSSNWSFLSRNNGA 194 Query: 181 VWDTSRVPAGALQFRFVVTGGFDGKMVWAKNVLPADWKPGMVYDTKVQISDIAQEGCSPC 240 +W TSRVPAGALQFRFVVT G+DGK VWA NVLP +WK GM+YDT+VQI+DIAQEGC C Sbjct: 195 IWKTSRVPAGALQFRFVVTSGYDGKTVWAPNVLPVNWKSGMIYDTRVQITDIAQEGCPHC 254 Query: 241 DDGIW 245 DDG W Sbjct: 255 DDGSW 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158380033 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27653 167 1e-43 >Contig27653 Length = 142 Score = 167 bits (422), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 78/141 (55%), Positives = 102/141 (72%) Query: 1 MIQFVLLISRQGKVRLTKWYSPYTQKERTKVLRELSGVILARGPKLCNFVEWREYKVVYK 60 MI+F+LL +RQGK RL K+Y P E+ KV E+ +++ R PK NFVE+R +KV+Y+ Sbjct: 1 MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKFTNFVEFRTHKVIYR 60 Query: 61 RYASLYFCMCIDQDDNELEVLEIIHHFVEILDRYFGSVCELDLIFNFHKAYYILDELLIA 120 RYA L+F +C+D DNEL LE IH FVEILD +F +VCELDL+FNFHK Y ILDE ++A Sbjct: 61 RYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFILA 120 Query: 121 GELQESSKKTIARLIAAQDSL 141 GELQE+SKK I + + L Sbjct: 121 GELQETSKKAIIERMGELEKL 141 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5378 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548426 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4047 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91030313 183 1e-48 >91030313 Length = 125 Score = 183 bits (465), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 90/112 (80%), Positives = 99/112 (88%) Query: 14 SCHRVLSLLSQPQDRVQFRNLEVETGKAVFRFKKVVSLLNTGLGHARVRKLKKLQIPFPE 73 SCHRVLSLLSQPQ++VQ+RNL VETGKAV RFKKVVS+LNTGLGHARVRKLKKLQIPFPE Sbjct: 14 SCHRVLSLLSQPQEQVQYRNLTVETGKAVSRFKKVVSILNTGLGHARVRKLKKLQIPFPE 73 Query: 74 SVLLDNPNCTTDHHSKTPHFLQSRFAENPSQDLSLGVRNSLSLGNPSLELST 125 +LLDNP D SKTPHFLQS F ENP+QDLSL V+++L LGNPSLELST Sbjct: 74 RILLDNPISIADRPSKTPHFLQSSFPENPTQDLSLDVKSALCLGNPSLELST 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542775 (117 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158351412 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3735 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1742 (369 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5029 (421 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27225 420 e-119 >Contig27225 Length = 424 Score = 420 bits (1079), Expect = e-119, Method: Compositional matrix adjust. Identities = 236/439 (53%), Positives = 305/439 (69%), Gaps = 33/439 (7%) Query: 1 MENQKEGHELISMTYTWTIDNFSKLKTRKHYSDGFVVGDFKWRIVVYPKGSNGR---QFL 57 ME ++ G EL+S+T+TW I+ FS+L+++KHYSDGF VGDF+W+IVVYPKGS+G L Sbjct: 1 MEKKQVG-ELVSVTFTWKIEKFSRLRSQKHYSDGFNVGDFQWQIVVYPKGSSGTPGTHDL 59 Query: 58 SMYLNVADASKLPSGWSRYAEFTLTVVNQFNSDKSITIDTQHQFSAKKSDWGFTSFMPLN 117 S+YLNVADAS LPSGWSRYA+FTLTVVNQ N DKSIT++T+H FSA+KSDWGFTSFMPL+ Sbjct: 60 SIYLNVADASALPSGWSRYAQFTLTVVNQVNYDKSITVETKHVFSARKSDWGFTSFMPLS 119 Query: 118 ELYDQNEGYIVDDICIVEAEVAVSKADIKVLKDQETAFLEQ-ELQXXXXXXXXXXXXXXX 176 EL D ++G++V+D C++EAEVAVS+ D + + ET F + Sbjct: 120 ELCDFSQGFLVNDTCVLEAEVAVSQVDY-MAEVHETWFCPPIQPSDHERQGHTDVDAVQL 178 Query: 177 TTHTSLCYEQMLALHNSLIPDPVQTN-VDSPQAPSLKI-IPRSDEVLPYQE--------- 225 T TS EQ+LA ++ + QTN + S+ + P S +VL + Sbjct: 179 TAPTS---EQVLAFQDASSSEQKQTNDFEQVLISSVAVTTPSSAQVLALWDGPSDGQVWT 235 Query: 226 --TDSPVGPPIVEESILDESDDVPSTPVGELIDFRGLGKIDKAFVPLLEEVCLWHPSLIS 283 +S VG PI + E + PS PVGEL++FRGLG+IDKAFVP LEEVCL HPSLI Sbjct: 236 GGNNSLVGSPIGK-----EHEQKPSAPVGELMNFRGLGQIDKAFVPFLEEVCLMHPSLIK 290 Query: 284 CQRKRSRMFSEWAFTALGRVLHFLNTTKVRDMMEDSCEHDPCEHLQVLWEEVEAFKFDLS 343 CQRKRS MF+EWAFTALGR+L+FL TTK DM D+ CEHL++ WEE+E+F+FDL+ Sbjct: 291 CQRKRSPMFTEWAFTALGRLLYFLKTTKGTDMNVDA-----CEHLRLSWEELESFRFDLA 345 Query: 344 WLQPFVQSALGMKKFGEREGVLKKLGEDVDALETEMRGLRERLAVAEVAHRLAKGDLEIA 403 WL+P +QSALGMKKF ERE +K L ++D+LE E++ L+ RL VAE+ AK D+ A Sbjct: 346 WLEPHIQSALGMKKFVERELEVKDLRNNMDSLEIEVKRLKARLNVAELDFEDAKRDVGEA 405 Query: 404 EESFGEANMNSKLGY-GRH 421 EESF E NM+S+LGY GRH Sbjct: 406 EESFVEINMDSELGYGGRH 424 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3566 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4715 169 2e-44 >Contig4715 Length = 160 Score = 169 bits (429), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 86/156 (55%), Positives = 110/156 (70%), Gaps = 8/156 (5%) Query: 16 KPVMVAVDESECSHYALMWVIDNLKESINTNSPLLIFMAQPPPANNITFAAPLGSARMYC 75 K VMVA+DESE S YA W ++NL+E+I + S L++F AQP I FA+ ++ Y Sbjct: 11 KKVMVAIDESEFSLYAFNWALENLRETIQS-SQLVVFTAQP-----IDFASTYAAS--YG 62 Query: 76 PPTPEFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEIGDAKTAICAAVLKHNVKL 135 + ++ ENH+K+ ALLERAK+ICA HG+ +TVTE+GD K IC AV KHN++L Sbjct: 63 AAPAQLVTSLLENHKKVALALLERAKEICAKHGIVPETVTEVGDPKVVICEAVEKHNIQL 122 Query: 136 LVLGERGLGKIKRAILGSVSNYCVLNAKCPVLVVKK 171 LVLG G G I+RA LGSVSNYCV NAKCPVLVV+K Sbjct: 123 LVLGSHGRGGIQRAFLGSVSNYCVHNAKCPVLVVRK 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 260658896 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89550719 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2908 (68 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158370739 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 52024425 313 8e-88 >52024425 Length = 183 Score = 313 bits (803), Expect = 8e-88, Method: Compositional matrix adjust. Identities = 143/164 (87%), Positives = 154/164 (93%) Query: 17 APVQASMVAPFNGLKSASAFPVTRKANDITTLASNGGRVQCMQVWPPVGLKKFETLSYLP 76 AP QASMVAPF GLKS+SAFPVTRK+NDIT++ASNGGRVQCMQVWPP+GLKKFETLSYLP Sbjct: 20 APAQASMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLP 79 Query: 77 PLSVESLAKEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGYYDGRYWTMWKLPMFGCTD 136 PLS ESLAKEV+YLLR WVPCLEFELEHGFVYRE+ SPGYYDGRYWTMWKLPMFGCTD Sbjct: 80 PLSSESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTD 139 Query: 137 ASQVIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKPASY 180 +SQV+ ELEEAKK YP AFIRIIGFDN+RQVQC+SFIAYKPASY Sbjct: 140 SSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKPASY 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5896 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14225 254 8e-70 >Contig14225 Length = 170 Score = 254 bits (648), Expect = 8e-70, Method: Compositional matrix adjust. Identities = 116/150 (77%), Positives = 132/150 (88%) Query: 18 CKNPVDGFSAGLVDENNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTSE 77 CK+PVDGFSAGLV+E+NIFEW+VTIIGPPDTLYEGGFFNAIMSFP +YP +PP V+FTSE Sbjct: 21 CKHPVDGFSAGLVNEDNIFEWNVTIIGPPDTLYEGGFFNAIMSFPEDYPCNPPIVRFTSE 80 Query: 78 LWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVEXXXXXXXXXXXXPNDESPA 137 +WHPNVY DG+VC+SILHPPGDDPNGYELA+ERW PVHTVE PNDESPA Sbjct: 81 MWHPNVYADGKVCVSILHPPGDDPNGYELATERWNPVHTVESILLSIISMLSSPNDESPA 140 Query: 138 NVEAAKEWRDRRDDFKKKVGRCVRKSQEML 167 NV+AAK+WR+ RD+F+KKVGRCVRKSQEML Sbjct: 141 NVDAAKQWRESRDEFRKKVGRCVRKSQEML 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89543424 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89545582 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4306 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10241 219 5e-59 >Contig10241 Length = 311 Score = 219 bits (557), Expect = 5e-59, Method: Compositional matrix adjust. Identities = 105/199 (52%), Positives = 140/199 (70%), Gaps = 2/199 (1%) Query: 69 EKLKSGFVHFRTEKFEKDVDLYGKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVR 128 E +K F+ F+ K+ ++++ Y LA GQ+PKFMV +C+DSRVCPS IL FQPGEAF+VR Sbjct: 94 EDMKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCPSTILGFQPGEAFIVR 153 Query: 129 NIANMVPPFDTTKHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDF 188 NIAN+VP ++ S AA+E++V LKVENI+V+GHSCCGGI+ LMS+ DD S F Sbjct: 154 NIANLVPSLESGP-SETNAALEFSVNSLKVENILVVGHSCCGGIRALMSM-DDEIEKSSF 211 Query: 189 IENWVQICAPAKNKIKSSCGDLSFADQCTSLEKEAVNVSLGNLLTYPFVREAVVNNTLAL 248 I+NWV + A++ K++ LSF QC EKE++N SL NLLTYP++ E V LA+ Sbjct: 212 IQNWVVVGKDARSWTKAAASTLSFDQQCKHCEKESINRSLLNLLTYPWIEEKVKQGVLAV 271 Query: 249 KGGHYDFVGGGFELWDLDF 267 GG+YDFV FE W LD+ Sbjct: 272 HGGYYDFVECTFEKWTLDY 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363625 (78 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361279 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 238017486 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 285809273 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4618 (228 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1094 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5220 (647 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5971 342 9e-96 >Contig5971 Length = 318 Score = 342 bits (877), Expect = 9e-96, Method: Compositional matrix adjust. Identities = 167/297 (56%), Positives = 222/297 (74%), Gaps = 1/297 (0%) Query: 325 KCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXX 384 K + DA ++K + ++VLVGGSTRIPKVQQLL+D+F+GKE K +NPDE Sbjct: 2 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 61 Query: 385 ILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGV 444 ILSGEG E+ +D ET GGVMT LIPRNT IPTKK QVF+TY D Q V Sbjct: 62 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 121 Query: 445 LIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQK 504 IQV+EGER+ T+D LGKF+L+GIPPAPRG PQI V F++DANGILNV AEDK TG+ Sbjct: 122 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRAEDKGTGKS 181 Query: 505 NKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKD-EK 563 KITITNDKGRLS+EEI++MV+EAE++ ED++ K++++A+N+LE Y YNM+N I D +K Sbjct: 182 EKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDK 241 Query: 564 IGEKLPGADKKKIEDAIEAAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGS 620 + +KL +K+KIE A + A++WLD NQ AE +++++K+KE+E++CNPII+ +YQ S Sbjct: 242 LADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISAVYQRS 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363092 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2685 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7568 142 1e-36 >Contig7568 Length = 115 Score = 142 bits (359), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 69/93 (74%), Positives = 78/93 (83%) Query: 24 QAITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSLNSAAKTTADRKQTCNCLKSAAGSI 83 AITCGQVT ++APC YV+SGGAVP ACCNGIR++N A+TTADR+ CNCLK+ AGSI Sbjct: 23 HAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSI 82 Query: 84 KGLNANLAAGLPGKCGVNVPYKISTSTNCNNVK 116 G+N N AAGLPGKCGVNVPYKISTSTNC VK Sbjct: 83 SGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1248 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7568 92 2e-21 >Contig7568 Length = 115 Score = 92.4 bits (228), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 51/122 (41%), Positives = 67/122 (54%), Gaps = 7/122 (5%) Query: 1 MAFSGVQKVVFLVVLSMXXXXXXXXXXXXXTCGQVVNKLMPCVSYVQNGGTPAANCCGGI 60 MA S V K+ +V L M TCGQV + L PC+ YV++GG CC GI Sbjct: 1 MASSAVTKLALVVALCMAVSVAHAI-----TCGQVTSSLAPCIGYVRSGGAVPPACCNGI 55 Query: 61 RALYGMAQTTPDRQSVCNCLKQAIAGIPYTXXXXXXXXXXXXKCGVNIPYKINPSTDCKS 120 R + G+A+TT DRQ+ CNCLK I + KCGVN+PYKI+ ST+C + Sbjct: 56 RTINGLARTTADRQTACNCLKNLAGSI--SGVNPNNAAGLPGKCGVNVPYKISTSTNCAT 113 Query: 121 IK 122 +K Sbjct: 114 VK 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3126 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89541679 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89557249 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3297 (73 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363934 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig392 (80 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2467 (274 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3332 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3414 (368 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 118496051 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig150 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20067 202 2e-54 >Contig20067 Length = 133 Score = 202 bits (513), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 97/133 (72%), Positives = 108/133 (81%), Gaps = 2/133 (1%) Query: 1 MSWQAYVDDHLLCDIDGN--HLASAAIVGHDGSVWAQSSNFPKFKPEEITAIMKDFDEPG 58 MSWQ YVDDHL+CDIDG HL +AAI+G DGSVWA+SS+FP+FKPEE+T I KDF+EPG Sbjct: 1 MSWQTYVDDHLMCDIDGQGQHLTAAAIIGLDGSVWAKSSSFPQFKPEEMTGINKDFEEPG 60 Query: 59 TLAPTGLHLAGTKYMVIQGEGGAVIRXXXXXXXXXXXXXXQALVFGIYEEPLTPGQCNMI 118 LAPTGLHL GTKYMVIQGE GAVIR QALVFGIYEEP+TPGQCNM+ Sbjct: 61 HLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120 Query: 119 VERLGDYLIDQGL 131 VERLGDYL+DQGL Sbjct: 121 VERLGDYLVDQGL 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3257 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1874 (302 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5089 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548708 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1668 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1709 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2475 61 5e-12 >Contig2475 Length = 95 Score = 60.8 bits (146), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 36/64 (56%), Positives = 40/64 (62%) Query: 47 NSQKASYQTGEAKGQTQEKANTMMGKAGNAAQSAKETMLNAGQTIQQKXXXXXXXXXXXT 106 N+QK SY G AKGQ QEK +TMM KA +AAQSA TM AGQT+Q K T Sbjct: 32 NTQKMSYNAGVAKGQAQEKTSTMMDKANSAAQSAMGTMQGAGQTVQAKAVGAVDAVKNAT 91 Query: 107 GMNK 110 GMNK Sbjct: 92 GMNK 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3221 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5015 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4695 (382 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 157 4e-40 >Contig31581 Length = 128 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGM 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 137 IQKESTLHLVLRLRGGM 153 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 213 IQKESTLHLVLRLRGGM 229 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 289 IQKESTLHLVLRLRGGM 305 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 156 bits (395), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 76/76 (100%), Positives = 76/76 (100%) Query: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 365 IQKESTLHLVLRLRGG 380 IQKESTLHLVLRLRGG Sbjct: 61 IQKESTLHLVLRLRGG 76 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5205 (347 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13441 121 1e-29 >Contig13441 Length = 361 Score = 121 bits (304), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 57/70 (81%), Positives = 64/70 (91%) Query: 28 NTVVYKTDMHCEGCAKKIKRAVKNFPGVEQVKTDAGANKLTVTGKMDPAALKARLEEKIK 87 N ++KTD+HCEGCAKKIKRAVKNF GVEQVKTD+ ANKLTVTGK+DPA LK +LE+KIK Sbjct: 28 NIFIFKTDIHCEGCAKKIKRAVKNFEGVEQVKTDSAANKLTVTGKVDPAGLKEKLEQKIK 87 Query: 88 KKVDLVSPQP 97 KKVDLVSPQP Sbjct: 88 KKVDLVSPQP 97 Score = 104 bits (259), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 56/74 (75%), Positives = 63/74 (85%), Gaps = 2/74 (2%) Query: 276 VNKMEYSGYPYAASTSYWYDPGHVYNHNKFVMEAQEHQAHVNQGYGH--YAMPMEHYPAP 333 ++KMEY+GYPY + YWYD GHVYNHNKFVMEAQ HQAH++QG YA+PMEHYPAP Sbjct: 288 MSKMEYNGYPYPPPSYYWYDEGHVYNHNKFVMEAQAHQAHISQGSSSHGYAVPMEHYPAP 347 Query: 334 QMFSDENPNGCSVM 347 QMFSDENPNGCSVM Sbjct: 348 QMFSDENPNGCSVM 361 Score = 100 bits (249), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 46/65 (70%), Positives = 54/65 (83%) Query: 145 TVPLKIRLHCEGCIQKMRSKILKYKGVSTVSFDMAKDLVTVVGTMDTKTLVPYLSEKFKR 204 V LKIRLHCEGC+QKM+SKI K+KGV+ VSFD +KDLVTV G MD K LVPYL EKF+R Sbjct: 152 AVVLKIRLHCEGCMQKMKSKISKFKGVNNVSFDASKDLVTVKGFMDVKELVPYLKEKFRR 211 Query: 205 PVDVI 209 V+V+ Sbjct: 212 AVEVV 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158371589 (103 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10799 163 6e-43 >Contig10799 Length = 252 Score = 163 bits (412), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 81/102 (79%), Positives = 84/102 (82%) Query: 1 MTFGLVYTVYATAVDPKRGSVGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVS 60 MTFGLVYTVYATA+DPK+GSVGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVS Sbjct: 151 MTFGLVYTVYATAIDPKKGSVGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVS 210 Query: 61 WSWENHWVYWXXXXXXXXXXXXXYEFFFINNSGHEPLPGGEY 102 WSWENHWVYW YEF FI NSGHE LP +Y Sbjct: 211 WSWENHWVYWAGPLIGAGIAGVIYEFVFIGNSGHEQLPSTDY 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5844 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 51912285 244 5e-67 >51912285 Length = 154 Score = 244 bits (623), Expect = 5e-67, Method: Compositional matrix adjust. Identities = 119/148 (80%), Positives = 132/148 (89%) Query: 11 MDFSKSSKNALQWAIDNLVDKGDTLHIIHINNNKHDESRNVLWAKSGSPLIPLSEFRELE 70 MDFSKSSKNAL+WAI NL DKGDTL+IIHI N ESR+ LWA+SGSPLIPL+EFRE + Sbjct: 1 MDFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLTEFREPQ 60 Query: 71 VMKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYWGDAREKLLQAVEDLKLDSLVMGSRGL 130 +MK YGV TDMEVLD LDTVSRQKEV ++TK+YWGDAREKLLQAVEDLKLDSLVMGSRGL Sbjct: 61 IMKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGL 120 Query: 131 GTLKRIVLGSVSNYVMTQAPIPVTIVKD 158 T+KRIVLGSVSN+V+T A IPVTIVKD Sbjct: 121 STIKRIVLGSVSNFVLTNASIPVTIVKD 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24 (471 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23352 735 0.0 >Contig23352 Length = 437 Score = 735 bits (1898), Expect = 0.0, Method: Compositional matrix adjust. Identities = 352/437 (80%), Positives = 382/437 (87%), Gaps = 3/437 (0%) Query: 1 MAASISTTIGAVRAPLKLNXXXXXXXXXXXXXLRKNLRKVSSK---TRISSGNFKVAAEY 57 MA ++ST RAP LN L +L+KV+S+ +++SSG+ ++ A Sbjct: 1 MATAVSTIGSVNRAPPNLNGSSSSASVPSSTFLGSSLKKVNSRFTNSKVSSGSLRIVASV 60 Query: 58 DEEKQTSKDRWGGLVTDTSDDQQDITRGKGMVDTLFQAPTGCGTHDAIMSSYDYISTGLR 117 DE+KQT KDRW GL DTSDDQQDITRGKG VD+LFQAP G GTH AIMSSY+YISTGLR Sbjct: 61 DEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYISTGLR 120 Query: 118 QYNLDNIMDGYYIAPAFMDKLVVHITKNFLNLPNIKVPLILGVWGGKGQGKSFQCELVFA 177 QYN DN MDGYYIAPAFMDKLVVHITKNF+ LPNIKVPLILG+WGGKGQGKSFQCELVFA Sbjct: 121 QYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCELVFA 180 Query: 178 KMGINPIMMSAGELESGNAGEPAKLIRQRYREAADIISKGKMCCLFINDLDAGAGRLGGT 237 KMGI+PIMMSAGELESGNAGEPAKLIRQRYREAADII KGKMC LFINDLDAGAGRLGGT Sbjct: 181 KMGISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGRLGGT 240 Query: 238 TQYTVNNQMVNATLMNIADNPTNVQLPGMYNKQENPRVPIIVTGNDFSTLYAPLIRDGRM 297 TQYTVNNQMVNATLMNIADNPTNVQLPGMYNK+ENPRVPIIVTGNDFSTLYAPLIRDGRM Sbjct: 241 TQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDGRM 300 Query: 298 EKFYWAPTREDRIGVCTGIFKTDNVPTDDIVKLVDAFPGQSIDFFGALRARVYDDEVRKW 357 EKFYWAPTREDRIGVC GIF++DNV +DIVKLVD FPGQSIDFFGALRARVYDDEVRKW Sbjct: 301 EKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKW 360 Query: 358 VASVGVEGVGKRLVNSKEGPPTFEQPKMTLAKLLEYGNMLVQEQENVKRVQLSDKYLKEA 417 + VGV+ +GK+LVNSKEGPPTFEQPKMT+ KLLEYGNMLVQEQENVKRVQL+DKYL EA Sbjct: 361 ITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYLSEA 420 Query: 418 ALGDANDDAIKSGNFYG 434 ALGDAN DA+ +G FYG Sbjct: 421 ALGDANSDAMNTGTFYG 437 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2427 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7976 317 1e-88 >Contig7976 Length = 241 Score = 317 bits (812), Expect = 1e-88, Method: Compositional matrix adjust. Identities = 170/258 (65%), Positives = 198/258 (76%), Gaps = 19/258 (7%) Query: 1 MASLHLRLLCIASLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNL 60 MASL + ++ SL S + G Y G W AHATFYGG DASGTMGGACGYGNL Sbjct: 1 MASLGILVIGFLSLVS-------SVNGYYGG--WSNAHATFYGGGDASGTMGGACGYGNL 51 Query: 61 YSQGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQP 120 YSQGYG NTAALSTALFNNGL+CGAC++I+C +DP+WC G SI VTATNFCPP Sbjct: 52 YSQGYGTNTAALSTALFNNGLTCGACYQIRCVNDPQWCLPG--SIIVTATNFCPP----- 104 Query: 121 SDNGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLV 180 GGWC+PP+ HFDL+ P+FL+IA+YKAG+VPVSYRRV C ++GGIRFT+NGH YFNLV Sbjct: 105 ---GGWCDPPQQHFDLSQPVFLRIAQYKAGVVPVSYRRVRCRRRGGIRFTVNGHSYFNLV 161 Query: 181 LVTNVAGAGDIVSVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTY 240 LVTNV GAGD+ SV++KG+ T W MSRNWGQNWQSNS L GQ+LSF V SD R +Y Sbjct: 162 LVTNVGGAGDVQSVAIKGSRTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSY 221 Query: 241 NVAPANWQFGQTYSGKNF 258 NVAP NW FGQTY+G+ F Sbjct: 222 NVAPPNWSFGQTYTGRQF 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89546967 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26370 73 2e-15 >Contig26370 Length = 406 Score = 72.8 bits (177), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 39/89 (43%), Positives = 56/89 (62%) Query: 1 MTLAIFTKIMVLGLLEPVLDQNLYYLGMKYTTATFAAAMSNILPALTFVMAWILRLEKVK 60 +TL + +L L+ +Q Y LG+ T+ TFA+A+ N +PA+TF+MA ILR+E V+ Sbjct: 80 ITLNFLIQFFLLALVGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAAILRIEHVR 139 Query: 61 LTCIRSQCKLLGTAATVAGAMIMTLVKGP 89 L K+LGT VAGA ++TL KGP Sbjct: 140 LNRKDGIAKVLGTVFCVAGASVITLYKGP 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2062 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57896167 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89551201 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7270 111 1e-26 >Contig7270 Length = 365 Score = 111 bits (277), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 79/236 (33%), Positives = 115/236 (48%), Gaps = 27/236 (11%) Query: 31 TIPRIFHSRSQPNVDQREGGDDDAR-------FS--IPTIDLQGGKIQADSALRAEVMEK 81 T+ I H ++ + Q+ D+D R FS IP I L G I R E+ +K Sbjct: 7 TLTSIAHEKT---LQQKFVRDEDERPKVAYNDFSNEIPIISLAG--IDEVEGRRGEICKK 61 Query: 82 VRHACEKWGFFQVVNHGIPVNVLDEVIRGIREFHEQDSELKKEFYTRTPGKKVYYHSNYD 141 + ACE WG FQ+V+HG+ ++ E+ REF SE K F + GKK + + Sbjct: 62 IVAACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLRF-DMSGGKKGGFIVSSH 120 Query: 142 LYQASSTDWRDTLGCFMAP--------NPPKPEELPSVCRDIVIEYSKHVMEVGLTLFEI 193 L + DWR+ + F P P KPE R++ +YS +M + L + Sbjct: 121 LQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPE----AWREVTKKYSDELMGLACKLLGV 176 Query: 194 LSESLGLNPNHLKDMNCAEGLLLLGHCYPACPEPDLTFGASKHTDGTFITILLQDQ 249 LSE++GL+ L ++ + YP CP+PDLT G +HTD IT+LLQDQ Sbjct: 177 LSEAMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQ 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5653 (653 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5971 313 7e-87 >Contig5971 Length = 318 Score = 313 bits (801), Expect = 7e-87, Method: Compositional matrix adjust. Identities = 158/295 (53%), Positives = 201/295 (68%), Gaps = 1/295 (0%) Query: 325 KCLRDAKIDKSLIHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXX 384 K + DA ++K I ++VLVGGSTRIPKVQQLL+D+F+GKE K +NPDE Sbjct: 2 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 61 Query: 385 ILSGEGDQKVQXXXXXXXXXXXXXXETAGGVMTTLIPRNTTIPTKKEQIFSTYSDNQPGV 444 ILSGEG ++ + ET GGVMT LIPRNT IPTKK Q+F+TY D Q V Sbjct: 62 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 121 Query: 445 LIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVCFDIDANGILNVSAEDKTAGVK 504 IQV+EGER+ TKD LGKF+LTGIPPAPRG PQI V F++DANGILNV AEDK G Sbjct: 122 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRAEDKGTGKS 181 Query: 505 NKITITNDKGRLSKEDIEKMVQXXXXXXXXXXXXXXXXXXXNALENYAYNMRNTIKD-DK 563 KITITNDKGRLS+E+I++MV+ N+LE Y YNM+N I D DK Sbjct: 182 EKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDK 241 Query: 564 IAGKLDPSDKQTIEKAVEEAIQWLEGNQLAEVDEFEDKQKELEGICNPIIAKMYQ 618 +A KL+ +K+ IE A +EA++WL+ NQ AE +++++K KE+E +CNPII+ +YQ Sbjct: 242 LADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISAVYQ 296 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4034 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362653 (43 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4492 (495 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89551100 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11014 77 2e-16 >Contig11014 Length = 227 Score = 77.0 bits (188), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 51/195 (26%), Positives = 100/195 (51%), Gaps = 11/195 (5%) Query: 8 ILATASYDHTIRFWEAKGGR---CYRTIQYPDSQVNRLEITPDKRFLAAAGNPHI-RLFD 63 + ++S D T+R W K CY+ YP V ++ +P + A+A + R++ Sbjct: 34 FILSSSADSTVRLWSTKLNANLVCYKGHNYP---VWDVQFSPVGHYFASASHDRTARIWS 90 Query: 64 VNSNSPQPVMSYDSHTNNVMAVGFQCDGNWMYSGSEDGTVKIWDLRAPGCQREY-ESRAA 122 ++ P +M+ H ++V V + + N++ +GS D TV++WD++ C R + R+ Sbjct: 91 MDRIQPLRIMA--GHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQTGECVRIFIGHRSM 148 Query: 123 VNTVVLHPNQTELISGDQNGNIRVWDLTANSCSCELVPEVDTAVRSLTVMWDGSLVVAAN 182 V ++ + P+ + SGD++G I +WDL+ C L+ + V +L +GSL+ + + Sbjct: 149 VLSLAMSPDGRYMASGDEDGAIMMWDLSTGRCVTPLMGHT-SCVWTLDFSGEGSLLASGS 207 Query: 183 NHGTCYVWRLLRGTQ 197 T +W + T+ Sbjct: 208 ADCTVKLWDVTASTK 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89551566 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10364 375 e-106 >Contig10364 Length = 221 Score = 375 bits (963), Expect = e-106, Method: Compositional matrix adjust. Identities = 177/180 (98%), Positives = 177/180 (98%) Query: 9 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYI 68 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYI Sbjct: 25 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYI 84 Query: 69 HGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRK 128 HGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRK Sbjct: 85 HGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRK 144 Query: 129 KNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDMATQLQHEAEL 188 KNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQ DMA Q QHEAEL Sbjct: 145 KNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQFDMAAQQQHEAEL 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2233 (595 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10909 278 1e-76 >Contig10909 Length = 570 Score = 278 bits (712), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 186/582 (31%), Positives = 289/582 (49%), Gaps = 31/582 (5%) Query: 14 DVVAGCVMPYIVDAKDREAVSLVCRRWYELDALTREHVTIALCYTTSPERLRRRFSQLKS 73 D V + + KDR AVSLVC+ W+ ++ +RE V I CY SPER+ RF LKS Sbjct: 6 DEVVEHIFESVTSQKDRNAVSLVCKSWFRIERFSRERVFIGNCYAISPERVIERFPGLKS 65 Query: 74 LKLKGKPRAAMFNLIPEDWGGFVTPWVEEIAESFKSLKHLHFRRMIVRDSDLELLARSRG 133 L LKGKP A FNL+P +WGGF+ PW+E +A+ L+ L +RM+V D LELL+R Sbjct: 66 LTLKGKPHFADFNLVPHEWGGFLQPWIEALADGRVGLEELRLKRMVVSDESLELLSR-LF 124 Query: 134 RELLSLKLDKCSGFSTQGLVHITRNCRELRTLFLEESSIIENEDERGEWLHQLAINNTVL 193 SL L C GF+T+GL I NCR L+ L L+E+ I +D RG WL ++T L Sbjct: 125 PNFKSLVLVSCEGFTTEGLAAIAANCRFLKELDLQENDI---DDHRGHWLSCFPESSTSL 181 Query: 194 ETLNFYMTDLDKIKFEDLELIARNCPSLTSVKISDREILDLL-GFFHHATALEEFCGGSF 252 +LNF +I LE + P L ++++ D L A L + GS+ Sbjct: 182 VSLNFACLK-GEINLAALERLVARSPDLKVLRLNRAVPPDTLQKVLTQAPQLVDLGTGSY 240 Query: 253 NDQSEE------KYSVVSLPRKLSRLGLTMMGRNEMPIVFXXXXXXXXXXXXXXX-XXTE 305 S+ K +++ S G +G +P ++ Sbjct: 241 VLDSDSDTYNKLKATILKCKSIKSLSGFLEVGPRCLPSIYPILENLTSLNLSYASGVHGS 300 Query: 306 DHCTLIQKCPNLIVLETRNVIGDRGLEVLAQNCKKLRRLRIERGADEQEMEDEDGVVSQR 365 + LI++C L L + IGD+GL V+A++CK+L+ LR+ V++ Sbjct: 301 ELIELIRQCVKLQRLWILDCIGDKGLGVVAKSCKELQELRV---FPSDPFAAGHASVTEE 357 Query: 366 GLMAIAQGCLELEYLAVYVSDITNTSLECIGTHSKNLTDFRLVLLD--REEIVSDLPLDN 423 GL+AI+ GC ++ L + +TN +L + + N FRL +LD + + V+ PLD Sbjct: 358 GLVAISAGCPKIHSLLYFCQQMTNAALITVAKNCPNFIRFRLCILDPTKPDAVTMQPLDE 417 Query: 424 GVRALLRGCQKLRRFALYLRPGGLTDKGLFYVGQYSPNVRWMLLGYVGETDTGLEDFSRG 483 G A+++ C+K+RR +L G LTD+ Y+G Y+ + + + + G++D G+ G Sbjct: 418 GFGAIVQACKKIRRLSL---SGLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNG 474 Query: 484 CPSLQKLEMRGCCFSERALANAVMQLPSLRYLWVQGYRGSGTGHDLLGMARPYWNIELIP 543 C L+KLE+R F +AL V + ++R LW+ + G L P N+E+I Sbjct: 475 CKKLRKLEIRDSPFGNKALLRDVGKYEAMRSLWMSSCEVTLGGCKALAKKMPRLNVEIIN 534 Query: 544 PR-RVDVSDQSGEAETVVVEHPAHILAYYSLAGPRTDFPDSV 584 ++D+ D+ + + Y +L G R D P+ V Sbjct: 535 ENDQMDLDDE---------QRVEKMYLYRTLVGKRRDTPEFV 567 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3947 (58 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57895483 (146 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2154 (343 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1387 (88 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2367 (649 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5971 332 1e-92 >Contig5971 Length = 318 Score = 332 bits (851), Expect = 1e-92, Method: Compositional matrix adjust. Identities = 166/295 (56%), Positives = 209/295 (70%), Gaps = 1/295 (0%) Query: 325 KCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXX 384 K + DA ++K + ++VLVGGSTRIPKVQQLL+D+F+GKE K +NPDE Sbjct: 2 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 61 Query: 385 ILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGV 444 ILSGEG E+ +D ET GGVMT LIPRNT IPTKK QVF+TY D Q V Sbjct: 62 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 121 Query: 445 LIQVFEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQK 504 IQVFEGER+ T+D LGKF+L+GIPPAPRG PQI V F++DANGILNV AEDK TG+ Sbjct: 122 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRAEDKGTGKS 181 Query: 505 NKITITNDKGRLSKEEIEKMVQEAXXXXXXXXXXXXXXXXXNALENYAYNMRNTIKD-EK 563 KITITNDKGRLS+EEI++MV+EA N+LE Y YNM+N I D +K Sbjct: 182 EKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDK 241 Query: 564 IASKLDAGDKKKIEDAIEQAIQWLDGNQLAEAEEYDDKVKELEGICNPIIAKMYQ 618 +A KL++ +K+KIE A ++A++WLD NQ AE E+YD+K+KE+E +CNPII+ +YQ Sbjct: 242 LADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISAVYQ 296 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77982401 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226756907 96 3e-22 >226756907 Length = 114 Score = 96.3 bits (238), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 43/94 (45%), Positives = 65/94 (69%) Query: 20 LMVGLDNSGKTTIVLRINGEDTSVVSPTLGFNIKTLTYQKYTLNIWDVGGQKTIRSYWRN 79 LMVGLD +GKTTI+ ++ + PT+GFN++T+ Y+ + +WDVGGQ IR WR+ Sbjct: 21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 Query: 80 YFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEE 113 YF+ T GL++VVDS+D R+ + + EL +L E+ Sbjct: 81 YFQNTQGLIFVVDSNDRDRVVEARDELHRMLNED 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3724 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19252 87 2e-19 >Contig19252 Length = 125 Score = 87.0 bits (214), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 2/81 (2%) Query: 171 DTLKLGACVDLLGGLVHIGLGDPVVNECCPVLSGLVELEAAVCLCTALKIKLLNLNIFVP 230 DTLKLGACVDLLG LV++ +G P + CC +L GL +LEAA+CLCT +K L LN+ VP Sbjct: 46 DTLKLGACVDLLG-LVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALGLNMEVP 104 Query: 231 IALQLLVT-CGKSPPPGFTCS 250 +AL LLV+ C K+ PPGF C Sbjct: 105 VALSLLVSACQKTVPPGFKCE 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4517 (333 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89554763 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3070 (218 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig908 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15008 321 6e-90 >Contig15008 Length = 219 Score = 321 bits (823), Expect = 6e-90, Method: Compositional matrix adjust. Identities = 165/219 (75%), Positives = 180/219 (82%), Gaps = 3/219 (1%) Query: 1 MASAAPMASQLKSTFTSPVSR--ALLAPKGLSASPLKLFPSKRSSSFTIKATQTDKP-FQ 57 MASA+PMASQLKS FTSP++ ALL+PKGLSASPLKLFPSKR SSF+IKA Q+DK FQ Sbjct: 1 MASASPMASQLKSNFTSPITTRPALLSPKGLSASPLKLFPSKRLSSFSIKAVQSDKQNFQ 60 Query: 58 VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFV 117 VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRG+EVGLAHG+LLVGPFV Sbjct: 61 VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFV 120 Query: 118 KAGPLRNTEXXXXXXXXXXXXXXXXXXXCLTMYGIASFKEGEPSTAPSLTLTGRKKEPDQ 177 K GPLRNT CLT+YGI+SFKEGEPS+AP+LTLTGRKKEPDQ Sbjct: 121 KTGPLRNTPYAGGAGSLAAAGLVVILTLCLTIYGISSFKEGEPSSAPALTLTGRKKEPDQ 180 Query: 178 LQTAEGWAKXXXXXXXXXISGVTWAYFLLYVLNLPYYVK 216 LQTAEGW+K ISGVTWAYFLLYV+NLPY+ K Sbjct: 181 LQTAEGWSKFTGGFFFGGISGVTWAYFLLYVVNLPYFFK 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4283 (582 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10804 782 0.0 >Contig10804 Length = 576 Score = 782 bits (2020), Expect = 0.0, Method: Compositional matrix adjust. Identities = 408/590 (69%), Positives = 439/590 (74%), Gaps = 26/590 (4%) Query: 1 MCKGSKNTVISSNFIMESEFQKQNGAGLNKSSVLVELSASDNLDAFRSEVEEKGLHVDEA 60 MCK SK+ + SNFIMESEFQKQ SVLVELSASDNLDAFR+EVEEKG HVDEA Sbjct: 1 MCKVSKDKLSPSNFIMESEFQKQK-------SVLVELSASDNLDAFRTEVEEKGFHVDEA 53 Query: 61 SFWYGRRIGSKKMGFEERTPLMIAAMFGSTKVLRYIIESGKVDVNRSCGSDRVTALHCAT 120 FWYGRRIGSK+MGFEERTPLMIAAMFGSTKVL+YIIESG VDVNRSCGSDRVTALHCA Sbjct: 54 GFWYGRRIGSKQMGFEERTPLMIAAMFGSTKVLKYIIESGMVDVNRSCGSDRVTALHCAA 113 Query: 121 AGGXXXXXXXXXXXXDASADANCVNANGNKPVDLIAPAWKSSCNLRRKAMEMLLKGDMSL 180 AGG DASADANCVNA GN PVDLIAPA KS C+ RRKAMEML +GD S+ Sbjct: 114 AGGSTASLEVVKLLLDASADANCVNAYGNSPVDLIAPALKSPCSSRRKAMEMLFRGDKSV 173 Query: 181 LGSDI------DDQEVPSLQLLKEGSEKKEYPIDIALPDINNGIYGSDEFRMYTFKVKPC 234 + SD D ++V S Q+ KEGS+KKEYPIDI+LPDINNGIYG+DEFRM+TFKVKPC Sbjct: 174 MESDQIAIEEGDQRKVSSPQMPKEGSDKKEYPIDISLPDINNGIYGTDEFRMFTFKVKPC 233 Query: 235 SRAYSHDWTECPFVHPGENARRRDPRKYPYSCVPCPEFRKGSCQKGDVCEYAHGVFESWL 294 SRAYSHDWTECPFVHPGENARRRDP+KYPYSCVPCPEFRKGSCQKGD CEYAHGVFESWL Sbjct: 234 SRAYSHDWTECPFVHPGENARRRDPKKYPYSCVPCPEFRKGSCQKGDACEYAHGVFESWL 293 Query: 295 HPAQYRTRLCKDETGCTRKVCFFAHKPEELRPVYASTGSAMPSPRSMSACAGDMTTMSPL 354 HPAQYRTRLCKDETGCTRKVCFFAH+PEELRPVYASTGSAMPSPRSMS A DM T+SPL Sbjct: 294 HPAQYRTRLCKDETGCTRKVCFFAHRPEELRPVYASTGSAMPSPRSMSVSAADMATLSPL 353 Query: 355 ALGXXXXXX-XXXXXXXXXXXXXXXXKNGGLWQNKVNLTPPALQLPGSRLKSASSARDLD 413 ALG KNGGLWQNKV+LTPP LQLPGSRLKSA SARDL+ Sbjct: 354 ALGSSAMSMPITSTPPMSPLAAASSPKNGGLWQNKVSLTPPTLQLPGSRLKSACSARDLE 413 Query: 414 LEMEFLGRD----HANXXXXXXHMWDEMSRLSSPSCYNNSRMGELKPTNLDDVFGSFDPX 469 LEME LG D + +WDE+SRLSS Y SR+GELKPTNL+D FGSFDP Sbjct: 414 LEMELLGLDSHSSQQHQQHQQQQLWDEISRLSSSPPY--SRLGELKPTNLEDAFGSFDP- 470 Query: 470 XXXXXXXXXXXXXXXXXXXXXXXXNMNQLRXXXXXXXXXXPVRKPSSFGLDSPAALAAAV 529 NMNQLR PVRKPSSFGLDSP+ALAAAV Sbjct: 471 ----SLLSQLQAHSQKPSTPTHRQNMNQLRSSYPTNLSSSPVRKPSSFGLDSPSALAAAV 526 Query: 530 INSRSAAFA-KRSHSFIDRGAVNHLQGFXXXXXXXXXXXXXDWNSPSGKL 578 +NSRSAAFA +RS SFIDRGA+NHL G DW+SP GKL Sbjct: 527 MNSRSAAFAQQRSQSFIDRGAMNHLSGLNAPVNSSTMRQSSDWSSPGGKL 576 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3834 (273 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25482 314 8e-88 >Contig25482 Length = 263 Score = 314 bits (805), Expect = 8e-88, Method: Compositional matrix adjust. Identities = 153/212 (72%), Positives = 174/212 (82%) Query: 62 AASKSSNSRPLTGVLFEPFEEVKKELDLVPTLPQVSLARQKYSEDSEAAVNEQINVEYNV 121 AAS SS + LTGV+F+PFEEVK + +VP PQVSLARQ+Y+++SEAA+NEQINVEYNV Sbjct: 51 AASVSSEAVALTGVVFQPFEEVKNDAFVVPVSPQVSLARQRYTDESEAAINEQINVEYNV 110 Query: 122 SYVYHAMYAYFDRDNVALRGLAKFFKESSEEERGHAEKLMEYQNKRGGRVKLQSILMPVS 181 SYVYHA++AYFDRDNVAL+GLA FFKESSEEER HAEKLMEYQNKRGGRVKL S++ + Sbjct: 111 SYVYHALFAYFDRDNVALKGLANFFKESSEEEREHAEKLMEYQNKRGGRVKLHSVIAAPT 170 Query: 182 EFDHAEKGDALYAMELAXXXXXXXXXXXXXXQHVADKNKDVQLTDFVESEFLAEQVEAIK 241 EFDHAEKGDALYAMELA VAD+N D QL DF+ESEFLAEQVEAIK Sbjct: 171 EFDHAEKGDALYAMELALSLEKLTNEKLLNLHKVADQNNDPQLMDFIESEFLAEQVEAIK 230 Query: 242 KISEYVAQLRRVGKGHGVWHFDQMLLHDEVAA 273 KI++YV QLRRVGKGHGVWHFDQ LLH+ AA Sbjct: 231 KIADYVTQLRRVGKGHGVWHFDQYLLHEGDAA 262 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359594 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3402 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1483 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4660 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30141 168 4e-44 >Contig30141 Length = 147 Score = 168 bits (426), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 91/151 (60%), Positives = 96/151 (63%), Gaps = 4/151 (2%) Query: 1 MDIISRXXXXXXXXLNPNAPMFVPSAYRAVEDFSTEWWALVQSSPWFRDYWLQENFHDPQ 60 MDIISR LNPNAPMFVP AYR VEDFS EWWALVQSSPWF+DYWLQE F DPQ Sbjct: 1 MDIISRSTTMSSN-LNPNAPMFVPLAYRTVEDFSAEWWALVQSSPWFQDYWLQERFQDPQ 59 Query: 61 NDPFFSDVNXXXXXXXXXXXXXXXXEQHYPTADNXXXXXXXXXXXXXXXLVSLGLLKWPK 120 NDP FSD++ H+ LVSLGLLKW K Sbjct: 60 NDPSFSDIHDPALLSDVDALFDDVENIHH---SRNTQAAEEEEKDLNKELVSLGLLKWRK 116 Query: 121 GRPVANAPRFIEKAPKFVNVKVSPRAIQQPR 151 GRPVA APR+IEKA KFVNVKVSPRAIQQPR Sbjct: 117 GRPVAEAPRYIEKAAKFVNVKVSPRAIQQPR 147 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542277 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2880 (405 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5502 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89545838 (256 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3502 (337 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158354890 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158350521 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9543 78 2e-16 >Contig9543 Length = 535 Score = 77.8 bits (190), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 52/182 (28%), Positives = 88/182 (48%), Gaps = 13/182 (7%) Query: 28 DIGATSCATISVESATLSGVSWYDLSSVEIGLITSGSLYGALIGSVLAFNIADIIGRRWE 87 DIG S A I ++ +S VE+ ++ +LIGS A +D +GRR+ Sbjct: 51 DIGVMSGAAIYIKDD-------LKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYT 103 Query: 88 LISSAIVYLIGAIVTALAPDLPXXXXXXXXXXXXXXLAMHAAPMYIAETAPSQIRGRLIS 147 ++ + ++ +GA++ A + A+ AP+Y AE +P+ RG L S Sbjct: 104 IVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTS 163 Query: 148 LKEFFI----VLGMVAGYGIGSLLVSIVGGWRYMYGASVPLAVIMGIGMWWLPESPRWIL 203 E FI +LG V+ Y L + GWR M G ++ + +G+ +PESPRW++ Sbjct: 164 FPEVFINSGILLGYVSNYAFSKLPTHL--GWRLMLGVGAIPSIFLAVGVLAMPESPRWLV 221 Query: 204 LR 205 ++ Sbjct: 222 MQ 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158376540 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1576 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 50701423 75 5e-16 >50701423 Length = 54 Score = 75.5 bits (184), Expect = 5e-16, Method: Composition-based stats. Identities = 36/53 (67%), Positives = 40/53 (75%) Query: 112 EGQKKVAEEATQVLKAGEGESDPLMSVENGSGLKLAVTQMSPPSWKSNKDLHA 164 EGQKKVAEEATQ +AGEGESDPL++ E GSG+ T P WKSNKDLHA Sbjct: 2 EGQKKVAEEATQPSQAGEGESDPLVAAETGSGVGTDSTPQIGPVWKSNKDLHA 54 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158380176 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11014 75 9e-16 >Contig11014 Length = 227 Score = 75.1 bits (183), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 6/190 (3%) Query: 29 DIIATGGVDTNAVIFDQPSGQILSTLGGHSKKVTSVKFVGRDNLVITGSADKTVRIWQGS 88 D I + D+ ++ L GH+ V V+F + + S D+T RIW Sbjct: 33 DFILSSSADSTVRLWSTKLNANLVCYKGHNYPVWDVQFSPVGHYFASASHDRTARIWSMD 92 Query: 89 DDGDYHCNHTLKDHTAEVQAVTVHATNNYFVTASLDSTWCFYDITSGLCLTQVEDTSASQ 148 + H ++V V HA NY T S D T +D+ +G C+ Sbjct: 93 R---IQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQTGECVRIF--IGHRS 147 Query: 149 GYTSVAFHPDGLILGAGTSEAVVKIWDVKSQTRVAKFDGHVGAVTSISFSENGYFLATAA 208 S+A PDG + +G + + +WD+ + V GH V ++ FS G LA+ + Sbjct: 148 MVLSLAMSPDGRYMASGDEDGAIMMWDLSTGRCVTPLMGHTSCVWTLDFSGEGSLLASGS 207 Query: 209 SDG-VKLWDL 217 +D VKLWD+ Sbjct: 208 ADCTVKLWDV 217 Score = 66.6 bits (161), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 43/158 (27%), Positives = 74/158 (46%), Gaps = 13/158 (8%) Query: 31 IATGGVDTNAVIFDQPSGQILSTLGGHSKKVTSVKFVGRDNLVITGSADKTVRIWQGSDD 90 A+ D A I+ Q L + GH V V++ N + TGS+DKTVR+W D Sbjct: 77 FASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLW---DV 133 Query: 91 GDYHCNHTLKDHTAEVQAVTVHATNNYFVTASLDSTWCFYDITSGLCLTQVEDTSASQGY 150 C H + V ++ + Y + D +D+++G C+T + G+ Sbjct: 134 QTGECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGAIMMWDLSTGRCVTPL------MGH 187 Query: 151 TSVA----FHPDGLILGAGTSEAVVKIWDVKSQTRVAK 184 TS F +G +L +G+++ VK+WDV + T++ + Sbjct: 188 TSCVWTLDFSGEGSLLASGSADCTVKLWDVTASTKLPR 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363512 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1700 (296 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3037 (313 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13954 227 2e-61 >Contig13954 Length = 239 Score = 227 bits (579), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 98/125 (78%), Positives = 114/125 (91%) Query: 3 RSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLR 62 R PCCEK TNKGAW+K+EDQ+LIDYI+ HGEGCWRSLPK AGL RCGKSCRLRWINYLR Sbjct: 2 RKPCCEKEGTNKGAWSKQEDQKLIDYIKTHGEGCWRSLPKAAGLHRCGKSCRLRWINYLR 61 Query: 63 PDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRGLD 122 PD+KRGNF ++E+ELIIKLH+LLGN+WSLIAGRLPGRTDNE+KNYWN+HI++KL+ G+D Sbjct: 62 PDIKRGNFEQDEEELIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGID 121 Query: 123 PQTHR 127 P HR Sbjct: 122 PNNHR 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158365572 (238 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1418 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig303 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89555729 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5479 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2976 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13719 148 3e-38 >Contig13719 Length = 132 Score = 148 bits (374), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 79/123 (64%), Positives = 87/123 (70%), Gaps = 4/123 (3%) Query: 1 MASFTASTPTSSVTRAALVHKPSVGAPSSTILALPSIGNKGKLRCSMEAKPPMKESNSNI 60 MA+ TAS+ SSVTRA+LVHKPSVGAPSST+LALPS+ KG++ CSME K KESNSN+ Sbjct: 1 MATITASSAASSVTRASLVHKPSVGAPSSTVLALPSLARKGRVSCSMEGK---KESNSNM 57 Query: 61 GXXXXXXXXXXXXXXXXXXXXXXVDDRLSTEGTGLPFGLSNNLLGWILLGVFALIWTFYF 120 VDDRLSTEGTGLPFGLSNNLLGWIL GVF LIWTFYF Sbjct: 58 -AKGASLAAAAMAATMSSPAMALVDDRLSTEGTGLPFGLSNNLLGWILFGVFGLIWTFYF 116 Query: 121 TYT 123 YT Sbjct: 117 IYT 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1991 (284 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8275 366 e-103 >Contig8275 Length = 380 Score = 366 bits (939), Expect = e-103, Method: Compositional matrix adjust. Identities = 175/283 (61%), Positives = 216/283 (76%) Query: 2 ATQGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVRILYTALCHTDAYTWGGKDPEG 61 +T G VI C AAVAWE KPLV+E V+VAPPQA EVRV+I YT+LCHTD Y W K Sbjct: 3 STAGLVIPCTAAVAWEAGKPLVMERVEVAPPQAMEVRVKIKYTSLCHTDLYFWEAKGQTP 62 Query: 62 LFPCILGHEAAGIVESVGEGVTTVQPGDHVIPCYQAECGECKFCKSGKTNLCGKVRAATG 121 LFP I GHEA+GIVESVGEGV ++ GDHV+P + ECG+C CKS ++N+C +R T Sbjct: 63 LFPRIFGHEASGIVESVGEGVEGLEVGDHVLPVFTGECGDCAHCKSEESNMCDLLRINTD 122 Query: 122 VGVMMSDRQSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCGVPT 181 GVM+SD + RFSING PI HF+GTSTFS+YTV+H +AKI+P APL+ VC+L CG+ T Sbjct: 123 RGVMLSDEKPRFSINGTPINHFVGTSTFSEYTVIHSGCLAKINPLAPLDIVCILSCGITT 182 Query: 182 GLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKTAGASRIIGVDIDSKKFDIAKNFGVT 241 GLGA N AK + GS VAIFGLG VGLA AEGA+ +GASRIIGVD + K+F+ AK FGV Sbjct: 183 GLGATLNVAKPKKGSSVAIFGLGAVGLAAAEGARISGASRIIGVDRNPKRFEEAKKFGVN 242 Query: 242 EFVNPKDHEKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALEC 284 EFVNPKDH+KP+Q+V+ ++T+GG D S EC GN++ M +A EC Sbjct: 243 EFVNPKDHDKPVQEVIAEMTNGGADRSIECTGNINAMISAFEC 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2922 (223 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3176 156 2e-40 >Contig3176 Length = 234 Score = 156 bits (395), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 89/216 (41%), Positives = 127/216 (58%), Gaps = 7/216 (3%) Query: 2 SQVTVLGAWSSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAG 61 S V VLG SP+V R AL LK VDYE+++E +KS+ LL+ NPVHKKVPVL+H Sbjct: 4 SDVKVLGMAPSPFVMRARIALNLKSVDYEFLQE-TFGSKSELLLQSNPVHKKVPVLIHGD 62 Query: 62 KPIAESAVILEYIEETWPQNP-LLPKDPHQRALARFWIKFGEDK-FGALFGFFMTEGEQQ 119 KP+ ES +I+EYI+E W P +LP DP+ RA ARFW + +K + ++ G + +GE+ Sbjct: 63 KPVCESLIIVEYIDEVWASGPSILPSDPYDRATARFWAAYISEKWYPSMKGIGLAQGEEA 122 Query: 120 VKATKER-QEQLTILEEQGLGDKK---FFGGDELGMADLEFGWLAWWMDVMSELAGVKGI 175 KA E+ E L +LEE K FFGGDE+G D+ FG W+ V +L G+K + Sbjct: 123 KKAAIEQVTEGLALLEEAFEKSSKGNVFFGGDEIGYLDIAFGCFLGWLRVNEKLHGIKLL 182 Query: 176 EAETFPRLHAWIQRFKDIPTIKEHLPDRSAMLTYFK 211 + P L W +F +K+ +P+ ++ K Sbjct: 183 DQTKTPGLVKWADKFCAHAAVKDVMPETDKLVEIAK 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158374503 (62 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3949 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1166 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48265854 127 5e-32 >48265854 Length = 138 Score = 127 bits (320), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 67/107 (62%), Positives = 83/107 (77%), Gaps = 2/107 (1%) Query: 27 RPVSRSSRAGIQFPVGRIHRQLKQRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASK 86 + VSRSS+AG+QFPVGRI R LK A RVGA A VYL+++LEYL AEVLELAGNA++ Sbjct: 17 KSVSRSSKAGLQFPVGRIARFLKAGKYAE-RVGAGAPVYLSAVLEYLAAEVLELAGNAAR 75 Query: 87 DLKVKRITPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINK 132 D K RI PRH+QLA+R DEEL L+ TIA GGV+P+IH++L+ K Sbjct: 76 DNKKNRIVPRHIQLAVRNDEELSKLLGAVTIANGGVMPNIHQNLLPK 122 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3744 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2035 135 9e-34 >Contig2035 Length = 132 Score = 135 bits (339), Expect = 9e-34, Method: Compositional matrix adjust. Identities = 63/88 (71%), Positives = 72/88 (81%), Gaps = 2/88 (2%) Query: 179 EIMRT-VADNLIVVLPSGKSVADLLPQIDAIEKCPGF-GVIVTGVAPPESGFDFISRYFC 236 EI RT V D+L+VVLPS K+V DL PQ DAI +CPG GVI+TG+APPESG+DF SRYFC Sbjct: 3 EIRRTTVTDDLLVVLPSAKAVTDLQPQFDAIRQCPGSSGVIITGIAPPESGYDFYSRYFC 62 Query: 237 PKFGINEDPVCGSAHCGLAPYWCKKTGE 264 PK GI+EDPV GSAHC LA YWCKK G+ Sbjct: 63 PKHGIDEDPVTGSAHCALASYWCKKLGK 90 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5214 (355 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9938 60 5e-11 >Contig9938 Length = 492 Score = 60.1 bits (144), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 2/104 (1%) Query: 119 INVKPGQRILDVGCGVGGPMRAIAAHSRANVVGITINEYQVKRARLHNKKAGLDSLCEVV 178 +++KPGQ++LDVGCG+GG +A++ V+GI ++ + A + GL E Sbjct: 279 LDLKPGQKVLDVGCGIGGGDFYMASNFDVEVIGIDLSVNMISFAL--EQSIGLKCAVEFE 336 Query: 179 CGNFLEMPFPENSFDGAYSIEATCHAPKLEEVYAEIFRVLKPGA 222 + + +P+N+FD YS + H ++ + LKPG Sbjct: 337 VADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYEWLKPGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 285809009 (181 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89541813 (196 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158373278 (103 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24372 75 2e-16 >Contig24372 Length = 148 Score = 75.1 bits (183), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 35/96 (36%), Positives = 55/96 (57%), Gaps = 2/96 (2%) Query: 4 LTLQFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQDL 63 +++ F DYP KPPK F FHPN+ +G++CL IL E W PA+T+ ++L+ I L Sbjct: 52 VSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ--WSPALTISKVLLSICSL 109 Query: 64 LDQPNAADPAQTEGYQLFIQEPAEYKRRVKQQAKQY 99 L PN DP E ++ + A+Y+ + ++Y Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDRAKYEATARSWTQKY 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig98 (472 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2902 457 e-130 >Contig2902 Length = 228 Score = 457 bits (1175), Expect = e-130, Method: Compositional matrix adjust. Identities = 218/228 (95%), Positives = 220/228 (96%) Query: 245 MTVFWSSTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKA 304 MTVFWSS AQSMTARPMKGMLTGPVTILNWSFVRNDQPR ETTYQIALAIKDEVEDLEKA Sbjct: 1 MTVFWSSAAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETTYQIALAIKDEVEDLEKA 60 Query: 305 GINVIQIDEAALREGLPLRKSEQAHYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDII 364 GI+VIQIDEAALREGLPLRKSE A YLDWAVHSFRITN GVQDTTQIHTHMCYSNFNDII Sbjct: 61 GISVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNSGVQDTTQIHTHMCYSNFNDII 120 Query: 365 HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK 424 HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINK Sbjct: 121 HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINK 180 Query: 425 MLAVLETNILWVNPDCGLKTRKYAEVKPALSAMVAAAKQLRTQLASAK 472 MLAVLETNILWVNPDCGLKTRKY EVKPALS MVAAAK LRTQLASAK Sbjct: 181 MLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89544682 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10241 209 3e-56 >Contig10241 Length = 311 Score = 209 bits (533), Expect = 3e-56, Method: Compositional matrix adjust. Identities = 97/148 (65%), Positives = 116/148 (78%) Query: 78 FGEMKDRFLSFKKQKFLRESEHFQNLAQVQDPKFMVIACADSRVCPSNILGFQPGEAFMI 137 F +MK RFL FK K++ EH+QNLA+ Q PKFMVI+CADSRVCPS ILGFQPGEAF++ Sbjct: 93 FEDMKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCPSTILGFQPGEAFIV 152 Query: 138 RNVANLVPPFENGASETNAALEFAVNTLEVENIFVIGHSSCAGIETLMTMQDDGDSSSFT 197 RN+ANLVP E+G SETNAALEF+VN+L+VENI V+GHS C GI LM+M D+ + SSF Sbjct: 153 RNIANLVPSLESGPSETNAALEFSVNSLKVENILVVGHSCCGGIRALMSMDDEIEKSSFI 212 Query: 198 HRWVVNAKVAKLRTKAAAPHLSFDQQCR 225 WVV K A+ TKAAA LSFDQQC+ Sbjct: 213 QNWVVVGKDARSWTKAAASTLSFDQQCK 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5612 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158364404 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 238016222 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89555242 (222 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30575 67 2e-13 >Contig30575 Length = 332 Score = 67.4 bits (163), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Query: 170 LVTHDNLQTAKAIAMECGILASDGSDASEINFIEGEVFRQLSDSQREQLAEKI 222 +VT DNLQTAKAIA+ECGIL S DA+E IEG+ FR+LS+ +REQ A+KI Sbjct: 1 MVTGDNLQTAKAIALECGILLSL-EDATEPTIIEGKTFRELSEKEREQTAKKI 52 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89540494 (290 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3762 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7532 376 e-106 >Contig7532 Length = 295 Score = 376 bits (966), Expect = e-106, Method: Compositional matrix adjust. Identities = 182/261 (69%), Positives = 205/261 (78%), Gaps = 2/261 (0%) Query: 1 MAKIYALALVMFFKILVAASAGNFNQDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKS 60 M ++ L+L +++ ASAGNF QDFDIT+GDGRAKILN QLLTL LDK SGSGFKS Sbjct: 8 MNMVFLLSLFTTSLMVMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKS 67 Query: 61 RNQYLFGKIDMQIKLVPGNSAGTVTSYYLSSLGSAHDEIDFEFLGNLSGDPYTLHTNVFT 120 +N+YLFG+IDMQIKLV GNSAGTVT+YYLSS G HDEIDFEFLGN +G+PYTLHTNVF+ Sbjct: 68 KNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSEGPTHDEIDFEFLGNSTGEPYTLHTNVFS 127 Query: 121 QGKGNREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAM 180 QGKGNREQQF+LWFDPTK FHTYSI+WN Q IIF VD PIR F NLES G+PFPKNQ M Sbjct: 128 QGKGNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPM 187 Query: 181 WIYSSLWNADDWATRGGLVKTDWSKAPFTASYRNFNAQACIWXXXXXXXXXXXXXXXKE- 239 IYSSLWNADDWATRGGLVKTDW++APFTASYRNF A AC E Sbjct: 188 RIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSLTEQ 247 Query: 240 -AWFTQSLDATGKGRMKWVQR 259 AW TQ LDA G+ R++WVQ+ Sbjct: 248 SAWKTQGLDAAGRNRLRWVQQ 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2204 (342 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24736 587 e-170 >Contig24736 Length = 340 Score = 587 bits (1514), Expect = e-170, Method: Compositional matrix adjust. Identities = 282/338 (83%), Positives = 307/338 (90%), Gaps = 6/338 (1%) Query: 7 IKLGSQGLEVSAQGLGCMGMSAFYGPPKPEPDMIKLIHHAVDSGVTFLDTSDIYGPHTNE 66 +KLGSQGLEVSAQGLGCMGMSAFYG PKP+ DMI LIHHA++SGVTFLDTSDIYGP TNE Sbjct: 1 MKLGSQGLEVSAQGLGCMGMSAFYGAPKPDQDMISLIHHAINSGVTFLDTSDIYGPFTNE 60 Query: 67 ILLGKALSGGVRDKVELATKFGISFADNKREV------RGDPAYVRAACEASLKRLGLNC 120 ILLGKAL GGVRDKVELATKFG+ F +NK EV +GDPAYVRAA E+SLKRLG++ Sbjct: 61 ILLGKALKGGVRDKVELATKFGLRFVENKMEVGKNMEVQGDPAYVRAALESSLKRLGVDS 120 Query: 121 IDLYYQHRIDTRLPIEVTVGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEW 180 IDLYYQHRIDT +P+EVTVGELKKLVEEGK+KYIGLSEASASTIRRAHAVHPITAVQLEW Sbjct: 121 IDLYYQHRIDTSVPVEVTVGELKKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEW 180 Query: 181 SLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFLSSGAKFVENLANDDFRKFLPRFQGENL 240 SLWSRDVE++IIPTCRELGIGIVAYSPLGRGF +SGAKFVENLA+ D RK LPRFQ EN+ Sbjct: 181 SLWSRDVEQEIIPTCRELGIGIVAYSPLGRGFFASGAKFVENLAHGDSRKNLPRFQPENV 240 Query: 241 EHNKSIFERVSDLATRKGCTSSQLALAWVHHQGNDVCPIPGTTKIENFNQNIGALSVKLT 300 EHNK++FERVSDLA RKGCT SQLALAWVHHQGNDVCPIPGTTKI NF+QNI ALSVKLT Sbjct: 241 EHNKTLFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIPGTTKIANFDQNIAALSVKLT 300 Query: 301 PEEKAELESFATADAVKGDRYQNDFSTWKNSETPPLSS 338 PEE AELES+A+ DAVKG+RY N +STW NSETPPLSS Sbjct: 301 PEELAELESYASVDAVKGERYPNYYSTWSNSETPPLSS 338 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542245 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4775 (399 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48275353 168 1e-43 >48275353 Length = 116 Score = 168 bits (426), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 80/99 (80%), Positives = 84/99 (84%) Query: 27 EDEGPRTPQSXXXXXXXXXXXXNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEY 86 E+E PR+PQS NSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEY Sbjct: 18 EEEPPRSPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEY 77 Query: 87 IQCDVSDADDAKGKLSPLTDVTHIFYVTWTNRSTEAENC 125 IQCD+SD DDAK KLSPLTDVTHIFYVTWTNRST+AENC Sbjct: 78 IQCDISDPDDAKTKLSPLTDVTHIFYVTWTNRSTDAENC 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig839 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24436 268 2e-74 >Contig24436 Length = 152 Score = 268 bits (686), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 130/152 (85%), Positives = 135/152 (88%) Query: 1 MSLVANEEFQHILRVMNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60 MSLVANEEFQHILRV+NTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVDMNKRAGELS Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 Query: 61 AQEIENLMHIVANPRQFKIPDWFLNRKKDYKDGKYSQVVANALDMKLRDDLERLKKIRNH 120 A E++ LM IVANPRQFKIPDWFLNRKKDYKDG+YSQVV+NALDMKLRDDLERLKKIRNH Sbjct: 61 AAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 Query: 121 RGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 152 RGLRHYWGLRVRGQH SKKR Sbjct: 121 RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig914 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1161 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20450 306 7e-86 >Contig20450 Length = 148 Score = 306 bits (785), Expect = 7e-86, Method: Compositional matrix adjust. Identities = 147/148 (99%), Positives = 148/148 (100%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRSKYETTARSWTQKYAMG 148 PEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRNKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 260659647 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361150 (55 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5929 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27013 237 8e-65 >Contig27013 Length = 213 Score = 237 bits (605), Expect = 8e-65, Method: Compositional matrix adjust. Identities = 113/166 (68%), Positives = 134/166 (80%), Gaps = 3/166 (1%) Query: 15 VAQWKRDFSRAFQYYLDRSTPHTLHRWLGTLAVAMIYILRVYYVQGFYVVSYGLGIYVLN 74 V+ W SR +Q+ LDR+TPH L+RWL LA A+IY+LRVY VQGFYVVSYGLGIY+LN Sbjct: 27 VSDWSYGVSRRYQHVLDRTTPHVLYRWLACLAAALIYVLRVYLVQGFYVVSYGLGIYILN 86 Query: 75 LLIGFFSPKVDPELEVL---DGASLPTKGADEFRPFVRRLPEFKFWYSITKAFLIAFVMT 131 LLIGF SP+VDPE+ L DG SLPT+G+DEFRPFVRRLPEFKFWYSITKAF IAF MT Sbjct: 87 LLIGFLSPQVDPEIHDLSSSDGPSLPTRGSDEFRPFVRRLPEFKFWYSITKAFCIAFAMT 146 Query: 132 FISVLDVPVFWPILLCYWIVLFVLTMKRQNLHLIQFQFFPLQMETE 177 F S DVPVFWPILL YW+VLFVLTM+RQ +H+I++++ P + Sbjct: 147 FFSAFDVPVFWPILLFYWVVLFVLTMRRQIVHMIKYKYVPFSFGKQ 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig980 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4725 (393 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6285 751 0.0 >Contig6285 Length = 393 Score = 751 bits (1938), Expect = 0.0, Method: Compositional matrix adjust. Identities = 361/393 (91%), Positives = 373/393 (94%) Query: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTK 60 METFLFTSESVNEGHPDKLCDQISDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTK Sbjct: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLTQDPDSKVACETCTKTNMVMVFGEITTK 60 Query: 61 ANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGA 120 ANVDYEKIVRDTCR IGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHF+KRPEEIGA Sbjct: 61 ANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFSKRPEEIGA 120 Query: 121 GDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTVEYHNEG 180 GDQGHMFGYATDETPELMPL+HVLATKLGAKLTEVRKNGTCAWLRPDGKTQVT+EY N+ Sbjct: 121 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTIEYFNDK 180 Query: 181 GAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVVPEKYLDEKTIFHLNPSGRFVI 240 GAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPV+PEKYLDEKTIFHLNPSGRFVI Sbjct: 181 GAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 Query: 241 GGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 GGPHGDAGLTGRKIIIDTY KDPTKVDRSGAYIVRQAAKSIVANGLAR Sbjct: 241 GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 Query: 301 RALVQVSYAIGVPEPLSVFVETYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNK 360 R +VQVSYAIGVPEPLSVFV++YGTGKIPDKEILKIVKE FDFRPGMI+INLDLKRGGN Sbjct: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKETFDFRPGMISINLDLKRGGNG 360 Query: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQS 393 RFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQ+ Sbjct: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89540286 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4624 (321 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57896472 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357709 (36 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158353405 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3667 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20884 519 e-149 >Contig20884 Length = 490 Score = 519 bits (1336), Expect = e-149, Method: Compositional matrix adjust. Identities = 240/289 (83%), Positives = 266/289 (92%) Query: 1 MVISSTSGDRSDHFLDCTFASRYVRNPVPKFRMPESSQPKEAAYQIINDELMLDGTPRLN 60 MVIS+TS +R ++CTFASRYVRN +PKF+MPE+S PK++AYQIINDELMLDG PRLN Sbjct: 1 MVISTTSAERRGEQVNCTFASRYVRNVLPKFQMPETSMPKDSAYQIINDELMLDGNPRLN 60 Query: 61 LASFVTTWMEPECEKIMMASMNKNYVDMDEYPVTTELQNRCVNMISHLFNAPIGEAETAI 120 LASFVTTWMEPEC+++MMASMNKNYVDMDEYPVTTELQNRCVN+I++LFNAPIG+ ETA+ Sbjct: 61 LASFVTTWMEPECDRLMMASMNKNYVDMDEYPVTTELQNRCVNIIANLFNAPIGDGETAV 120 Query: 121 GVGTVGSSEAIMLAGLAFKRKWQHRRKLEGKPFDKPNIVTGANVQVCWEKFARYFEVELK 180 GV TVGSSEA+MLAGLAFKRKWQ++RKLEGKPFDKPN+VTGANVQVCWEKFARYFEVELK Sbjct: 121 GVSTVGSSEAMMLAGLAFKRKWQNKRKLEGKPFDKPNMVTGANVQVCWEKFARYFEVELK 180 Query: 181 EVKLSDGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVXXXXXXXXXXXXETGWET 240 EVKLS+GYYVMDP KAVEMVDENTICVAAILGSTLTGEFEDV +TGW+T Sbjct: 181 EVKLSEGYYVMDPAKAVEMVDENTICVAAILGSTLTGEFEDVKLLHDLLVEKNKQTGWDT 240 Query: 241 PIHVDAASGGFIAPFLYPDIEWDFRLPLVKSINVSGHKYGLVYAGVGWV 289 PIHVDAASGGFIAPFLYP++EWDFRLPLVKSINVSGHKYGLVYAGVGWV Sbjct: 241 PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWV 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4729 (303 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9979 102 7e-24 >Contig9979 Length = 342 Score = 102 bits (255), Expect = 7e-24, Method: Compositional matrix adjust. Identities = 86/288 (29%), Positives = 131/288 (45%), Gaps = 42/288 (14%) Query: 18 MTICMIGAGGFIGSHLCEKLMAETPHKVLALDVYNDKIKHLLEPSDGHPWSDRIQFHRLN 77 M I + G GFIGSHL +KLM ++V+ D Y K L+ GHP R + Sbjct: 30 MRILVTGGAGFIGSHLVDKLMENEKNEVIVADNYFTGSKDNLKKWIGHP---RFEL---- 82 Query: 78 IKHDSRLEGLIKTSDLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIH 137 I+HD E L+ D +LA +P Y P+ TI +N I L ++ R++ Sbjct: 83 IRHDV-TEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILL 141 Query: 138 FSTCEVYGKTIGSFLPKDSPLRQDPEYYLLKENDSPCIFGSIE--KQRWSYACAKQLIER 195 ST EVYG DP + EN +G++ R Y K++ E Sbjct: 142 TSTSEVYG---------------DPLIHPQTEN----YWGNVNPIGVRSCYDEGKRVAET 182 Query: 196 LIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRREPLKLVD 255 L++ ++G+E I R FN GPRM+ G RV++ F +R +PL + Sbjct: 183 LMFDYHRQHGIEIRIARIFNTYGPRMNIDDG---------RVVSNFIAQAIRNDPLTVQA 233 Query: 256 GGESQRTFVYIKDAIDAVMLMIENPARANGHIFNVGNPNNEVTVRQLG 303 G R+F Y+ D +D ++ +++ N N+GNP E T+ +L Sbjct: 234 PGTQTRSFCYVSDMVDGLIRLMQG---DNTGPINIGNP-GEFTMLELA 277 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2740 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548249 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2230 (375 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89550843 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25573 138 4e-35 >Contig25573 Length = 308 Score = 138 bits (347), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 62/77 (80%), Positives = 69/77 (89%) Query: 26 EAVWVWTVSLPVTVVNSSNKTPSLQAADFIGWIMWSVGFLVEATADQQKLVFKNSPENRG 85 +A+WVWTVSLPVTV N+SN+ P +QAAD IGWIMW VGF VEA ADQQKL FK+SP+NRG Sbjct: 111 QAMWVWTVSLPVTVANASNRMPLIQAADIIGWIMWFVGFSVEAAADQQKLTFKSSPQNRG 170 Query: 86 KWCNVGLWKYTRHPNYF 102 KWCNVGLWKYTRHPNYF Sbjct: 171 KWCNVGLWKYTRHPNYF 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2437 (408 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16098 309 5e-86 >Contig16098 Length = 339 Score = 309 bits (792), Expect = 5e-86, Method: Compositional matrix adjust. Identities = 163/320 (50%), Positives = 211/320 (65%), Gaps = 6/320 (1%) Query: 91 GDRVKHWVTMNEPNGFAISGYGGGTFAPGRCSNYEG-NCTSGNSATESYTVXXXXXXXXX 149 GDRVK W T+NEP+ + +G+ G+ APGRCS ++ NC G+SA E Y Sbjct: 1 GDRVKQWTTLNEPHSVSNNGFAVGSQAPGRCSYWQNRNCLGGDSAIEPYLATHHLLLAHA 60 Query: 150 XXVKIYKDKYQASQKGQIGITVVTHWWKPKYPAQLASRTATLRSLDFMFGWFANPIVHGD 209 VK+YKDKYQA QKG IGIT+ T+W+ P + + A LRSLDFMFGWF P+ GD Sbjct: 61 AAVKVYKDKYQAFQKGLIGITLNTYWFVPASETK-EDKHAALRSLDFMFGWFMEPLTSGD 119 Query: 210 YPEVMRSMVGNRLPKFTEAESKQIKGSLDFLGLNYYTSYYTE-DGPASSN--HSWTSDRQ 266 YP+ MRS+VGNRLP FT ES + GS DFLGLNYYT+ Y+ D P +S+ S+ +D Sbjct: 120 YPQSMRSLVGNRLPVFTNEESMLLTGSFDFLGLNYYTARYSSNDVPDNSSLPASYVTDSH 179 Query: 267 VTASTTDKAGVLIGAATDLDWLYVYPKGIRDVLLYIKEKYNNPNIFITENGYAYGYNAST 326 V T + GV IG T DWLYVYPKG+ D+LLYIK+KYN+P I+ITE+G + + Sbjct: 180 VKV-TIELNGVPIGPPTASDWLYVYPKGVYDLLLYIKKKYNDPLIYITESGVSEFNDPKL 238 Query: 327 PIEEARKDNLRIRYHHDHLWYLLKAIKDGVQVKGYYAWSFFDDFEWDAGYTVGFGLTLVD 386 ++EA D R+ Y++ HL Y+ AIK+G +VKGY AWS D+FEW+ GY V FG+ VD Sbjct: 239 SLQEALNDTNRVDYYYRHLCYVRAAIKNGSKVKGYIAWSLLDNFEWEIGYAVRFGINYVD 298 Query: 387 VKDNLKRYLKYSAYWYKMFL 406 + LKRY K SA+W+K FL Sbjct: 299 YNNGLKRYPKLSAHWFKSFL 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1652 (238 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89557926 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3262 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26571 187 7e-50 >Contig26571 Length = 132 Score = 187 bits (474), Expect = 7e-50, Method: Compositional matrix adjust. Identities = 90/114 (78%), Positives = 103/114 (90%), Gaps = 2/114 (1%) Query: 1 MESQNLSPPHVDASRPSLGFPLGTALLLIIIFSLSGVFSCCYHWDKLRSLRRSFAEDSNP 60 MESQN SPPHVDASRPSLGFPLGTALLLIIIFSLSG+FSCCYHWDKLRSLRRSF ++++P Sbjct: 1 MESQNFSPPHVDASRPSLGFPLGTALLLIIIFSLSGIFSCCYHWDKLRSLRRSFNQNADP 60 Query: 61 EASDDIEGQPPSKSKPAHLDMKQTQKQSVPVIMPGDQIPKFMALPCPCEPPREE 114 EA D++ PSKSKPAH+D+KQ Q++S+PVIM GDQIPKFMALPCP EPP +E Sbjct: 61 EA--DVQPPSPSKSKPAHMDLKQKQRESLPVIMAGDQIPKFMALPCPREPPTDE 112 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158378709 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31834 74 6e-16 >Contig31834 Length = 181 Score = 74.3 bits (181), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Query: 7 WQLWKEGRGMEVIDASVRETCRIHEALRCIHVGLLCVQEAPADRPTMSLVIHMLEAEEAT 66 W+LWK+ +E+ D ++ ++C ++ LRCIH+ LLCV+E ADRPTMS VI ML E+ Sbjct: 81 WELWKKNAALELKDPTLGDSCNGNQLLRCIHISLLCVEENAADRPTMSDVISML-TNESM 139 Query: 67 SLPPSKEPC 75 LP K+P Sbjct: 140 ELPKPKKPA 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359332 (92 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4811 (440 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357974 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7125 124 3e-31 >Contig7125 Length = 102 Score = 124 bits (311), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 71/104 (68%), Positives = 81/104 (77%), Gaps = 9/104 (8%) Query: 1 MARSFSNAKLLSALV----SNTIARRGYAAGSPGLAA--VRGEVAAASVTRSVNLEKK-S 53 MARSFSNAK LS LV S++I+RRGYAAGS G+A+ VRG A+ RSVN+ KK S Sbjct: 1 MARSFSNAKFLSVLVVDGFSSSISRRGYAAGSQGVASSVVRG--GGATNPRSVNITKKNS 58 Query: 54 GEDKVGSVFKVSWVPNPKTGVYGPENRADEIDVAELRNALLKKH 97 GE+KVGS FKVSWVP+PKTGVYGPEN +ID AELR ALLKKH Sbjct: 59 GEEKVGSTFKVSWVPDPKTGVYGPENGTAKIDAAELRAALLKKH 102 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig258 (254 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5682 251 1e-68 >Contig5682 Length = 246 Score = 251 bits (640), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 128/215 (59%), Positives = 153/215 (71%), Gaps = 22/215 (10%) Query: 50 KRGFSET-----------VDLKLNFSSENDDV-SRSGRDGQVE---IKKEKDXX------ 88 KRGFSET VDLKLN S+ + + S G+DG E KEK+ Sbjct: 31 KRGFSETESDISTDASTCVDLKLNLSNNSKETNSTGGKDGSAEKSKTNKEKNNNLDFRAS 90 Query: 89 -XXXXXXXXXQVVGWPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTSTSAAFVKVSMDGAP 147 QVVGWPPVRSFRKN+ +KST+ ++ + + ++ +A VKVSMDGAP Sbjct: 91 DPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAP 150 Query: 148 YLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPSYE 207 YLRKVDLK+Y+SY ELS AL KMFSSFTIGNCGSQGMKDFMNE KL+D+LNGS+Y+P+Y+ Sbjct: 151 YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYQ 210 Query: 208 DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL 242 DKDGDWMLVGDVPWEMFV+SCKRLRIMK EA+GL Sbjct: 211 DKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGL 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4253 (304 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158373803 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3439 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6600 159 4e-41 >Contig6600 Length = 197 Score = 159 bits (401), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 108/209 (51%), Positives = 123/209 (58%), Gaps = 21/209 (10%) Query: 1 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRXXXXXXXXXXXXSLIDQKIKELIGQ 60 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVR SLIDQ+IKE +G Sbjct: 1 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVREYYQQFEQEQTQSLIDQRIKEHLGN 60 Query: 61 NAA-----YGQVGAAYNQHLMARPRMPILXXXXXXXXXXXXXXXXXXIRIPVLPRPP-MG 114 +AA YGQ+GAAYNQHLMA+PR+P + IR PVLPRPP + Sbjct: 61 SAAYGGQPYGQIGAAYNQHLMAQPRLPGM------------PQMLPGIRPPVLPRPPILN 108 Query: 115 APGVYXXXXXXXXXX--XXXXXXXXVNMPMRPPTLXXXXXXXXXXXX-XXXNGAPSVAAP 171 APG ++ PMRPP NG P +AAP Sbjct: 109 APGYSSAPHMIPMMAPPGAPGMPGQLSAPMRPPPALNPPPAVPGSTAPNASNGPPPMAAP 168 Query: 172 PMYQPNPTAPSTGGYDSFNLNAQPPESSQ 200 PMYQPNPTAP++GGY+SFN N QPP+SSQ Sbjct: 169 PMYQPNPTAPTSGGYESFNPNTQPPDSSQ 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89549845 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9611 245 4e-67 >Contig9611 Length = 337 Score = 245 bits (625), Expect = 4e-67, Method: Compositional matrix adjust. Identities = 108/174 (62%), Positives = 136/174 (78%) Query: 21 PCSVSVPFIVLHGIGDQCANRGVKQFTEQLRDFSGAEGYCIEVGAGTWDSWFVPLEEQTR 80 P + SVPF+V HGI D+C+NRGV FTE L ++SG++G+CIE+G G+WDSW +PL EQT Sbjct: 22 PLTHSVPFVVFHGISDKCSNRGVALFTELLSNWSGSQGHCIEIGDGSWDSWTMPLSEQTA 81 Query: 81 IVCEKVKEMEELRQGYNIVGLSQGNLIGRGVVEFCNNGPLVKNFVSLGGPHAGIASVPLC 140 I CEKVK M EL GYN+VGLSQGN+IGRGV++FC+ P VKN +SL GPHAG AS+P C Sbjct: 82 IACEKVKNMSELSDGYNMVGLSQGNVIGRGVIQFCDGAPPVKNLISLAGPHAGTASIPFC 141 Query: 141 GSGIFCIIVNKLIKGEIYSDYIQAHLAPSGYIKLPNAMTDYLGRCRFLPKLNNE 194 C++++ LI+ EIYSD+IQ HLAPSGY+K+P + YL CRFLPKLNNE Sbjct: 142 KCEWICVLLDDLIQSEIYSDFIQEHLAPSGYLKIPTDIDGYLKGCRFLPKLNNE 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4278 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20776 420 e-120 >Contig20776 Length = 259 Score = 420 bits (1080), Expect = e-120, Method: Compositional matrix adjust. Identities = 209/259 (80%), Positives = 223/259 (86%), Gaps = 2/259 (0%) Query: 1 MAATTGAMLNGLNST-FLCGGKRSQXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXSWIP 58 MAATTGA+LNGLNS FLCGGKRSQ SWIP Sbjct: 1 MAATTGAVLNGLNSAAFLCGGKRSQALLSAATVGSKVGGASPTPKRFIVVAAAAKKSWIP 60 Query: 59 AVKGGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMTAVVGIFVG 118 AVKGGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAM AVVGIFVG Sbjct: 61 AVKGGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVG 120 Query: 119 QAWSGVPWFQAGADPSAVAPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWS 178 QAWSG+PWF+AGADPSA++PFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWS Sbjct: 121 QAWSGIPWFEAGADPSAISPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWS 180 Query: 179 KTAENFSNFTGEQGYPGGKFFDPLGLAGTIKDGVYIPDTEKLERLQLAEIKHSRLAMLAM 238 KT+ENF+N TGEQGYPGGKFFDPLG AG+I+DGVY+PD+EKLERL+LAEIKH+RLAM+AM Sbjct: 181 KTSENFANSTGEQGYPGGKFFDPLGFAGSIQDGVYVPDSEKLERLKLAEIKHARLAMVAM 240 Query: 239 LIFYFEAGQGKTPLGALGL 257 LIFYFEAGQGKTPLGALGL Sbjct: 241 LIFYFEAGQGKTPLGALGL 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362347 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29234 69 9e-14 >Contig29234 Length = 344 Score = 68.6 bits (166), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 60/221 (27%), Positives = 100/221 (45%), Gaps = 23/221 (10%) Query: 3 VVASQAANGGRTVLITGVSKGLGRALAVELAKRGHTVIGCSRSQDKLTSLQSELSSD--- 59 V+ G R V+I+G ++GLG+ALA E G V+ SRS + + + EL + Sbjct: 2 VLEDHCRAGPRNVVISGSTRGLGKALAREFLLSGDRVVVASRSPESVQATVRELEENLRE 61 Query: 60 ------------NH---LFLAADVSSNSSIQELARIVMEKKGVPDIIVNNAGVINSNNKL 104 H + +A DV +Q+LA + + G DI +NNAG L Sbjct: 62 GINSAGGLSKNLKHAKVVGVACDVCEAGDVQKLANFAVSELGHIDIWINNAGANKGFRPL 121 Query: 105 WEVPADEFDGVIDTNVKGVANVLRHFIPLMLKRDPAPATGIIVNMS-SGWGRSGAAHVAP 163 + ++ ++ TN+ G R + +M+ + G I NM +G G S A Sbjct: 122 LQFTDEDIKQIVSTNLVGSILCTREAMRIMMNQAKG---GHIFNMDGAGSGGSSTPLTAV 178 Query: 164 YCASKWAVEGLTRSVAKELP-KDMAIVALNPGVIHTDMLVS 203 Y ++K + L S+ KE + + +PG++ TD+L+S Sbjct: 179 YGSTKCGLRQLQSSLLKECKGSKVGVHTASPGMVLTDLLLS 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3036 (79 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89557269 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1759 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89543790 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158358365 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1499 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226787194 59 6e-11 >226787194 Length = 144 Score = 58.9 bits (141), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 11/126 (8%) Query: 82 VFGVVRFAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAASTGKVFDPSTEGVNEP 141 V G + F Q + SGL PG HG+ ++ FGD T G STG F+P+ + P Sbjct: 14 VKGTINFVQEGDGPTTVTGCISGLKPGLHGFHVHAFGDTTNGCLSTGPHFNPNGKEHGAP 73 Query: 142 ------LGDLGTLDTDENRNAFFTGVKEKLRV--PE-LIGRSIAVYGTADKSDSGVAAAV 192 GDLG + ++ A FT + +++ + P +IGR++ V+G D D G Sbjct: 74 EDEDRHAGDLGNVTVGDDGTATFTLIDKQIPLTGPHSVIGRAVVVHG--DPDDLGKGGHE 131 Query: 193 IARSAG 198 +++S G Sbjct: 132 LSKSTG 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361786 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10840 124 1e-30 >Contig10840 Length = 440 Score = 124 bits (310), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 52/75 (69%), Positives = 64/75 (85%) Query: 1 MISWSEGGSTFVVWRPAEFARDILPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANDCF 60 M+SW+E GS+FVVW P EFA+++LP YFKHNNFSSFVRQLNTYGFRK+ P++WEFAN+ F Sbjct: 31 MVSWTESGSSFVVWDPTEFAKEMLPMYFKHNNFSSFVRQLNTYGFRKIDPEQWEFANEEF 90 Query: 61 KRGEKGLLREIQRRK 75 RG + LL+ I RRK Sbjct: 91 LRGGRHLLKNIHRRK 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4628 (524 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28992 117 4e-28 >Contig28992 Length = 832 Score = 117 bits (293), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 133/540 (24%), Positives = 218/540 (40%), Gaps = 61/540 (11%) Query: 31 LTHARLHELVEYAASQLLAAGVAPHDSIALTFPNSIEYVVMFLAVIRCRXXXXXXXXXXX 90 LT+ +L V A+ L GV D++ + P +E + LA R Sbjct: 287 LTYTQLLHNVCQLANYLKDVGVKKGDAVVVYLPMLMELPITMLACARIGAVHSVVFAGFS 346 Query: 91 XEEFEFYLSDSESKLLITSE--------------------KPIQSAVSAATKLSIPYVTA 130 E + D + K+ IT K +S VS L+ +A Sbjct: 347 AESLAQRIVDCKPKVEITCNAVKRGSKVIHLKDIVDAALIKSSESGVSVDICLTYENQSA 406 Query: 131 ALSEG-----GGNVCLSSATVGEPSCDSISKFVNDPSDVALFLHTSGTTSRPKGVPLTQ- 184 E G +VC P+ ++ D D L+TSG+T +PKGV T Sbjct: 407 MKRESTKWLEGRDVCWQDVIPKYPTTCAVEWV--DAEDPLFLLYTSGSTGKPKGVLHTTG 464 Query: 185 --LNLASSVRNIRSVYRLTE-----SDSTVIVLPLFHVHG-LIAGLLSSFTAGAAVTLPA 236 + A++ Y+ ++ +D I + +G L+ G + GA P Sbjct: 465 GYMVYAATTFKYAFDYKSSDIYWCTADCGWITGHSYVTYGPLLNGATAVLYEGAP-NYPD 523 Query: 237 AGRFSASTFWADMLKYNAT-WYTAVPTIHQIILDRHANKPEPAYPKLRFIRSCSASLAPS 295 GR W + KY + +YTA + ++ D + LR + S + PS Sbjct: 524 PGRC-----WDVVDKYKVSIFYTAPTLVRSLMRDSDEYVTRYSRKSLRVLGSVGEPINPS 578 Query: 296 ILARLEESFG---APVLEAYAMTEATHLMCSNPLPEDGAHKPGSVGKPV-GQELAILNEN 351 + G P+ + + TE M + PLP KPGS P G + I++E Sbjct: 579 AWKWVFNVVGDSKCPISDTWWQTETGGFMIT-PLPGAWPQKPGSATFPFFGVQAVIVDEK 637 Query: 352 GVVQPSDVSGEVCIRG--PNVTKGYKNNPEANKAAFTF---GWFHTGDVGFLDSDGYLHL 406 GV + SG +C++ P + + E + + G++ +GD D DGY L Sbjct: 638 GVEIEGECSGYLCVKSSWPGAFRTLYGDHERYETTYFKPFPGYYFSGDGCSRDKDGYHWL 697 Query: 407 VGRIKELINRGGEKISPIEVDAVLLSHPEICQAVCFGVPDDKYGEEINCAIIPREGSSID 466 GR+ ++IN G +I EV++ L+SHP+ +A GV + G+ I + EG Sbjct: 698 TGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGVEHEVKGQGIYAFVTLVEGVPYS 757 Query: 467 E---AEVMRFCKKNLAAFKVPKKVFITDSVPKTATGKIQRRIVAEHFLAQISTAKVPKFG 523 E ++ +K + F P K+ +PKT +GKI RRI L +I++ ++ + G Sbjct: 758 EELRKSLILAVRKQIGPFAAPDKIHWAPGLPKTRSGKIMRRI-----LRKIASRQLDELG 812 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1630 (139 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158376124 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2708 (543 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4661 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9457 470 e-135 >Contig9457 Length = 253 Score = 470 bits (1210), Expect = e-135, Method: Compositional matrix adjust. Identities = 227/252 (90%), Positives = 238/252 (94%), Gaps = 1/252 (0%) Query: 1 MATVTTQASA-VYRPQITSKSRFLTGSSGKLTREVAFRPVTSPSASSFKVEAKKGEWLPG 59 MATVTTQASA ++RP + SKSRFL+GSS KL REVAFRP+ SP ASSFKVEAKKGEWLPG Sbjct: 1 MATVTTQASAAIFRPCVNSKSRFLSGSSSKLNREVAFRPMASPPASSFKVEAKKGEWLPG 60 Query: 60 LPSPGYLTGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIG 119 LPSP YLTGSLPGDNGFDPLALAEDPENL+W++QAELVNGRWAMLGV GMLLPEV TSIG Sbjct: 61 LPSPDYLTGSLPGDNGFDPLALAEDPENLRWYIQAELVNGRWAMLGVVGMLLPEVFTSIG 120 Query: 120 IINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 179 I+NVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP Sbjct: 121 ILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 180 Query: 180 NEVGYPGGIFNPLNFAPTEEAKEKEIANGRLAMLAFLGFVVQHNVTGKGPFDNLVQHLSD 239 EVGYPGGIFNPLNF PT EAKEKE+ANGRLAMLAFLGFVVQHNVTGKGPFDNL+QHLSD Sbjct: 181 GEVGYPGGIFNPLNFEPTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSD 240 Query: 240 PWHNTIVQTLRG 251 PWHNTIVQTL G Sbjct: 241 PWHNTIVQTLSG 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2717 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16441 62 9e-12 >Contig16441 Length = 288 Score = 62.0 bits (149), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 54/195 (27%), Positives = 90/195 (46%), Gaps = 24/195 (12%) Query: 43 CAATSYGGNTPKFPRVSVWDPYKRLGVNQDASEEEIWGSRNFLLQQYAGHERSEESIEAA 102 AA+ N P +SV + K LGV+ AS +EI ++N ++ + + +EAA Sbjct: 57 TAASRADDNAPF--EMSVENALKLLGVSDGASFDEILRAKNSIVAACKDDQEAIAQVEAA 114 Query: 103 FEKILMTSFKQRKKTKI--------NLKSRLKNKVEESPPW----VKNLLSFVEIPATEV 150 ++ +LM S QR+ K+ ++K + P W VKN VE P+T Sbjct: 115 YDMLLMRSLTQRRAGKVVNSSVRYADVKPVSAPGIGSVPQWLQATVKNPPIAVETPSTSD 174 Query: 151 IFRRLFLFAFMGGWSIMNSAEGG----------PAFQVAVSLAACIYFLNDKIKSLARAS 200 + ++ ++ + + +N A G P +A S A +YF+ K L +A+ Sbjct: 175 LGVQVGVYGALMALTYVNGASGSSSGPYGGADVPGLILAGSFGASLYFMTKKNIKLGKAT 234 Query: 201 VYGLGALVAGWVCGS 215 + +G LVAG V GS Sbjct: 235 IITVGGLVAGAVVGS 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig479 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19252 105 5e-25 >Contig19252 Length = 125 Score = 105 bits (261), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 48/85 (56%), Positives = 67/85 (78%), Gaps = 1/85 (1%) Query: 74 TCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGIN 133 TCP+D LKLG C ++L L+N+ IG+PP CC L++GL+DLEAA+CLCT I+A+ LG+N Sbjct: 42 TCPKDTLKLGACVDLLG-LVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALGLN 100 Query: 134 LNIPIALSLLLNACGNQVPRGFQCS 158 + +P+ALSLL++AC VP GF+C Sbjct: 101 MEVPVALSLLVSACQKTVPPGFKCE 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4022 (357 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5234 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26661 63 6e-12 >Contig26661 Length = 146 Score = 62.8 bits (151), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 28/76 (36%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Query: 41 RQLWL-AGPLICVSILQYSIQIIAVMFVGHLGELSLSGATMALSFTSVTGFSLLMGMSSA 99 +++WL AGP I + + +++ F+GH+G L L+ ++ + G +L+GM+SA Sbjct: 41 KKMWLVAGPAIFTRVASFGTNVVSQAFIGHIGSLELAAFSLVFTVLVRFGNGILLGMASA 100 Query: 100 LDTFSGQCYGAKQYHM 115 L+T GQ +GAKQY+M Sbjct: 101 LETLCGQSHGAKQYNM 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2521 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548447 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158352629 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361895 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4472 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1849 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89558065 (120 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158358371 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2549 (341 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3034 339 3e-95 >Contig3034 Length = 220 Score = 339 bits (870), Expect = 3e-95, Method: Compositional matrix adjust. Identities = 160/219 (73%), Positives = 184/219 (84%), Gaps = 1/219 (0%) Query: 1 MAPELVPA-VPKSTALTRPATLPRRAYVTFLAGNGDYVKGVVGLAKGLRKVNTAYPLVVA 59 MAP VPA V ++T+ + +RA+VTFLAG+ DYVKGVVGLAKGLRKV + Y LVVA Sbjct: 1 MAPPEVPADVLQATSNSTTTGYSKRAFVTFLAGDADYVKGVVGLAKGLRKVKSEYSLVVA 60 Query: 60 VLPDVPEDHRRILESQGCIVREIEPVYPPENQTQFAMAYYVINYSKLRIWEFVEYDKMIY 119 +LPDVPE+HR IL SQGCIV+EIEP+YPPENQ +FAMAYYVINYSKLRIW F EY KMIY Sbjct: 61 ILPDVPEEHREILRSQGCIVQEIEPIYPPENQIKFAMAYYVINYSKLRIWNFEEYSKMIY 120 Query: 120 LDGDIQVYDNIDHLFDLPDGNFYAVMDCFCEKTWSHTPQYKIGYCQQCPERVKWDFELGP 179 LD DIQVY+NIDHLF P+G FYAVMDCFCEKTWSH+PQ+KIGYCQQCP++V W ++G Sbjct: 121 LDADIQVYENIDHLFATPNGYFYAVMDCFCEKTWSHSPQHKIGYCQQCPDKVSWPADMGS 180 Query: 180 PPSLYFNAGMFVFEPSVLTYQDLLKTLRVAPTTPFAEQD 218 PP LYFNAGMFVFEPS LTY LL+TL+V P TPFAEQ+ Sbjct: 181 PPPLYFNAGMFVFEPSRLTYNSLLQTLQVVPPTPFAEQE 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3413 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48121754 137 6e-35 >48121754 Length = 106 Score = 137 bits (346), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 58/106 (54%), Positives = 79/106 (74%), Gaps = 1/106 (0%) Query: 3 SSSAQLRLMSDLKTIINEPPEGCSASPMSDDNLFVWSATIFGPDETPWEGGVFSLRLTFS 62 S+ A+ RLM D K + +PP G S +P D+N+ +W+A IFGPD+TPW+GG F L L F+ Sbjct: 2 STPARKRLMRDFKRLQQDPPAGISGAP-QDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 Query: 63 ERYPEKPPRVRFTSEMFHPNVYHDGALCMDIIQDAWSPCHNVSTIL 108 E YP KPP VRF S MFHPN+Y DG++C+DI+Q+ WSP ++V+ IL Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1900 (451 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226742903 311 1e-86 >226742903 Length = 195 Score = 311 bits (798), Expect = 1e-86, Method: Compositional matrix adjust. Identities = 156/174 (89%), Positives = 156/174 (89%) Query: 113 EIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVY 172 EIVDLCLDRIRKLA NCTGLQGFLVFNAV VDYGKKSKLGFTVY Sbjct: 19 EIVDLCLDRIRKLAYNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY 78 Query: 173 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 232 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS Sbjct: 79 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 138 Query: 233 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 286 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL Sbjct: 139 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig982 (534 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10760 747 0.0 >Contig10760 Length = 403 Score = 747 bits (1929), Expect = 0.0, Method: Compositional matrix adjust. Identities = 346/399 (86%), Positives = 375/399 (93%) Query: 133 MGNAFLLQGGDCAESFKEFSANNIRDTFRVMLQMGVVLMFGGQMNVVKVGRMAGQFAKPR 192 MGNAFLLQGGDCAESFKEF+ANNIRDTFR++LQMGVVLMFGGQM VVKVGRMAGQFAKPR Sbjct: 1 MGNAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPR 60 Query: 193 SAAVEEKNGITLPVYKGDNINGEAFDEKSRIPDPQRLIRAYCQSAATLNLLRSFATGGYA 252 S + EEK+G+ LP Y+GDN+NG+AFD +SR PDPQRLIRAYCQSAATLNLLR+FATGGYA Sbjct: 61 SDSFEEKDGVKLPSYRGDNVNGDAFDLQSRTPDPQRLIRAYCQSAATLNLLRAFATGGYA 120 Query: 253 AMQRVTQWNLDFAEHSEQGDRYQELAHRVDEALGFMSAAGLTVDHPIMRTTEFWTSHECL 312 AMQRVTQWNLDF EHSEQGDRY+ELA RVDEALGFM+AAGLT+DHPIM TTEFWTSHECL Sbjct: 121 AMQRVTQWNLDFTEHSEQGDRYRELASRVDEALGFMTAAGLTIDHPIMTTTEFWTSHECL 180 Query: 313 HLPYEQALTREDSTSGLFYDCSAHMLWCGERTRQLDGAHVEFLRGISNPIGVKVSNTMDP 372 LPYEQ+LTR DSTSGL+YDCSAHMLW GERTRQLDGAH+EFLRG++NP+G+KVS+ MDP Sbjct: 181 LLPYEQSLTRLDSTSGLYYDCSAHMLWVGERTRQLDGAHIEFLRGVANPLGIKVSDKMDP 240 Query: 373 KDLVNLIEILNPTNKPGRITIICRMGAENMRVKLPHLIRAVRQAGQIVTWVCDPMHGNTI 432 +LV LIEILNP NK GRIT+I RMGAENMRVKLPHLIRAVR+AGQIVTWV DPMHGNTI Sbjct: 241 NELVKLIEILNPQNKAGRITVITRMGAENMRVKLPHLIRAVRRAGQIVTWVSDPMHGNTI 300 Query: 433 KAPCGLKTRPFDAILAEVRAFFDVHEQEGSHPGGIHLEMTGQNVTECIGGSRTVTFDDLS 492 KAPCGLKTRPFDAI AEVRAFFDVHEQEGSHPGG+HLEMTGQNVTECIGGSRTVTFDDLS Sbjct: 301 KAPCGLKTRPFDAIRAEVRAFFDVHEQEGSHPGGVHLEMTGQNVTECIGGSRTVTFDDLS 360 Query: 493 SRYHTHCDPRLNASQALELAFIIAERLRKRRIGTQRLLS 531 SRYHTHCDPRLNASQ+LELAFIIAERLRKRRI +Q L+ Sbjct: 361 SRYHTHCDPRLNASQSLELAFIIAERLRKRRIKSQNPLA 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4657 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1785 (483 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig119 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22262 490 e-140 >Contig22262 Length = 299 Score = 490 bits (1262), Expect = e-140, Method: Compositional matrix adjust. Identities = 235/287 (81%), Positives = 255/287 (88%) Query: 1 MAFIKASKPRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60 M F+K+ K RAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI Sbjct: 1 MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60 Query: 61 VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE 120 VAQI+S++I+GDLVLA+AY+HELP YGL VGLTNYAA+YCTGLLLARR LKKLEMD+EYE Sbjct: 61 VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE 120 Query: 121 GNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFA 180 GN+EATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D+PHSEKRFA Sbjct: 121 GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA 180 Query: 181 GFSKDSKSLDAETHRKYIYGGHVAAYMGTLIEDEPEKYQTHFSXXXXXXXXXXXXXXLYK 240 GFSKDSK LDAE HRKYIYGGHVAAYM TL EDEPEKYQTHFS LYK Sbjct: 181 GFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYK 240 Query: 241 KVHAAIRADPLEKKTAKPEPKQHKRFNLKKLTYEERKNKLIERLNAF 287 KVHAAIRADP KKT K PK+HKR+NLKKLT++ERK KL+ERL AF Sbjct: 241 KVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4299 (462 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5776 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 207 2e-55 >Contig7384 Length = 326 Score = 207 bits (526), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 112/260 (43%), Positives = 154/260 (59%), Gaps = 8/260 (3%) Query: 36 LSWSFYDSSCPKLDSIVRKQLKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLDGSASG 95 L +FY +SCP ++SIV + + + + I A LRL HDCFV+GCD S+++ S +G Sbjct: 26 LVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEGCDASIII-ASPNG 84 Query: 96 PSEQQAPPNLSLRAKAFQIINDLREIVHSKCGRVVSCADLTALAARDAVFLSGGPEYEVP 155 +E+ NLSL F + ++ V ++C VVSCAD+ A+AARD V L+GGP + V Sbjct: 85 DAEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAGGPSFPVE 144 Query: 156 LGRKDGLNFATRNETLANLPAPTSNTTKLLTDLAKKNLDATDVVALSGGHTIGLGHCTSF 215 LGR+DGL + + NLP PT N +L T AK NL TDV+ALSG HT+G HC F Sbjct: 145 LGRRDGL-ISKASRVAGNLPEPTFNLNQLTTMFAKHNLSLTDVIALSGAHTLGFSHCNRF 203 Query: 216 TGRLY-----PTQDASMDKTFANDLKQVCP-AADTNATTVLDIRSPDTFDNKYYVDLMNR 269 + RLY T D S++ +A L CP A D N LD +P TFDN YY +L+ Sbjct: 204 SDRLYNFSPSSTVDPSLNPDYAKQLMATCPIAVDPNIVMTLDPDTPFTFDNAYYRNLVAG 263 Query: 270 QCLFTSDQDLYTDKRTRDIV 289 + L +SDQ L++D +R V Sbjct: 264 KGLLSSDQVLFSDSASRSTV 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1052 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89544763 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30126 120 1e-29 >Contig30126 Length = 148 Score = 120 bits (301), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 61/147 (41%), Positives = 90/147 (61%), Gaps = 4/147 (2%) Query: 7 RLFKEYKEVQREKVADPDIQLVCDDSNIFKWTALIKGPSETPFEGGIFQLAFAVPEQYPL 66 R+ KE K++Q++ A V DD +F W A I GP+E+PF GG+F ++ P YP Sbjct: 5 RINKELKDLQKDPPASCSAGPVADD--MFHWQATIMGPAESPFSGGVFLVSIHFPPDYPF 62 Query: 67 QPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNC 126 +PP+V F TK++HPN++ G ICLDILK WSPA T+ V +I +L+ P PD PL Sbjct: 63 KPPKVAFRTKVYHPNIN-SNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVP 121 Query: 127 DSGNLLRAGDIKGYHSMARMYTRLAAM 153 + ++ + D + Y + AR +T+ AM Sbjct: 122 EIAHMYKT-DRQKYETTARSWTQKYAM 147 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158365522 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24889 385 e-109 >Contig24889 Length = 300 Score = 385 bits (989), Expect = e-109, Method: Compositional matrix adjust. Identities = 184/190 (96%), Positives = 188/190 (98%) Query: 22 MEDGGVPMGTSSASLLKEAIHVISCGYEDKTEWGKEVGWIYGSVTEDILTGFKMHCHGWR 81 MEDGGVP GTSSASLLKEAIHVISCGYEDK+EWGKEVGWIYGSVTEDILTGFKMHCHGWR Sbjct: 1 MEDGGVPKGTSSASLLKEAIHVISCGYEDKSEWGKEVGWIYGSVTEDILTGFKMHCHGWR 60 Query: 82 SVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLKSLERFSY 141 SVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLK LERFSY Sbjct: 61 SVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLKWLERFSY 120 Query: 142 INSVVYPLTSIPLIAYCSLPAVCLLTGKFIVPEISNYASIIFMALFLSIAATSVLEMQWG 201 INSVVYPLTSIPL+AYCSLPAVCLLTGKFIVPEISNYASI+FMALFLSIAATS+LEMQWG Sbjct: 121 INSVVYPLTSIPLLAYCSLPAVCLLTGKFIVPEISNYASILFMALFLSIAATSILEMQWG 180 Query: 202 HVGIHDWWRN 211 HVGIHDWWRN Sbjct: 181 HVGIHDWWRN 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372667 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2612 236 3e-64 >Contig2612 Length = 248 Score = 236 bits (601), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 130/233 (55%), Positives = 161/233 (69%), Gaps = 6/233 (2%) Query: 1 MAKIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKLGADTTV---ALFFIA 57 MA IAFG ++ +A + EF++T LF+FAGVGSA+A +KL +D + L +A Sbjct: 1 MAGIAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVA 60 Query: 58 ITH--ALVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCXXX 115 I H AL VAV I A +ISGGH+NPAVT GL GG IT+ + YWI QL+ A + Sbjct: 61 IAHGFALFVAVSIGA-NISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVAAFIL 119 Query: 116 XXXXXXXXXPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGF 175 PIHSLA+GVG QGV++EII+TF+L++TVYAT DPKKGSL + P GF Sbjct: 120 KFVTGGLTIPIHSLAAGVGAIQGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGF 179 Query: 176 VVGANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIY 228 +VGANILA G FSG SMNPARSFGPA+ S D+ D+W+YWVGPLIGGGLAG IY Sbjct: 180 IVGANILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIY 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89540794 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9656 159 3e-41 >Contig9656 Length = 171 Score = 159 bits (402), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 77/85 (90%), Positives = 83/85 (97%) Query: 1 MASAEIEFRCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEK 60 MASAEIEFRCFVGGLAWATDN+ALERAF+ +GEIIESKIINDRETGRSRGFGFVTF +E+ Sbjct: 1 MASAEIEFRCFVGGLAWATDNEALERAFSQYGEIIESKIINDRETGRSRGFGFVTFGSEQ 60 Query: 61 AMRDAIEGMNGQDLDGRNITVNEAQ 85 AMRDAIEGMNGQ+LDGRNITVNEAQ Sbjct: 61 AMRDAIEGMNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226877846 (48 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158350965 (78 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3077 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4218 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7180 219 2e-59 >Contig7180 Length = 199 Score = 219 bits (559), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 104/175 (59%), Positives = 129/175 (73%), Gaps = 2/175 (1%) Query: 1 MAFAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP 60 M+F GT QKC AC+KTVY V++L+AD +HK+CF+C HCKGTLKLSNY+S EGVLYC+P Sbjct: 1 MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFDQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAASKASGMFGGTRDKCFGCKNTVYPT 120 HF+QLFK TG+ +K+F+ K + P + P SKA+ MF GT+DKC C T YP Sbjct: 61 HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSP--SKAASMFSGTQDKCATCGKTAYPL 118 Query: 121 EKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIREKGNLSQL 175 EKVTV YHK CFKC+HGGC I+PSNY A EG LYCKHH +QL +EKG+ + L Sbjct: 119 EKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHL 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77981379 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3802 213 3e-57 >Contig3802 Length = 163 Score = 213 bits (541), Expect = 3e-57, Method: Compositional matrix adjust. Identities = 101/160 (63%), Positives = 114/160 (71%) Query: 43 IAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSKFHRIIPSFMLQX 102 I G+PAGRIVM L P+TAENFRALCTGEKG+G+SGKP HYKGS FHR+IP FM Q Sbjct: 3 IGGQPAGRIVMELDADTTPRTAENFRALCTGEKGVGRSGKPPHYKGSAFHRVIPGFMCQG 62 Query: 103 XXXXXXXXXXXESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTTWLDG 162 ESIYG KFADENF KHTGPG+LSMANAGP TNGSQFFI T T WLDG Sbjct: 63 GDFTAGNGTGGESIYGAKFADENFNKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLDG 122 Query: 163 RHVVFGKVLSGMDVVYKVEAEGSQSGTPKSKVAIVDSGEL 202 +HVVFG+V+ G+DVV +E GS G V + D G+L Sbjct: 123 KHVVFGQVVEGLDVVKNIEKVGSGQGRTSKPVVVADCGQL 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1241 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89550254 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29068 380 e-108 >Contig29068 Length = 216 Score = 380 bits (977), Expect = e-108, Method: Compositional matrix adjust. Identities = 182/208 (87%), Positives = 198/208 (95%) Query: 4 RLLQVGTKIIGVGRNYAAHAKELGNAVPKEPVLFLKPTSSYLENGGTIEIPHPLESLDHE 63 +LL+ GTKI+GVGRNYAAHAKELGNAVPKEPVLFLKPTSSYL+NGGTIE+PHPL SLDHE Sbjct: 8 KLLEAGTKIVGVGRNYAAHAKELGNAVPKEPVLFLKPTSSYLKNGGTIEVPHPLLSLDHE 67 Query: 64 VELAVVISKKARDVPQAKAMEYVGGYALALDMTAREIQATAKSAGLPWTIAKGQDTFTPI 123 VELAV+IS+KARDVPQ+ AM+YV GYALALDMTAREIQA+AKSAGLPWTIAKGQDTFTPI Sbjct: 68 VELAVIISQKARDVPQSTAMDYVAGYALALDMTAREIQASAKSAGLPWTIAKGQDTFTPI 127 Query: 124 SSVLSLATVPDPDDLELWLKVDGEVRQKGSTKDMIFKIPFLISHISSIMTLLEGDVILTG 183 SS L VP+PDD+ELWLKVDGE++QKGSTKDMIFK+PFLISHISSIMTLLEGDVILTG Sbjct: 128 SSALPKEMVPNPDDIELWLKVDGELKQKGSTKDMIFKLPFLISHISSIMTLLEGDVILTG 187 Query: 184 TPKGVGPVKAGQKITAGITNLVDVQFNV 211 TP+GVGPVK GQKITAGITNLVDVQFNV Sbjct: 188 TPQGVGPVKIGQKITAGITNLVDVQFNV 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89545624 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4460 (431 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158378857 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28069 66 3e-13 >Contig28069 Length = 447 Score = 66.2 bits (160), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 6/107 (5%) Query: 61 HWEDRMWKGLFRYDVTTSEIKVIGGRRKFIAQLNEGWSKDCIPKLGRSKTGRGVFDFGWM 120 WEDRM +GLFRYDVT E KVI G+ FIAQLNEG P R FD Sbjct: 82 EWEDRMQRGLFRYDVTACETKVIPGQYGFIAQLNEGRHLKKRPTEFRVDKVLQPFDSSKF 141 Query: 121 D----SQEELL--FSVARGGQSKPELVLATDVPDSALLITVNASPVD 161 + QEE+L F + G+ DV +S ++ +N SP++ Sbjct: 142 NFTKVGQEEVLFRFEASEDGEVHFFPSAPIDVENSPSVVAINVSPIE 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158354686 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25993 281 6e-78 >Contig25993 Length = 161 Score = 281 bits (719), Expect = 6e-78, Method: Compositional matrix adjust. Identities = 132/161 (81%), Positives = 144/161 (89%) Query: 1 MSFSFFKPSRPKTPQEVAKAISDSLSALDSQTVAEVKSLEKALEEVEKNFGIMRCMLVGD 60 MSFSFFKPSRPKTPQEVAKAI+DSLSALD+QTV EVK+LEKALEEVEKNF M+C+L GD Sbjct: 1 MSFSFFKPSRPKTPQEVAKAINDSLSALDTQTVVEVKALEKALEEVEKNFTTMKCLLSGD 60 Query: 61 GETEANTEQVSQLVFEICKEDVLALLVHKLPILGWEARKDLVHCWSILLKQKVEDTFCCE 120 GETE N +QVSQL EICKE V LL+HKLPILGWEARKDLVHCWSIL+KQKVE T+CC Sbjct: 61 GETEPNMDQVSQLALEICKEGVFDLLIHKLPILGWEARKDLVHCWSILMKQKVELTYCCA 120 Query: 121 QYIENHYELLDFLVASYDNKEIALNCGAMLRDCIRFPTLAK 161 +Y+ENH ELLDFLV YDNKEIALNCG+MLRDCIRFP LAK Sbjct: 121 EYMENHLELLDFLVVCYDNKEIALNCGSMLRDCIRFPALAK 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2876 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21497 500 e-144 >Contig21497 Length = 261 Score = 500 bits (1288), Expect = e-144, Method: Compositional matrix adjust. Identities = 242/256 (94%), Positives = 248/256 (96%) Query: 3 ERDNYVYTAKLAEQAERYDEMVEAMTKVAKLDVELTIEERNLLSVGYKNVIGARRASWRI 62 ER+NYVYTAKLAEQAERYDEMVEAMTKVAKLDVELT+EERNLLSVGYKNVIGARRASWRI Sbjct: 6 ERENYVYTAKLAEQAERYDEMVEAMTKVAKLDVELTVEERNLLSVGYKNVIGARRASWRI 65 Query: 63 LSSIEQKEEGKGNDINVSRIKEYRNKVEAELSSICSDIMRVIDEHLLPSCSGFESTVFFY 122 LSSIEQKEEGKGND NVSRIKEYR KVE+ELSSICSDIMRVIDEHL+PSC+ FESTVFFY Sbjct: 66 LSSIEQKEEGKGNDQNVSRIKEYRQKVESELSSICSDIMRVIDEHLIPSCTAFESTVFFY 125 Query: 123 KMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYY 182 KMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYY Sbjct: 126 KMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYY 185 Query: 183 EILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGVEE 242 EILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDG E+ Sbjct: 186 EILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGGED 245 Query: 243 GQKADSSAKAGGEDAE 258 QK D SAK GGEDAE Sbjct: 246 IQKVDGSAKPGGEDAE 261 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2870 (408 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14799 518 e-149 >Contig14799 Length = 428 Score = 518 bits (1334), Expect = e-149, Method: Compositional matrix adjust. Identities = 249/311 (80%), Positives = 276/311 (88%) Query: 97 FLGKYPWLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLISWAVG 156 F K+P+L+TGFFFFMWY LNVIFNILNKK+YNYFPYPYFVSVIHL VGVVYCL+SW+VG Sbjct: 114 FSEKFPFLITGFFFFMWYLLNVIFNILNKKVYNYFPYPYFVSVIHLLVGVVYCLVSWSVG 173 Query: 157 LPKRAPMDSNQLKLLIPVAACHALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFIL 216 LPKRAP+D QL LL PVA CHALGHV SNVSFAAVAVSFTHTIKALEPFFNASASQF+L Sbjct: 174 LPKRAPIDKEQLALLTPVAFCHALGHVMSNVSFAAVAVSFTHTIKALEPFFNASASQFVL 233 Query: 217 GQSIPLSLWLSLAPVVLGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDS 276 G IPLSLWLSLAPVV+GVSMASLTELSFNWLGF SAMISNI+FTYRSIYSKKAMT MDS Sbjct: 234 GHHIPLSLWLSLAPVVIGVSMASLTELSFNWLGFGSAMISNIAFTYRSIYSKKAMTGMDS 293 Query: 277 TNLYAYISIIALFFCLPPALILEGPQLLKHGFADAIAKVGLVKFITDLVWVGLFYHLYNQ 336 TN+YAYISIIAL C+PPA+++EGPQL+++GF DAIAKVGL KF++DL W+G+FYHLYNQ Sbjct: 294 TNVYAYISIIALLVCIPPAILIEGPQLMQYGFKDAIAKVGLYKFVSDLFWIGMFYHLYNQ 353 Query: 337 LATNTLERVAPLTHAVGNVLKRVFVIGFSIVIFGNKISXXXXXXXXXXXXXVAIYSYLKA 396 LATNTLERVAPLTHAVGNVLKRVFVIGFSIV+FGNKIS VAIYS +KA Sbjct: 354 LATNTLERVAPLTHAVGNVLKRVFVIGFSIVVFGNKISTQTGIGTAIAIAGVAIYSLIKA 413 Query: 397 KIEEEKRQAKA 407 +EE+KR+A A Sbjct: 414 NLEEQKRKAAA 424 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3140 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57896440 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5239 116 3e-28 >Contig5239 Length = 206 Score = 116 bits (291), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 55/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%) Query: 161 HGPRKASPLERKLPCSLEELYKGTTKKMKISREIADASGRTMPVEEILTIEVKPGWKKGT 220 +GP+KA+ + R LPC+LEELY G TKK+KISR++ ASGR VEE+LTIE+KPGWKKGT Sbjct: 22 NGPKKAAAIVRTLPCTLEELYNGATKKLKISRDVLGASGRKSTVEEVLTIEIKPGWKKGT 81 Query: 221 KITFPEKG-NEHPNEIPADLVFIID 244 KITF EKG + IPAD+VFI+D Sbjct: 82 KITFQEKGPDTRRGVIPADIVFIVD 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3391 (390 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7498 94 4e-21 >Contig7498 Length = 333 Score = 94.0 bits (232), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 75/315 (23%), Positives = 142/315 (45%), Gaps = 22/315 (6%) Query: 3 MALPPLPVSISFSVVIFILAYNLYQRLRFKLPP-GPRP------WPVVG--NLYHIKPVR 53 + P L +I+ + + +Y Q+ R G +P P++G +L+ + Sbjct: 8 FSFPFLNTAIAGLFAVLLFSYYFIQKFRAATNSRGSKPPKLAGGLPLLGHLDLFGGSQLP 67 Query: 54 FRCYAEWAQSYGPIISVWIGSTLNVVVSNTELARQVLKDHDQKLADRHRNRSAAKFSKDG 113 YGPI + IG +V++ E A++ +D ++ R S D Sbjct: 68 HITLGALVDKYGPIFTFNIGIHSALVINTWEAAKECFTTNDSIVSSRPATLGIKHLSYDF 127 Query: 114 QDLIWADYGPHYVKVRKVCTLELFSPKRIEALRPIREDEVTAMVESIYNHCTAAENYGK- 172 ++ YGP++ K+RK+ +LEL S +R+E L+ +R EV ++ +Y T ++ G Sbjct: 128 AMFGFSPYGPYWRKIRKLTSLELLSNRRLELLKSVRVSEVEMRLKKLYKRWTERKDGGSS 187 Query: 173 ---NLSVREYLGAVAFNNITRLAFGKR---FVNSEGVLDKQGLEFKAITANGLKLGASLA 226 ++ ++++ G + N I R+ KR VN +K+ ++ L Sbjct: 188 ADISVEMKQWFGDLTLNVILRMIAEKRVLNVVNGNSNDEKEARAWQKAMREFFHLVGMFV 247 Query: 227 MAEHIPWLRWM-FPLEEEAFAKHGERRDRLTREIMEEHTQKRNKSGGVAKQHFVDALLTL 285 + + IPWL W+ ++A K + D + +EEH Q+R K G +Q F+ +L++ Sbjct: 248 LGDAIPWLWWLDLGGHQKAMKKTAKALDSIVMGWLEEHKQRRAK--GQDQQDFMGVMLSV 305 Query: 286 QEKYDLS---EDTII 297 + +S DT+I Sbjct: 306 LDGAHVSGFDTDTVI 320 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359308 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542771 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1993 (585 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5264 (447 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 884 0.0 >Contig27182 Length = 447 Score = 884 bits (2284), Expect = 0.0, Method: Compositional matrix adjust. Identities = 424/436 (97%), Positives = 433/436 (99%) Query: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD 240 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPSDKPLRLPLQD Sbjct: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETG++KPGMVVTFGPTGLTTEVKSVEMHHEAL EALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 GEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 EILTKIDRRSGKE+EKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKNVEKKDPSG 436 VAVGVIK+VEKK+P+G Sbjct: 421 VAVGVIKSVEKKEPTG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4974 (423 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21943 606 e-175 >Contig21943 Length = 420 Score = 606 bits (1563), Expect = e-175, Method: Compositional matrix adjust. Identities = 317/422 (75%), Positives = 338/422 (80%), Gaps = 7/422 (1%) Query: 5 GRAPKKSDNSKYYEILGVSKTASPEDVKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLS 64 GRAPKKSDN++YYEILGVSK+ASP+D+KKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLS Sbjct: 3 GRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLS 62 Query: 65 DPEKREIYDRYGEDGLKEEMQSGG---HDPFDIXXXXXXXXXXXXXXXXXXXXXXXXXXX 121 DPEKREIYD+YGED LKE M GG HDPFDI Sbjct: 63 DPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRG--- 119 Query: 122 XEDVVHPLKVSLEDLYLGTSKKLSLSRNVLXXXXXXXXXXXXXXXXXXXXQGTGMKVTIR 181 EDVVH LKVSLEDLYLGTSKKLSLSRNVL QG+GMKV+IR Sbjct: 120 -EDVVHALKVSLEDLYLGTSKKLSLSRNVLCSKCNGKGSKSGASLKCSGCQGSGMKVSIR 178 Query: 182 HLGPSMIQQMQHACNECKGTGETISDKDRCGQCXXXXXXXXXXXXXXXXXXXMQNGQKIT 241 HLGPSMIQQMQHACNECKGTGETISD+DRC QC MQNGQKIT Sbjct: 179 HLGPSMIQQMQHACNECKGTGETISDRDRCTQCKGEKVVQEKKVLEVHVEKGMQNGQKIT 238 Query: 242 FPGEADEAPDTVTGDIVFIIQQKEHPKFKRKMDDLFVEHSLSLTDALCGFQFVLNHLDGR 301 FPGEADEAP+TVTGDIVF+IQQKEHPKFKRK +DLFVEH+LSLT+ALCGFQFVL HLDGR Sbjct: 239 FPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGR 298 Query: 302 QLLIKSNPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVDFPETLSPEQVKALEAA 361 QLLIKSNPGEVVKPDSFKA+NDEGMPMYQRPFMKGKLYIHF+V+FPE+LSPEQVKALEAA Sbjct: 299 QLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLSPEQVKALEAA 358 Query: 362 LPSRASSQQLTDMELDECEETTLHDVNMEEEMRRKQHQAHSEAYDEDDDMPGGAQRVQCA 421 LP + S+ QLTDME+DECEETTLHDVNMEEEMRRKQ QA EAYDEDDDMPGGAQRVQCA Sbjct: 359 LPGKPSASQLTDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPGGAQRVQCA 418 Query: 422 QQ 423 QQ Sbjct: 419 QQ 420 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158371151 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4717 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24312 245 6e-67 >Contig24312 Length = 482 Score = 245 bits (625), Expect = 6e-67, Method: Compositional matrix adjust. Identities = 119/206 (57%), Positives = 143/206 (69%), Gaps = 3/206 (1%) Query: 36 QKADRVIGLPGQP-PVKFDQYAGYVTVNETHGRALFYWFFEAVKTPQDKPLVLWLNGGPG 94 Q DRV LPGQ + F ++GYV VNE GRALFYWF EA + P KP+VLWLNGGPG Sbjct: 36 QNLDRVADLPGQSFNLSFAHFSGYVPVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPG 95 Query: 95 CSSIGYGASEELGPFFPQKGAKPKLKYNPYTWNNAANLLFLESPVGVGFSYTNTTKDISQ 154 CSSI YG +EE+GPF + K L NPY+WN AN+LF +SPVGVGFSY+NT+ D+ Sbjct: 96 CSSIAYGMAEEIGPFHIEADGK-TLYLNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLS 154 Query: 155 LGDTITAEDSHKFLINWFKRFPQYKSHDFYITGESYGGHYVPQLSELVYDRNKNASKETY 214 GD TA DS FL+ WF+RFPQYK DFYITGESYGGHYVPQLS+ + N +KE Sbjct: 155 NGDKRTANDSLTFLLQWFERFPQYKGRDFYITGESYGGHYVPQLSQAIVKYNLK-TKEKT 213 Query: 215 INFKGFMIGNAAIDDETDQKGLIDML 240 +N KG+M+GNA DD D G+ + Sbjct: 214 VNLKGYMVGNALTDDYHDHLGVFQFM 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5275 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3826 (597 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7310 67 1e-12 >Contig7310 Length = 583 Score = 66.6 bits (161), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 55/193 (28%), Positives = 85/193 (44%), Gaps = 14/193 (7%) Query: 325 KSEKKAPKTPATPETSGSKTLFAGNLSYNIEQKDVVEFFKNVGQVVDVRLSSDADG-NFK 383 K +K+A + A PE +T+FA + ++DV EFF G+V DVRL D + K Sbjct: 200 KDKKEAMEPEADPERD-QRTVFAYQMPLKAAERDVYEFFSKAGKVRDVRLIMDRNSRRSK 258 Query: 384 GYGHVEFATAEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG 443 G G++EF A A+ L+G L G+P+ + + SG G G Sbjct: 259 GVGYIEFYDAMSVPMAIALSGQLLLGQPVMVKPSEAEKNLVQSNATSGAAGVVGPYGAVD 318 Query: 444 QSQTIFVRGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTD--- 500 + + F+ T+ + L+ F G + V +P D +TG KG ++ F Sbjct: 319 RKLYVGNLHFNMTE------THLREIFEPFGPVELVQLPLDLETGQCKGFGFVQFAHLEH 372 Query: 501 ---ADALNKALEF 510 A +LN LE Sbjct: 373 AKAAQSLNGKLEI 385 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359037 (52 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig395 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1985 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28069 266 2e-73 >Contig28069 Length = 447 Score = 266 bits (679), Expect = 2e-73, Method: Compositional matrix adjust. Identities = 124/148 (83%), Positives = 137/148 (92%), Gaps = 1/148 (0%) Query: 1 MMLKIKRVPTVVSNYQKDEADEG-RRAGGCGRNCLNKCCISGAKLPLYAFKKQNNSPGEK 59 MML+IKRVPTVVSNYQKDEA+EG RR GCGRNCLN+CCI GAKLPLYAFKK+N + G+ Sbjct: 1 MMLRIKRVPTVVSNYQKDEAEEGARRVEGCGRNCLNQCCIPGAKLPLYAFKKRNVNNGDT 60 Query: 60 GFSGHEKQDAPVAFLDSLVLGEWEDRMQKGLFRYDVTACETKVIPGQFGFIAQLNEGRHL 119 G GH+K++ PVAFLDSL+LGEWEDRMQ+GLFRYDVTACETKVIPGQ+GFIAQLNEGRHL Sbjct: 61 GVPGHDKREPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQYGFIAQLNEGRHL 120 Query: 120 KKRPTEFRVDKVLQPFDGSKFNFTKVGK 147 KKRPTEFRVDKVLQPFD SKFNFTKVG+ Sbjct: 121 KKRPTEFRVDKVLQPFDSSKFNFTKVGQ 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5748 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1132 484 e-139 >Contig1132 Length = 265 Score = 484 bits (1247), Expect = e-139, Method: Compositional matrix adjust. Identities = 236/265 (89%), Positives = 245/265 (92%) Query: 1 MATSAIQQSAFAGQTALKPSNELVRKIGSLGGGRISMRRTVKSAPESIWYGPDRPKYLGP 60 MATSAIQQSAFAGQTALK S+ELVRKIG LGGGR SMRRTVKSAP+SIWYGPDRPKYLGP Sbjct: 1 MATSAIQQSAFAGQTALKQSSELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP 60 Query: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSK 120 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+LS+ Sbjct: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSR 120 Query: 121 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVXXXX 180 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNL+HAQSILAIWAVQVVLMGFIEGYRV Sbjct: 121 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGP 180 Query: 181 XXXXXXXXXXXXAFDPLGLADDPEAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIE 240 AFDPLGLADDPEAFAELKVKE+KNGRLAMTSMFGFFVQAIVTGKGP+E Sbjct: 181 LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE 240 Query: 241 NLYDHVADPVANNAWAYATNFVPGK 265 NL+DH+ADPVANNAWAYATNFVPGK Sbjct: 241 NLFDHIADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357238 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4754 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4285 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4105 (385 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158378767 (63 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5427 (78 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2099 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1132 424 e-120 >Contig1132 Length = 265 Score = 424 bits (1089), Expect = e-120, Method: Compositional matrix adjust. Identities = 210/266 (78%), Positives = 228/266 (85%), Gaps = 8/266 (3%) Query: 4 STMALSSPTFAGKAVQLAPTEV------FGTGRISMRKTVGKAVSSGSPWYGPDRVKYLG 57 +T A+ FAG+ +E+ G GR SMR+TV A S WYGPDR KYLG Sbjct: 2 ATSAIQQSAFAGQTALKQSSELVRKIGGLGGGRFSMRRTVKSAPQS--IWYGPDRPKYLG 59 Query: 58 PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 117 PFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE+L+ Sbjct: 60 PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS 119 Query: 118 RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGG 177 RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG +EGYR+ GG Sbjct: 120 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGG 179 Query: 178 PLGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPL 237 PLGE DPLYPGG+FDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+ Sbjct: 180 PLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPV 239 Query: 238 ENLADHLADPVNNNAWSYATNFVPGK 263 ENL DH+ADPV NNAW+YATNFVPGK Sbjct: 240 ENLFDHIADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1429 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2312 (113 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2206 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1132 421 e-120 >Contig1132 Length = 265 Score = 421 bits (1082), Expect = e-120, Method: Compositional matrix adjust. Identities = 208/266 (78%), Positives = 227/266 (85%), Gaps = 8/266 (3%) Query: 4 STMALSSPTFAGKAVQLAPAEV------FGTGRISMRKTVGKAVSSGSPWYGPDRVKYLG 57 +T A+ FAG+ +E+ G GR SMR+TV A S WYGPDR KYLG Sbjct: 2 ATSAIQQSAFAGQTALKQSSELVRKIGGLGGGRFSMRRTVKSAPQS--IWYGPDRPKYLG 59 Query: 58 PFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 117 PFS + PSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE+L+ Sbjct: 60 PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS 119 Query: 118 RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGG 177 RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG +EGYR+ GG Sbjct: 120 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGG 179 Query: 178 PLGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPL 237 PLGE DPLYPGG+FDPLGLADDPEAFAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+ Sbjct: 180 PLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPV 239 Query: 238 ENLADHLADPVNNNAWSYATNFVPGK 263 ENL DH+ADPV NNAW+YATNFVPGK Sbjct: 240 ENLFDHIADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2468 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1014 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3157 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1473 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13441 62 1e-11 >Contig13441 Length = 361 Score = 62.0 bits (149), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Query: 23 IVLKVDMHCEACARKVARALKGFEGVEEVTTDXXXXXXXXXXXXXDPIKVCERLQKKSGK 82 + K D+HCE CA+K+ RA+K FEGVE+V TD DP + E+L++K K Sbjct: 30 FIFKTDIHCEGCAKKIKRAVKNFEGVEQVKTD-SAANKLTVTGKVDPAGLKEKLEQKIKK 88 Query: 83 KVELISP 89 KV+L+SP Sbjct: 89 KVDLVSP 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4113 (368 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48411817 245 1e-66 >48411817 Length = 154 Score = 245 bits (625), Expect = 1e-66, Method: Compositional matrix adjust. Identities = 116/134 (86%), Positives = 122/134 (91%) Query: 3 EVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNIDMT 62 E+TNVSEYEAIAK+KLPKM YDYYASG+EDQWTLAENRNAF++ILFRPRILIDVS IDMT Sbjct: 21 EITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDMT 80 Query: 63 TTVLGFKISMPIMIAPTAFQKMAHPEGEYXXXXXXXXXGTIMTLSSWATSSVEEVASTGP 122 TTVLGFKISMPIMIAPTA QKMAHPEGEY GTIMTLSSWATSSVEEVASTGP Sbjct: 81 TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 140 Query: 123 GIRFFQLYVYKDRH 136 GIRFFQLYVYKDR+ Sbjct: 141 GIRFFQLYVYKDRN 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51048958 (102 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5788 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2701 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4792 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7788 474 e-136 >Contig7788 Length = 264 Score = 474 bits (1220), Expect = e-136, Method: Compositional matrix adjust. Identities = 231/242 (95%), Positives = 237/242 (97%) Query: 18 PNTNSLRDVVPMGPGKYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLS 77 P+ N+L+DVVPMG GKYTMGN+LWYGPDRVKYLGPFSAQTPSYL GEFPGDYGWDTAGLS Sbjct: 23 PSFNTLKDVVPMGTGKYTMGNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLS 82 Query: 78 ADPEAFAKNRALEVIHGRWAMLGAFGCITPEVLEKWVRVDFKEPVWFKAGAQIFSEGGLD 137 ADPEAFAKNRALEVIHGRWAMLGA GCITPEVLEKWVRVDFKEPVWFKAGAQIFSEGGLD Sbjct: 83 ADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWVRVDFKEPVWFKAGAQIFSEGGLD 142 Query: 138 YLGNPNLVHAQSILAVLGSQVLLMGLVEGFRINGLDGVGEGNDLYPGGQYFDPLGLADDP 197 YLGNPNLVHAQSILAVLG QV+LMGLVEGFRINGLDGVGEGN+LYPGGQYFDPLGLADDP Sbjct: 143 YLGNPNLVHAQSILAVLGFQVILMGLVEGFRINGLDGVGEGNNLYPGGQYFDPLGLADDP 202 Query: 198 VTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVP 257 VTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVP Sbjct: 203 VTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVP 262 Query: 258 GS 259 GS Sbjct: 263 GS 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig890 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3836 (408 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89557288 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77980986 (111 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4537 (586 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32014 531 e-152 >Contig32014 Length = 282 Score = 531 bits (1367), Expect = e-152, Method: Compositional matrix adjust. Identities = 248/282 (87%), Positives = 270/282 (95%) Query: 305 MGQYDDCIKDCDKAVERGREVRADFKMIAKALTRKGTAIAKTAKTSKDYEPAIEIFQKAL 364 MGQ++DCIKDC+KAVERGRE+R+DFKMIAKALTRKGTA K AK SKD+EPAIE FQKAL Sbjct: 1 MGQFEDCIKDCEKAVERGRELRSDFKMIAKALTRKGTAYVKMAKCSKDFEPAIESFQKAL 60 Query: 365 TEHRNPDTLKKLNDAEKAKKDLEQQEYFDPKLADEEREKGNEFFKQQKYPEAIRHYTEAL 424 TEHRNPDTLKKLNDAEKAKKDLEQQEY+DPKLADEEREKGNE+FKQQKYPEAI+ YTEAL Sbjct: 61 TEHRNPDTLKKLNDAEKAKKDLEQQEYYDPKLADEEREKGNEYFKQQKYPEAIKQYTEAL 120 Query: 425 RRNPKDPKAYSNRAACYTKLGAMPEGLKDAEKCIELDPTFSKGYTRKGTVQYFMREYEKA 484 RRNPKDPKAYSNRAACYTKLGAMPEGLKDAE+CIELDPTF+KGYTRKG VQ+FM+EYEKA Sbjct: 121 RRNPKDPKAYSNRAACYTKLGAMPEGLKDAEQCIELDPTFAKGYTRKGAVQFFMKEYEKA 180 Query: 485 LETYQEGLKHDPGNQDLLDGVRKCVEQINKASRGDLSADELKERQTKGMQDPEIQNILSD 544 LETYQEGLKH+P NQ+LLDGVR+CVEQINKASRGDLS +ELKERQ KGMQDPE+QNIL D Sbjct: 181 LETYQEGLKHNPSNQELLDGVRRCVEQINKASRGDLSPEELKERQAKGMQDPEVQNILQD 240 Query: 545 PVMRQVLVDFQENPKAAQEHSKNPMVMAKIQKLVSAGIVQIK 586 PVMRQVL DFQENPKAAQEH+KNPMVM+KIQKLVSAGIVQ++ Sbjct: 241 PVMRQVLTDFQENPKAAQEHTKNPMVMSKIQKLVSAGIVQLR 282 Score = 89.0 bits (219), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 55/200 (27%), Positives = 93/200 (46%), Gaps = 16/200 (8%) Query: 1 MADEAKAKGNAAYSAGDYEAAITHFTEAINLAPTNHVLYSNRSASYASLNRYSDALSDAK 60 +ADE + KGN + Y AI +TEA+ P + YSNR+A Y L + L DA+ Sbjct: 92 LADEEREKGNEYFKQQKYPEAIKQYTEALRRNPKDPKAYSNRAACYTKLGAMPEGLKDAE 151 Query: 61 KTVELKPDWVKGYSRLGAAHHGLAQFDDAVSAYNKGLEIDPNNAALKEALAESKXXXXXX 120 + +EL P + KGY+R GA + +++ A+ Y +GL+ +P+N L + + Sbjct: 152 QCIELDPTFAKGYTRKGAVQFFMKEYEKALETYQEGLKHNPSNQELLDGVRRC------- 204 Query: 121 XXXXXXXXXXXXXFGDAFSGPQM---WAKLTADPSTRAFMQQPDFVSMMQEIQKNPTNLN 177 GD S ++ AK DP + +Q P ++ + Q+NP Sbjct: 205 -----VEQINKASRGD-LSPEELKERQAKGMQDPEVQNILQDPVMRQVLTDFQENPKAAQ 258 Query: 178 LYLKDQRVMQALGVLLNVKL 197 + K+ VM + L++ + Sbjct: 259 EHTKNPMVMSKIQKLVSAGI 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158371956 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26661 78 1e-16 >Contig26661 Length = 146 Score = 77.8 bits (190), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 37/85 (43%), Positives = 59/85 (69%) Query: 44 LRRATWVELKILFRLAAPAVVVYLLNNVISMSTQIYCGHLGNLELAASSLGNTGIQVFAY 103 L+R W+E+K ++ +A PA+ + + ++ +Q + GH+G+LELAA SL T + F Sbjct: 32 LKRRVWIEIKKMWLVAGPAIFTRVASFGTNVVSQAFIGHIGSLELAAFSLVFTVLVRFGN 91 Query: 104 GLMLGMGSAVETLCGQAYGAHKYEM 128 G++LGM SA+ETLCGQ++GA +Y M Sbjct: 92 GILLGMASALETLCGQSHGAKQYNM 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158355803 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 156 1e-40 >Contig31581 Length = 128 Score = 156 bits (395), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGM 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 156 bits (395), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 76/77 (98%) Query: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 137 IQKESTLHLVLRLRGGF 153 IQKESTLHLVLRLRGG Sbjct: 61 IQKESTLHLVLRLRGGI 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1582 (391 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5016 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5841 193 2e-51 >Contig5841 Length = 211 Score = 193 bits (491), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 118/211 (55%), Positives = 135/211 (63%), Gaps = 11/211 (5%) Query: 1 MADKHQQVYPLAPSN-GYTRSDGESL-SEDELKRKKRIKCFAYIGIFIVFQMAVGAVFGL 58 MA+K QQ YP AP+N GY RSD ESL S DELKRKKRIK Y+ IFIVFQ+ V V L Sbjct: 1 MAEKTQQAYPAAPANHGYQRSDAESLLSADELKRKKRIKLAIYVAIFIVFQIIVITVISL 60 Query: 59 TVLKVKTPKVRL-DXXXXXXXXXXXXXXXXXXFNTQIRVKNTNWGPYKFDEGVVTFKYQG 117 TV+KVKTPKVRL + F TQI VKNTNWGPYKFD VTF Y+G Sbjct: 61 TVMKVKTPKVRLGNINVQELNSIPATPSFDTKFTTQINVKNTNWGPYKFDASSVTFLYKG 120 Query: 118 TPVGTFTVPKGKAGMRGTKKIDASV--------SLNTAALNSSGELTLTSEAKLTGKVTL 169 VG ++PK KAGM TKKI V N + SSG LTL S AKL GKV L Sbjct: 121 ATVGQVSIPKSKAGMLSTKKITVEVSLSSSALGGSNLGSELSSGVLTLNSAAKLNGKVEL 180 Query: 170 MFIMKKKKSASMNCTIQIDVSGQTVKSVVCK 200 M IMKKKKS++M+CTI D+S +T+KS+ CK Sbjct: 181 MLIMKKKKSSTMDCTIAFDLSSKTLKSLRCK 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2866 (330 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 192 7e-51 >Contig7384 Length = 326 Score = 192 bits (488), Expect = 7e-51, Method: Compositional matrix adjust. Identities = 114/312 (36%), Positives = 162/312 (51%), Gaps = 9/312 (2%) Query: 23 ESNEEDPGLVMNFYSDSCPQAEEIVREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDAXX 82 + E + LV NFYS SCP E IV + V + T + LR HDC V+ CDA Sbjct: 18 QGKESEGQLVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEGCDASI 77 Query: 83 XXXXXXXXXXEKEMDR-SFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLG 141 + D S F + + K+A+E +CPGVVSC+DIL ++AR+ VV G Sbjct: 78 IIASPNGDAEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAG 137 Query: 142 GPFIPLKTGRRDGRRSRAEILEEYLPDHNESMSTVLEKFSAMGIDTPGVVALLGAHSVGR 201 GP P++ GRRDG S+A + LP+ +++ + F+ + V+AL GAH++G Sbjct: 138 GPSFPVELGRRDGLISKASRVAGNLPEPTFNLNQLTTMFAKHNLSLTDVIALSGAHTLGF 197 Query: 202 THCVKLVHRLY-----PEVDPALNPDHVPHMLKKCPDAIPDPKAVQYVRNDRGTPMIFDN 256 +HC + RLY VDP+LNPD+ ++ CP A+ DP V + D TP FDN Sbjct: 198 SHCNRFSDRLYNFSPSSTVDPSLNPDYAKQLMATCPIAV-DPNIVMTL--DPDTPFTFDN 254 Query: 257 NYYRNILDNKGLMMVDHQLATDKRTKPYVKKMAKSQDYFFKEFTRAFTILSENNPLTGDK 316 YYRN++ KGL+ D L +D ++ V A + D F F A L TG++ Sbjct: 255 AYYRNLVAGKGLLSSDQVLFSDSASRSTVLNFANNADNFNGAFVTAMRKLGRVGVKTGNQ 314 Query: 317 GEIRQQCNVANK 328 GEIR+ C N Sbjct: 315 GEIRRDCTTFNS 326 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77980463 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig198 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18203 234 7e-64 >Contig18203 Length = 221 Score = 234 bits (596), Expect = 7e-64, Method: Compositional matrix adjust. Identities = 114/161 (70%), Positives = 134/161 (83%), Gaps = 1/161 (0%) Query: 1 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60 MGV+TYE EF S IP P+LFKAF+LDADNLIPK+APQAVK EILEG+GG GTIKK+TFG Sbjct: 61 MGVFTYETEFISVIPPPRLFKAFILDADNLIPKLAPQAVKGIEILEGNGGVGTIKKVTFG 120 Query: 61 EGSHYGYVKHKIHSIDKENHTYSYSLIEGDA-LSDNIEKIDYETKLVSAPHGGTVIKTTS 119 EGS G+VKH+I IDK+N YSY+LIEGD LSD IEK+ YETKLV++P GG+++K+TS Sbjct: 121 EGSQLGFVKHRIDGIDKDNFVYSYTLIEGDGLLSDKIEKVAYETKLVASPDGGSIVKSTS 180 Query: 120 KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160 YH KGDVEIKEE VKAGKE+AS LFKL+E YL +P YN Sbjct: 181 HYHAKGDVEIKEEQVKAGKEQASGLFKLVESYLLANPDAYN 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig268 (394 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6285 745 0.0 >Contig6285 Length = 393 Score = 745 bits (1924), Expect = 0.0, Method: Compositional matrix adjust. Identities = 363/393 (92%), Positives = 369/393 (93%), Gaps = 1/393 (0%) Query: 3 LETFLFTSESVNEGHPDKLCDQISDAVLDACLAQDADSKVACETCTKTNMVMVFGEITTK 62 +ETFLFTSESVNEGHPDKLCDQISDAVLDACL QD DSKVACETCTKTNMVMVFGEITTK Sbjct: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLTQDPDSKVACETCTKTNMVMVFGEITTK 60 Query: 63 ANVDYEKIVRDTCREIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA 122 ANVDYEKIVRDTCR IGFVS DVGLDADNCKVLVNIEQQSPDIAQGVHGH +KRPEEIGA Sbjct: 61 ANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFSKRPEEIGA 120 Query: 123 GDQGHMFGYATDETEELMPLSHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTVEYFNDN 182 GDQGHMFGYATDET ELMPL+HVLATKLGAKLTEVRKNGTCAWLRPDGKTQVT+EYFND Sbjct: 121 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTIEYFNDK 180 Query: 183 GAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 242 GAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI Sbjct: 181 GAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 Query: 243 GGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPTKVDRSGAYIVRQAAKSIVASGLAR 302 GGPHGDAGLTGRKIIIDTY KDPTKVDRSGAYIVRQAAKSIVA+GLAR Sbjct: 241 GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 Query: 303 RCIVQVSYAIGVAEPLSVFVDSYGTGKIPDKEILKIVKETFDFRPGMIAINLDLKR-GNG 361 RCIVQVSYAIGV EPLSVFVDSYGTGKIPDKEILKIVKETFDFRPGMI+INLDLKR GNG Sbjct: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKETFDFRPGMISINLDLKRGGNG 360 Query: 362 RFLKTAAYGHFGRDDADFTWEVVKPLKWDKVQA 394 RFLKTAAYGHFGRDD DFTWEVVKPLKWDK QA Sbjct: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1399 (143 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7583 181 5e-48 >Contig7583 Length = 376 Score = 181 bits (458), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 88/160 (55%), Positives = 113/160 (70%), Gaps = 19/160 (11%) Query: 1 MREESKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPSHS------------------- 41 R ESKK TL+LVDME SYLTVDFFR+LPQ+++ GNP + Sbjct: 215 FRNESKKTTLRLVDMESSYLTVDFFRRLPQEMENTGNPGNPGKPGSTPAGRPGTTPAPAP 274 Query: 42 LFDRYNDSYLRRIGSNVLAYVNMVCASLRNSIPKSVVYCQVREAKRSLLDRFFTDMGKLD 101 DRY++ + RRIGSNV +YV MV +LRN+IPK+VV+CQV+EA SLL+ F+ +GK + Sbjct: 275 AMDRYSEGHFRRIGSNVSSYVGMVSETLRNTIPKAVVHCQVKEANTSLLNHFYIQIGKRE 334 Query: 102 AKQLSSLLNEDPAVMERRSALAKRLELYRSAQAEMDTVAW 141 AK LS LL+EDPA+MERR AKRLELY+SA+ E+D+VAW Sbjct: 335 AKHLSQLLDEDPALMERRHQCAKRLELYKSARDEIDSVAW 374 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372649 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3495 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89543621 (107 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2143 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158364149 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 52024425 152 2e-39 >52024425 Length = 183 Score = 152 bits (384), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 71/83 (85%), Positives = 78/83 (93%), Gaps = 1/83 (1%) Query: 27 PFTGLKSASAFPITRKTNSDITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTSESLA 86 PFTGLKS+SAFP+TRK+N DITS+ SNGGRVQCMQVWPP+GLKKFETLSYLPPL+SESLA Sbjct: 29 PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA 87 Query: 87 KEVDFLLRNKWVPCLEFELEKGF 109 KEVD+LLR WVPCLEFELE GF Sbjct: 88 KEVDYLLRKNWVPCLEFELEHGF 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158352558 (141 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2063 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158360568 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5998 150 5e-39 >Contig5998 Length = 107 Score = 150 bits (379), Expect = 5e-39, Method: Compositional matrix adjust. Identities = 77/108 (71%), Positives = 81/108 (75%), Gaps = 1/108 (0%) Query: 1 MAMVKFVXXXXXXXXXISMLQTMVMAXXXXXXXXXXXXQYGPGSLKSYQCPSQCTRRCSK 60 MAM K V ISM T VMA YGPGSLKSYQCPSQCTRRCS+ Sbjct: 1 MAMAKLVCFLLLALLGISMAATQVMAKEQARNQLDSGG-YGPGSLKSYQCPSQCTRRCSQ 59 Query: 61 TQYHKPCMFFCQKCCSKCLCVPPGFYGNKAVCPCYNNWKTKEGGPKCP 108 TQYHKPCMFFCQKCC+KCLCVPPGFYGNKAVCPCYNNWKT++GGPKCP Sbjct: 60 TQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 285809339 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89548891 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3804 (391 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9034 478 e-137 >Contig9034 Length = 386 Score = 478 bits (1230), Expect = e-137, Method: Compositional matrix adjust. Identities = 246/391 (62%), Positives = 276/391 (70%), Gaps = 5/391 (1%) Query: 1 MCGGAIISGFIPPTRSRRVTADFLWPDLXXXXXXXXXXXXXXPLRSEIFGLDDDFEADFQ 60 MCGGAIIS FI P RSRR+TAD+LWPDL PL+SEI LDDDFEADFQ Sbjct: 1 MCGGAIISDFIAPVRSRRLTADYLWPDLKKPSSGKRLSK---PLKSEIVDLDDDFEADFQ 57 Query: 61 EFKXXXXXXXXXXXXXSKPFAFSAGKPSPAARGPKTVKSVECNSQAEKSAKRKRKNQYRG 120 EFK SKP AFSAG PS ARG VKSVE + QAEKSAKRKRKNQYRG Sbjct: 58 EFKDESDVDEDDEMVDSKPSAFSAGNPS-FARGSTAVKSVEFDGQAEKSAKRKRKNQYRG 116 Query: 121 IRQRPWGKWAAEIRDPRKGVRVWLGTFNTXXXXXXXXXXXXXXIRGKKAKVNFPEEAPRA 180 IRQRPWGKWAAEIRDPRKGVRVWLGTFNT IRGKKAKVNFPEE P A Sbjct: 117 IRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEETPCA 176 Query: 181 STKRAVKANPQKVLPKTNLDNMQSNLNQNVNFVNGSDQEYYNSMSFLEEKPQTNNFGYMD 240 S KR++K NPQK++ KTNL+ QSN NQN NFVN S ++YY+++ FL+EKP NNF YM Sbjct: 177 SAKRSIKENPQKLIAKTNLNGTQSNPNQNFNFVNDSSEDYYSALGFLDEKPTMNNFRYMS 236 Query: 241 SVLTNGDFGMKSSTVADPAALYFSSDQGSNSFDCSDFGWGEQGSRTPEIXXXXXXXXXXX 300 + N D +KSS ++ A YFSSDQGSNSFDCSDFGWGEQGS+TPEI Sbjct: 237 TFPANEDVALKSSVPSENAPFYFSSDQGSNSFDCSDFGWGEQGSKTPEISSVISSVMEES 296 Query: 301 XXXXXXXDANPTKKLKANPEGLVPAENNVAPKTLSEELSAFEMKYCQTPYLEGSWDTSID 360 D+NPTKK+K N + L P E+N KTLS+ELSAFEMKY QTPYL+ SWD S+D Sbjct: 297 DNSPFLEDSNPTKKMKPNSQDLEPPEDNSG-KTLSDELSAFEMKYFQTPYLDESWDASVD 355 Query: 361 TFLNGDMTQDGCNPVDLWSFDDLPSMAGGVF 391 FLNGD TQDG NP+DLWSFDDLP++ GGVF Sbjct: 356 AFLNGDATQDGGNPMDLWSFDDLPAIVGGVF 386 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158363939 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3714 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158367455 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5722 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3643 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24131 120 4e-29 >Contig24131 Length = 311 Score = 120 bits (300), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 88/241 (36%), Positives = 124/241 (51%), Gaps = 30/241 (12%) Query: 2 GPVLSSHPINIYLIWYGRWSLPQKLLIKDFLLSISTTA---APSPSVAEWWRTVSLY--- 55 GP+LS I I LIWYG + QK ++ DF+ S+++++ P PSVA WW+T Y Sbjct: 54 GPLLSGK-ITINLIWYGNFKPSQKAIVSDFISSLASSSPSKTPQPSVAAWWQTTEKYYHL 112 Query: 56 TDQTGANVSRSVVVAGEHADVKYSQGKALTRLSVQQVIGNAVRSAPFPADHKHGIYLVLT 115 T ++ S S+ + + D YS GK+LT +Q++ A + D K+ I +VLT Sbjct: 113 TSNKKSSNSLSLSLGRQILDQSYSLGKSLT---TKQIVALAAK-----GDQKNAINVVLT 164 Query: 116 SDDVTMQDFCRAVCGFHYFTFPSM-VGYT-------LPYAWIGNSAKQCPEVCAYPFALP 167 S DV + FC CG H S G+T Y W+GNS QCP CA+PF P Sbjct: 165 SADVAVDGFCMNRCGTHGSASGSFKTGHTKGSKNSKFAYIWVGNSETQCPGQCAWPFHQP 224 Query: 168 AYMGGGGPGA--LSPPNKDVGVDGMISVIGHELAELSSNPLVNAWYAGEDPTAPTEIGDL 225 Y GP + L PN DVG+DGM+ + +A ++NP N ++ G AP E Sbjct: 225 IY----GPQSPPLVAPNNDVGLDGMVINLASLMAGTATNPFGNGYFQGP-AEAPLEASSA 279 Query: 226 C 226 C Sbjct: 280 C 280 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1663 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1990 (354 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11077 223 4e-60 >Contig11077 Length = 317 Score = 223 bits (568), Expect = 4e-60, Method: Compositional matrix adjust. Identities = 129/306 (42%), Positives = 178/306 (58%), Gaps = 20/306 (6%) Query: 41 KHQKVYNGIGEEETRFQIFKDNLKFVDEHNAENRSYKVGMNAFADLTNQEYRARFLGTRP 100 ++ K Y + E + R++IF +N K + N + SY + +N FAD + +E+ LG Sbjct: 24 RYGKKYESVEEMKLRYEIFLENKKLIRSTNRKGLSYTLAVNRFADWSWEEFARHRLGAAQ 83 Query: 101 DPKRRVMKAKNPSLRYVVLPDDKLPESVDWRALGAVNPIKNQGSCGSCWAFSTVAAVEGI 160 + L D LPES +W+ G V P+K+QG CGSCW FST A+E Sbjct: 84 NCSATTKGNHK-------LTDAVLPESKNWKEEGIVTPVKDQGHCGSCWTFSTTGALEAA 136 Query: 161 NKIATGELVSLSEQELVDCDRKY-NAGCNGGLMDYAFEFIIKNGGMDTESDYPYKAVNQQ 219 A G+ +SLSEQ+LVDC + N GCNGGL AFE+I NGG+DTE+ YPY V+ Sbjct: 137 YVQAFGKQISLSEQQLVDCAGDFNNNGCNGGLPSQAFEYIKYNGGLDTEAAYPYVGVDGA 196 Query: 220 CDASLENNKVVSIDGYEDVPAFNEEALKKAVAH-QPVSVAIEAGGVALQLYDSGVFTGE- 277 C S EN V +D ++ EE LK AVA +PVSVA + + + Y SGV+T + Sbjct: 197 CKFSSENVGVQVVDSV-NITLGAEEELKHAVAFVRPVSVAFQVVQ-SFRFYKSGVYTSDT 254 Query: 278 CGSA---LDHGVVAVGYGTENGVDYWLVRNSWGTNWGEGGYFKIERNVKSTYTGKCGIAM 334 CGS+ ++H V+AVGYG E+GV +WL++NSWG +WG+ GYFK+E CG+A Sbjct: 255 CGSSSMDVNHAVLAVGYGVEDGVPFWLIKNSWGQSWGDNGYFKMEYG-----KNMCGVAT 309 Query: 335 EASYPT 340 ASYP Sbjct: 310 CASYPV 315 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig449 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7532 202 3e-54 >Contig7532 Length = 295 Score = 202 bits (514), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 87/136 (63%), Positives = 113/136 (83%) Query: 47 GELLHMKLDNYSGAGFSSKNKYMFGKVTVQIKLVEGDSAGTVTAFYMSSDGPLHNEFDFE 106 G+LL + LD SG+GF SKN+Y+FG++ +QIKLV G+SAGTVTA+Y+SS+GP H+E DFE Sbjct: 50 GQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSEGPTHDEIDFE 109 Query: 107 FLGNTTGEPYSVQTNIYINGVGNREQRLDLWFDPTKDFHSYSIFWNQRQVVFLVDETPIR 166 FLGN+TGEPY++ TN++ G GNREQ+ LWFDPTK FH+YSI WN ++++FLVD PIR Sbjct: 110 FLGNSTGEPYTLHTNVFSQGKGNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIR 169 Query: 167 VHTNMESKGVPFPKDQ 182 V N+ES GVPFPK+Q Sbjct: 170 VFNNLESAGVPFPKNQ 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3225 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5857 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89552570 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5766 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4859 (544 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3999 (397 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2950 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25232 160 2e-41 >Contig25232 Length = 273 Score = 160 bits (404), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 80/202 (39%), Positives = 123/202 (60%), Gaps = 13/202 (6%) Query: 14 KVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQER 73 K+VL+GD G GKS+L+ RF + +F +STIG F ++++ V+D VK +IWDTAGQER Sbjct: 85 KLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQER 144 Query: 74 YRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLR 133 Y ++ YYRGA A++VYD+T +FE ++W+ EL+ + N+V+ L GNKADL R Sbjct: 145 YHSLAPMYYRGAAAAIIVYDLTNQASFERAKKWVLELKSQGNPNMVMALAGNKADLVEAR 204 Query: 134 AVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEVGDDPAAVPK 193 V+ EDA+++A+ FF+ETSA + NV + F E+ ++ +V P P Sbjct: 205 KVAAEDAQSYAQENGLFFLETSAKTADNVNDIFYEIAKRLPRV----------QPVQNPA 254 Query: 194 GQTINVGGKDDVSAIKKAGCCS 215 G + + V++ + CCS Sbjct: 255 GMVLVDRPSERVAS---SSCCS 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2686 (408 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4694 (351 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18083 357 e-100 >Contig18083 Length = 316 Score = 357 bits (917), Expect = e-100, Method: Compositional matrix adjust. Identities = 161/298 (54%), Positives = 220/298 (73%) Query: 41 SDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTARKFFAQPLEEKRKIRRDE 100 S+ KA+E L +IG AC+ WGFF VINHGVP ++R ++ +RKFFA PLEEK+K+ R+ Sbjct: 5 SNSKAVEELAAKIGEACRTWGFFTVINHGVPSDIRRRIMEASRKFFALPLEEKKKVSREA 64 Query: 101 KCVVGYYDTEHTKNVRDWKEVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREV 160 G+++ EH+K+ +DWKEVYDF V + L+P+S EPDD E W+ WPEN + RE Sbjct: 65 HNTAGFHNDEHSKDFKDWKEVYDFYVNDGMLMPASHEPDDPEIVPWYTPWPENLSKFRET 124 Query: 161 MEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQTSFIRLNHYPPCPSPELALGVGR 220 E+Y + EKL L+ L++LSLGLP R GYF++Q SF RLN+Y PCP P+L LG G Sbjct: 125 CEEYGRACEKLFFNLLELVSLSLGLPPTRLHGYFENQASFARLNYYAPCPKPDLVLGTGG 184 Query: 221 HKDGGALTVLAQDEVGGLEVKRKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHR 280 H+D ALTVLAQ++V GL+V RK+DG W+RV+P P++++INVGDV+QVWSND YESVEHR Sbjct: 185 HRDPSALTVLAQEDVEGLDVLRKSDGAWVRVKPVPDSFVINVGDVLQVWSNDLYESVEHR 244 Query: 281 VMVNSEKERFSVLFFLNPAHYTEVKPLEELTNKQNPAKYTPYSWGKFLTLRKLSNFKK 338 MV++E ER+S+ F +P+H +KPL+EL ++++PAKY Y GK+L LR +N+KK Sbjct: 245 AMVHAETERYSIPIFFHPSHDITMKPLDELVDERSPAKYPEYKAGKWLNLRMFNNYKK 302 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4398 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17769 233 2e-63 >Contig17769 Length = 297 Score = 233 bits (593), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 116/214 (54%), Positives = 146/214 (68%), Gaps = 22/214 (10%) Query: 1 DDFHSFVHGRLPYNLLKPDHVLRGLLLSLPVRKVIFTNSDKNHTITVLKRLGIEDCFESI 60 D++HSFVHGRLPY +KPD VLR LLL+LP RK+IFTN+DK H L RLG+ED FE I Sbjct: 84 DEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFTNADKIHAAKALSRLGLEDIFEGI 143 Query: 61 ICFETLNPTNSADGSADAEETDFV---------------------QQPNTDAVTPRSPVI 99 ICFETLNP + S D ++ +FV PN + P++P++ Sbjct: 144 ICFETLNPIHKNTVSDDEDDIEFVGLSSTTTTTSSSQIFDIIGHFATPNPTSKLPKTPIV 203 Query: 100 CKPFENAYVEAFKIANINPQRTLFFDDSIRNLETAKQVGLQTVWVGTSHRTKDVDHALES 159 CKP E+A A KIANINPQRTLFF+DS+RN++ K+VGLQTV VGTS R K D+ALES Sbjct: 204 CKPSEDAIERALKIANINPQRTLFFEDSVRNIQAGKRVGLQTVLVGTSQRVKGADYALES 263 Query: 160 IHNMREALPELW-AEQSENVIYSREVAIETPVEA 192 IHN+REA+PELW A++ V YS ++A+ET V A Sbjct: 264 IHNLREAIPELWEADRKSKVGYSGKIAVETSVTA 297 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158354627 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89541379 (113 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46990835 66 2e-13 >46990835 Length = 192 Score = 65.9 bits (159), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Query: 1 MGTNLESSYSMCQLAHPLLKASGAGKIVLISSIAGVVSVGGCDSIYSASK 50 M TNLES+Y +CQL+HPLLKASG+ IVL+SSIAGVVS+ +IYSA+K Sbjct: 106 MSTNLESAYHLCQLSHPLLKASGSANIVLLSSIAGVVSL-NIGTIYSATK 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1721 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3700 (476 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23352 746 0.0 >Contig23352 Length = 437 Score = 746 bits (1927), Expect = 0.0, Method: Compositional matrix adjust. Identities = 357/439 (81%), Positives = 393/439 (89%), Gaps = 2/439 (0%) Query: 1 MASTVSTVGAVNRTXXXXXXXXXXXXXXXXXFLGSSLKKVNNTRLSYQKTVSAGNLRITA 60 MA+ VST+G+VNR FLGSSLKKVN +R + K VS+G+LRI A Sbjct: 1 MATAVSTIGSVNRAPPNLNGSSSSASVPSSTFLGSSLKKVN-SRFTNSK-VSSGSLRIVA 58 Query: 61 EIDETKQSKTDKWKGLAYDISDDQQDITRGKGMVDTVFQAPSGTGTHNPIMSSYDYVSTG 120 +DE KQ+ D+WKGLA+D SDDQQDITRGKG VD++FQAP G+GTH IMSSY+Y+STG Sbjct: 59 SVDEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYISTG 118 Query: 121 LRTYNLDNNMDGFYIAPAFMDKLVVHITKNFMSLPNIKIPLILGIWGGKGQGKSFQCELV 180 LR YN DNNMDG+YIAPAFMDKLVVHITKNFM+LPNIK+PLILGIWGGKGQGKSFQCELV Sbjct: 119 LRQYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCELV 178 Query: 181 FAKMGITPIMMSAGELESGNAGEPAKLIRQRYREASDIIRKGKMCALFINDLDAGAGRMG 240 FAKMGI+PIMMSAGELESGNAGEPAKLIRQRYREA+DIIRKGKMCALFINDLDAGAGR+G Sbjct: 179 FAKMGISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGRLG 238 Query: 241 GTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEDNARVPIIVTGNDFSTLYAPLIRDG 300 GTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKE+N RVPIIVTGNDFSTLYAPLIRDG Sbjct: 239 GTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRDG 298 Query: 301 RMEKFYWAPTREDRIGVCIGIFKTDNIPEEDVVKIVDTFPGQSIDFFGALRARVYDDEVR 360 RMEKFYWAPTREDRIGVCIGIF++DN+ +ED+VK+VDTFPGQSIDFFGALRARVYDDEVR Sbjct: 299 RMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEVR 358 Query: 361 KWISGVGVDGIGKKLVNSKEGLPTFEQPKMTLEKLLGYGNMLVQEQDNVKRVQLAETYLS 420 KWI+GVGVD IGKKLVNSKEG PTFEQPKMT+EKLL YGNMLVQEQ+NVKRVQLA+ YLS Sbjct: 359 KWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYLS 418 Query: 421 QAALGDANQDSIKRGDFYG 439 +AALGDAN D++ G FYG Sbjct: 419 EAALGDANSDAMNTGTFYG 437 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158358373 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89558552 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3886 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5614 (75 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158353901 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12578 129 4e-32 >Contig12578 Length = 204 Score = 129 bits (323), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 73/149 (48%), Positives = 94/149 (63%) Query: 55 ADESKAVAIVEKPCEPAEEKKSKEVSDRDAVLARVETEKKISLINAWEESEKSKVENKAH 114 D+ KA+A+V K E +K S DRD LA +E EK +S I AWEESEK+K ENKA Sbjct: 56 GDDVKALAVVNKVPETLVKKASGGSIDRDIALAGLEKEKSMSFIRAWEESEKTKAENKAQ 115 Query: 115 KKLSVVGSWENTKKASXXXXXXXXXXXXXXXXXXXXXQMKNKIALIHKAAEEKRALIEAK 174 KKLS V +WE+++KA+ +MKNK+AL+ K A+EKRA++ A+ Sbjct: 116 KKLSDVTAWESSRKAAVEAKLRSIEEQLEKKKAQYAEKMKNKVALLQKQADEKRAMVLAQ 175 Query: 175 RAEDLLKAEENAAKYRATGKAPKKLLSFF 203 + E+LLKAEE AAKYRATG PKK L F Sbjct: 176 KGEELLKAEETAAKYRATGSIPKKFLGCF 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77982879 (292 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359219 (59 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig702 (207 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3141 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig582 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1231 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2700 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9527 382 e-108 >Contig9527 Length = 247 Score = 382 bits (981), Expect = e-108, Method: Compositional matrix adjust. Identities = 185/201 (92%), Positives = 189/201 (94%) Query: 1 MSAEWMPGQPRPPYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILV 60 MSAEWMPG+PRPPYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILV Sbjct: 47 MSAEWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILV 106 Query: 61 PEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPE 120 PEALGLGNWVKAQEWAA+PGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPE Sbjct: 107 PEALGLGNWVKAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPE 166 Query: 121 KKKYPGGAFDPLGYSKDPXXXXXXXXXXXXNGRLALLAFVGFVVQQSAYPGTGPLENLAT 180 KKKYPGGAFDPLGYSKDP NGRLALLAFVGFVVQQSAYPGTGPLENLAT Sbjct: 167 KKKYPGGAFDPLGYSKDPKKFEEYKVKEVKNGRLALLAFVGFVVQQSAYPGTGPLENLAT 226 Query: 181 HLADPWHNNIGDIIIPKGLLP 201 HLADPWHNNIGD+IIPKG+LP Sbjct: 227 HLADPWHNNIGDVIIPKGILP 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3170 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372858 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1803 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542992 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158378696 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20275 328 4e-92 >Contig20275 Length = 206 Score = 328 bits (841), Expect = 4e-92, Method: Compositional matrix adjust. Identities = 160/174 (91%), Positives = 169/174 (97%) Query: 1 MIYAHFCGSWGHYTCLAWLPTYFSEELNLNLTEAAWVSILPPLASIFVNTIASQIADNLI 60 MIYAHFCGSWGHYTCLAWLPTYFSEELNLNLTEAAWVSILPPLASIFV +IASQ AD+LI Sbjct: 1 MIYAHFCGSWGHYTCLAWLPTYFSEELNLNLTEAAWVSILPPLASIFVTSIASQFADSLI 60 Query: 61 SNGVQTTTVRKICQTIAFLSPAACMTLSSLDLGLPHWEVVGILTAGLALSSFAISGLYCT 120 S GVQTTTVRK+CQTIAFLSPAACMTLSSLDLGLPHWEVVGILT GLALSSFA+SG+ CT Sbjct: 61 STGVQTTTVRKVCQTIAFLSPAACMTLSSLDLGLPHWEVVGILTGGLALSSFALSGMDCT 120 Query: 121 HQDISPEYASILLGITNTVGAVPGIVGVALTGYLLDSTHSWSMSLFIPSIFFYL 174 HQD+SPEYASILLGITNTVGAVPGI+GVALTG+LLDSTHSWS+SLFIPSIFFYL Sbjct: 121 HQDMSPEYASILLGITNTVGAVPGIIGVALTGFLLDSTHSWSISLFIPSIFFYL 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57895818 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25288 77 8e-17 >Contig25288 Length = 324 Score = 77.0 bits (188), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 38/75 (50%), Positives = 49/75 (65%), Gaps = 1/75 (1%) Query: 1 MFVASQEKFHAEVDKNYWKAVADLIPNEVPAIEK-RGRKDQEXXXXXXXXXXXXXXXXTE 59 +F+ +QE FH DK WKA+A+LIP+EVP IEK RG+KDQE T+ Sbjct: 168 LFLVNQENFHKNADKQSWKAIAELIPHEVPNIEKRRGKKDQEKKPGIQVIQGPKPGKPTD 227 Query: 60 LSRMRQILLKLKHNT 74 LSR+RQ+L+KLKH T Sbjct: 228 LSRLRQVLVKLKHKT 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig469 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2665 (282 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3127 (308 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13757 110 4e-26 >Contig13757 Length = 116 Score = 110 bits (274), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 55/63 (87%), Positives = 58/63 (92%) Query: 18 WERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSSADRSTPNNRNTLGRPVPSRPW 77 WERAGSSSGPAPFKPPSAGSTSDVVEASGTA+PGEIV S+DR+T NRN L RPVPSRPW Sbjct: 17 WERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVPSSDRNTAANRNALARPVPSRPW 76 Query: 78 EQN 80 EQN Sbjct: 77 EQN 79 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158369292 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2623 (334 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1245 (358 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11077 571 e-165 >Contig11077 Length = 317 Score = 571 bits (1472), Expect = e-165, Method: Compositional matrix adjust. Identities = 270/317 (85%), Positives = 289/317 (91%) Query: 42 LQDQFVQVLGHGCHVHSFARFAFRYEKKYESLEEMRRRFEIFAENKKLIRSTNRKGLSYK 101 +++Q VQVLG HV SFARFA RY KKYES+EEM+ R+EIF ENKKLIRSTNRKGLSY Sbjct: 1 MEEQVVQVLGSSHHVLSFARFAHRYGKKYESVEEMKLRYEIFLENKKLIRSTNRKGLSYT 60 Query: 102 LGVNRFADWTWEEFQRHRLGAAQNCSATTKGNHKLTDAVPPLSKNWRDEGIVTPVKDQGH 161 L VNRFADW+WEEF RHRLGAAQNCSATTKGNHKLTDAV P SKNW++EGIVTPVKDQGH Sbjct: 61 LAVNRFADWSWEEFARHRLGAAQNCSATTKGNHKLTDAVLPESKNWKEEGIVTPVKDQGH 120 Query: 162 CGSCWTFSTTGALEAAYAQAFGKQISLSEQQLVDCAGAFNNFGCSGGLPSQAFEYVKYNG 221 CGSCWTFSTTGALEAAY QAFGKQISLSEQQLVDCAG FNN GC+GGLPSQAFEY+KYNG Sbjct: 121 CGSCWTFSTTGALEAAYVQAFGKQISLSEQQLVDCAGDFNNNGCNGGLPSQAFEYIKYNG 180 Query: 222 GLDTEEGYPYTAKDGACKFSSENVGVQVLDSVNITLGDEEGLKHAVAFVRPVSIAFQVVS 281 GLDTE YPY DGACKFSSENVGVQV+DSVNITLG EE LKHAVAFVRPVS+AFQVV Sbjct: 181 GLDTEAAYPYVGVDGACKFSSENVGVQVVDSVNITLGAEEELKHAVAFVRPVSVAFQVVQ 240 Query: 282 DFRLYKSGVYTSETCGNTPMDVNHAVLAVGYGVENGVPYWLIKNSWGQSWGDNGYFKMEY 341 FR YKSGVYTS+TCG++ MDVNHAVLAVGYGVE+GVP+WLIKNSWGQSWGDNGYFKMEY Sbjct: 241 SFRFYKSGVYTSDTCGSSSMDVNHAVLAVGYGVEDGVPFWLIKNSWGQSWGDNGYFKMEY 300 Query: 342 GKNMCGIATCASYPVVA 358 GKNMCG+ATCASYPVVA Sbjct: 301 GKNMCGVATCASYPVVA 317 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158367214 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4741 (306 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9966 150 2e-38 >Contig9966 Length = 245 Score = 150 bits (380), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 76/102 (74%), Positives = 83/102 (81%) Query: 205 MDPADVKRARRMLXXXXXXXXXXXXKQAQMTDLETQAGQLRVENSALLKQLTDVNHKYDN 264 MDP+DVKRARRML KQAQM++LETQ GQLRVE+S LLK+LTDVN KYDN Sbjct: 1 MDPSDVKRARRMLSNRESARRSRRRKQAQMSELETQVGQLRVEHSGLLKRLTDVNQKYDN 60 Query: 265 SVVDRRILEANIETLRAKVKMAEESVKRKTGINPLLLAMSNV 306 + VD RIL A+IETLRAKVKMAEESVKR TGINPLLLAMSNV Sbjct: 61 AAVDNRILRADIETLRAKVKMAEESVKRVTGINPLLLAMSNV 102 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2632 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20067 194 6e-52 >Contig20067 Length = 133 Score = 194 bits (492), Expect = 6e-52, Method: Compositional matrix adjust. Identities = 94/133 (70%), Positives = 106/133 (79%), Gaps = 2/133 (1%) Query: 1 MSWQQYVDEHLMCDIDGN--SLTAAAILGQDGSVWSQSSNFPQFKPEEIAAIMKDFDQPG 58 MSWQ YVD+HLMCDIDG LTAAAI+G DGSVW++SS+FPQFKPEE+ I KDF++PG Sbjct: 1 MSWQTYVDDHLMCDIDGQGQHLTAAAIIGLDGSVWAKSSSFPQFKPEEMTGINKDFEEPG 60 Query: 59 TLAPTGLFLGGTKYMVIQGEAGAVIRXXXXXXXXXXXXXNQALIIGIYDEPMTPGQCNMV 118 LAPTGL LGGTKYMVIQGE GAVIR QAL+ GIY+EP+TPGQCNMV Sbjct: 61 HLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120 Query: 119 VERLGDYLVEQGL 131 VERLGDYLV+QGL Sbjct: 121 VERLGDYLVDQGL 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158349336 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89552756 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28902 384 e-109 >Contig28902 Length = 208 Score = 384 bits (985), Expect = e-109, Method: Compositional matrix adjust. Identities = 183/189 (96%), Positives = 185/189 (97%) Query: 1 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 60 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR Sbjct: 20 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 79 Query: 61 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLT 120 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKS+MVTEKIDVYSFGIVMWELLT Sbjct: 80 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSNMVTEKIDVYSFGIVMWELLT 139 Query: 121 GDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQKLR 180 GDEPY DMHCASIIGGIVNNTLRPQIP WCDPEWKSLMESCW EP+QRPSFSEISQKLR Sbjct: 140 GDEPYRDMHCASIIGGIVNNTLRPQIPPWCDPEWKSLMESCWAPEPSQRPSFSEISQKLR 199 Query: 181 NMAAAMNVK 189 NMAAAMNVK Sbjct: 200 NMAAAMNVK 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357796 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362734 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91044742 199 2e-53 >91044742 Length = 207 Score = 199 bits (507), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 2/126 (1%) Query: 55 LLRELWVFRSNFGSQAKAMEG--PQGSSSTTVPSIVVYVTVPNKEVGKKLAESLVREKLA 112 L LWV RS FGSQ+ A+ +GSSS TVPSIVVYVTVP++EVGKKLAESLVRE+LA Sbjct: 82 LFTVLWVCRSRFGSQSAAVHSVRMEGSSSATVPSIVVYVTVPSREVGKKLAESLVREQLA 141 Query: 113 ACVNIVPGIQSVYQWEGEVQTDSEELLIIKTRQSLFEALTEHVKSNHPYDVPEVIALPIN 172 ACVN+VPGI+SVYQW+GEVQTDSE+LLIIKTRQSLFE LT HVK+NHPYDVPEVIALPIN Sbjct: 142 ACVNLVPGIESVYQWKGEVQTDSEKLLIIKTRQSLFEGLTAHVKANHPYDVPEVIALPIN 201 Query: 173 AGSLNY 178 AGSL Y Sbjct: 202 AGSLPY 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 260657597 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4178 (303 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89543955 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3840 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24514 96 3e-22 >Contig24514 Length = 181 Score = 95.9 bits (237), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 55/124 (44%), Positives = 69/124 (55%), Gaps = 11/124 (8%) Query: 1 MRTLCDACESAAAIVFCAADEAALCRACDEKVHLCNKLASRHVRVGLATPSA--VPRCDI 58 M+ CD C A VFC ADEAALC ACD +VH NKLAS+H R L PS+ P CDI Sbjct: 1 MKIQCDVCNKDDASVFCTADEAALCDACDHRVHHANKLASKHHRFSLVHPSSKEFPVCDI 60 Query: 59 CENAPAFFYCEIDGSSLCLQCDMVVHVGGK--RTHGRYLVLRQRVQFPGDKPSSNGEDPA 116 C+ AF +C+ D + LC +CD+ +H + R H RYL+ G K S+ Sbjct: 61 CQERRAFLFCQQDRAILCRECDLPIHNANEHTRKHNRYLLT-------GIKLSATSALYK 113 Query: 117 SQPP 120 S PP Sbjct: 114 SSPP 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2977 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1279 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3652 (310 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1075 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3203 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31420 298 3e-83 >Contig31420 Length = 330 Score = 298 bits (764), Expect = 3e-83, Method: Compositional matrix adjust. Identities = 146/184 (79%), Positives = 166/184 (90%), Gaps = 1/184 (0%) Query: 1 MKRLGSSDSLGALISICPTTTADEHSPRNNHVYSRDFQSMLDGLDEEGCVEESGHVAEKK 60 MKRLGSSDSLGA+ISICP T DE SPR+NHVYSR+FQSML+GLDE+GCVEE+G V+EKK Sbjct: 1 MKRLGSSDSLGAMISICPIIT-DEQSPRSNHVYSREFQSMLEGLDEDGCVEEAGRVSEKK 59 Query: 61 RRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDY 120 RRL+VEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQV+VWFQNRRARWKTKQLERDY Sbjct: 60 RRLNVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVSVWFQNRRARWKTKQLERDY 119 Query: 121 GVLKANYDSLKISFDSLQHDNQALHKEIKELKAKFQEENTESNHSVKEEQMALANESSYK 180 GVLKA+YDSLK S+D LQHDN+AL KEIK+LKAKFQE +N SVK+E++ ++SSY+ Sbjct: 120 GVLKADYDSLKCSYDILQHDNEALLKEIKQLKAKFQENTESTNPSVKQEKLLGKDQSSYR 179 Query: 181 MVIE 184 V E Sbjct: 180 AVHE 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5689 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3715 (362 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8381 105 8e-25 >Contig8381 Length = 352 Score = 105 bits (263), Expect = 8e-25, Method: Compositional matrix adjust. Identities = 47/74 (63%), Positives = 60/74 (81%), Gaps = 2/74 (2%) Query: 44 NDQALKVRKPYTITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSHAQK 103 +DQ+ K+RKPYTITK RE WT++EH KFLEAL+L+ R W++IE VG+KT +QIRSHAQK Sbjct: 66 DDQSKKIRKPYTITKSRESWTDQEHDKFLEALQLFDRDWKKIESFVGSKTVIQIRSHAQK 125 Query: 104 FFSKVAKELPGTGE 117 +F KV K+ GT E Sbjct: 126 YFLKVQKK--GTSE 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372035 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig795 (683 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2917 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3406 (450 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29208 272 1e-74 >Contig29208 Length = 288 Score = 272 bits (695), Expect = 1e-74, Method: Compositional matrix adjust. Identities = 145/288 (50%), Positives = 184/288 (63%), Gaps = 5/288 (1%) Query: 131 DSMLGTFKADIKIVDNETISVDGKPIKVVSNRDPLKLPWAEMGIDIVIEGTGVFVDGPGA 190 DS G F I +VDN T+ ++GK IKVVS RDP ++PW + G++ V+E +G+F A Sbjct: 1 DSTHGIFDGSISVVDNSTLEINGKEIKVVSKRDPAEIPWGDYGVEYVVESSGIFTTLEKA 60 Query: 191 GKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHSVADIVSNASCTTNCLAPFVKVLD 250 H + GAKKV+I+AP+ AD P +VVGVNE Y ++ DIVSNASCTTNCLAP KV+ Sbjct: 61 ALHKKGGAKKVVISAPS--ADAPMFVVGVNENTYKPNM-DIVSNASCTTNCLAPLAKVIH 117 Query: 251 EEFGIVKGTMTTTHSYTGDQXXXXXXXXXX-XXXXXXXXNIVPTSTGAAKAVSLVLPQLK 309 EEFGI++G MTT H+ T Q NI+P+STGAAKAV VLP+L Sbjct: 118 EEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELN 177 Query: 310 GKLNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFRKAADGPLKGILAVCDVPLVSV 369 GKL G+A RVPTPNVSVVDL + K + EDV R AADGPL+GIL + +VS Sbjct: 178 GKLTGMAFRVPTPNVSVVDLTCRLEKSS-SYEDVKATIRYAADGPLRGILGYTEEDVVSN 236 Query: 370 DFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA 417 DF SS D+ + + VK+V+WYDNEWGYS RV+DL +A Sbjct: 237 DFVGDSRSSIFDAKAGLALSSSFVKLVSWYDNEWGYSTRVLDLIEHMA 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158377985 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361428 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158360140 (51 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5485 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158370383 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5585 (92 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158372750 (132 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27225 77 1e-16 >Contig27225 Length = 424 Score = 77.0 bits (188), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 42/94 (44%), Positives = 57/94 (60%), Gaps = 3/94 (3%) Query: 36 INREQRPGEQFTQWAFTTLCRLLYFLNTGKPKKLTKQSRRDLRNLWEELQVFKFDLSWVE 95 I +++ FT+WAFT L RLLYFL T K + + LR WEEL+ F+FDL+W+E Sbjct: 289 IKCQRKRSPMFTEWAFTALGRLLYFLKTTKGTDMNVDACEHLRLSWEELESFRFDLAWLE 348 Query: 96 DDFITALGMKDEVER---AKKLREEMNTLDTQRK 126 +ALGMK VER K LR M++L+ + K Sbjct: 349 PHIQSALGMKKFVERELEVKDLRNNMDSLEIEVK 382 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1484 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22793 369 e-104 >Contig22793 Length = 406 Score = 369 bits (946), Expect = e-104, Method: Compositional matrix adjust. Identities = 172/243 (70%), Positives = 208/243 (85%), Gaps = 1/243 (0%) Query: 1 MGDVLIDGKTTGFCAGGCAAIADSGTSLLVGPTTIITELNHAIGATGIVSQECKTVVAEY 60 MGDVLI GK TGFCAGGC AIADSGTSLL GP+T IT++N AIGA+G+VSQECK VV +Y Sbjct: 164 MGDVLIGGKPTGFCAGGCFAIADSGTSLLTGPSTSITKINQAIGASGVVSQECKAVVNQY 223 Query: 61 GDTIIKMILAKD-QPQKICSQIGLCTFDGTRGVSVGIKSVVDENNHKSSAGLSDAMCSAC 119 G TI+ +++A + QP+K+CSQIG+CTFDGTR VS+GI+SVVDE N KSS L DA CSAC Sbjct: 224 GRTILDLLVAHEVQPKKVCSQIGVCTFDGTRSVSMGIESVVDEKNGKSSGILHDASCSAC 283 Query: 120 EMTVVWMQNQLKQNQTQDRILDYVNQLCDRLPSPMGESAVDCAGLSSMPSVSFTIGGKQF 179 EM VVWMQN+LK+N TQDRIL+YVN+LC+++P +G+S VDC LSSMP VSFTIGG+ F Sbjct: 284 EMAVVWMQNELKKNITQDRILNYVNELCEKMPDTLGQSTVDCGKLSSMPPVSFTIGGRAF 343 Query: 180 DLAPEQYVLKVGEGEVAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVFDFGKERIGFA 239 L ++Y+LKVGEG AQCISGFT+LD+P PRGPLWILGD+FMG+YHTVFD+GK R+GFA Sbjct: 344 KLTSDEYILKVGEGAQAQCISGFTSLDIPRPRGPLWILGDIFMGRYHTVFDYGKMRVGFA 403 Query: 240 EAA 242 +AA Sbjct: 404 DAA 406 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89541905 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2208 (408 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359626 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27007 281 6e-78 >Contig27007 Length = 207 Score = 281 bits (720), Expect = 6e-78, Method: Compositional matrix adjust. Identities = 133/180 (73%), Positives = 147/180 (81%) Query: 3 GFKFEEEEFRACCGSTQFAKEMAKASPFSSLEEAVTVARDVWFNKVDVTGWLQAFSAHPQ 62 G KFEEEEF ACC ST+FAKEMA+ASPFSSL+EAVT ARD+WFNKVDV GWLQ+FSAHPQ Sbjct: 2 GLKFEEEEFLACCASTKFAKEMAEASPFSSLDEAVTAARDIWFNKVDVNGWLQSFSAHPQ 61 Query: 63 IGXXXXXXXXXXXAQWSKGEQXXXXXXXXXXXLQELSQWNARYREKFGFVFLICASGKST 122 IG AQWSKGEQ LQEL++WNA+YR+KFGFVFLICASGKS+ Sbjct: 62 IGNSPSPSSHSTSAQWSKGEQATAVATATSSSLQELAEWNAKYRQKFGFVFLICASGKSS 121 Query: 123 DGILAELKKRYPNRPIVEFEIAAKEQMKITELRLAKLFSTKEKVPSTGNVNPSVAAKKVE 182 DGILAELKKRYPNRPIVEFEIAA+EQMKITELRLAKLF+ KE V STGN NP++ AKK E Sbjct: 122 DGILAELKKRYPNRPIVEFEIAAQEQMKITELRLAKLFAAKENVTSTGNKNPTIVAKKAE 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89556940 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3908 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12750 165 6e-43 >Contig12750 Length = 248 Score = 165 bits (418), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 87/246 (35%), Positives = 129/246 (52%), Gaps = 1/246 (0%) Query: 1 MAEEVKAESLMEKIEDKILGHHDSPAPEVVHHDSPR-SMQDKVFRIFGRERPVHHVFGGG 59 M E++ AE L+ I + S + Q R+FGR++PVHH+ GGG Sbjct: 1 MPEKITAEDLLNNIVGTLADKKQKSGSFFGEETSSSVTTQFNFNRLFGRQKPVHHILGGG 60 Query: 60 KLADIFLWRDKKLSGGILGGATVMWXXXXXXXXXXXXXVAHVLIAAITLFFLWSNGLGFI 119 K AD+ LWR+KK+S +L AT++W V LI + FLWSN G I Sbjct: 61 KSADVLLWRNKKISASVLTAATIVWVLFEWLNYHFLTLVGFALILGMLAQFLWSNFSGMI 120 Query: 120 NKSXXXXXXXXXXXXTLLQIVSSITFEINRALVVIRDIASGKDLKQFLSVIAGLWVVSIL 179 N+S + I SI EINR L ++D+A ++KQF+ V+ L + +++ Sbjct: 121 NRSPSKVPRLVLPKDLFVNIAISIGAEINRGLAFVQDVACEGNVKQFIVVVVSLLIAAMI 180 Query: 180 GKSCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKAMFEIKKQYAVFDAKVLSKIPRG 239 G CNFLT+LYI V ++PV YE+Y+ ++D + + +++ Y D VLSKIP+G Sbjct: 181 GSWCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFVYQVLGQLQHNYRKLDTGVLSKIPKG 240 Query: 240 ALKAKK 245 L KK Sbjct: 241 KLSWKK 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2603 (401 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89547331 (69 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3720 (311 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14799 153 4e-39 >Contig14799 Length = 428 Score = 153 bits (386), Expect = 4e-39, Method: Compositional matrix adjust. Identities = 78/182 (42%), Positives = 113/182 (62%), Gaps = 4/182 (2%) Query: 99 GAMFGIWYLLNIYFNIYNKQVLKVYPFPATVTAFQFACGTVMIILMWTLNLYPRPKITRS 158 G F +WYLLN+ FNI NK+V +P+P V+ G V ++ W++ L R I + Sbjct: 124 GFFFFMWYLLNVIFNILNKKVYNYFPYPYFVSVIHLLVGVVYCLVSWSVGLPKRAPIDKE 183 Query: 159 QLATILPLAVAHTMGNLLTNISLGKVTVSFTHTIKAMEPFFTVLFSALLLAERPTIWVVS 218 QLA + P+A H +G++++N+S V VSFTHTIKA+EPFF S +L + + Sbjct: 184 QLALLTPVAFCHALGHVMSNVSFAAVAVSFTHTIKALEPFFNASASQFVLGHHIPLSLWL 243 Query: 219 SLVPIVSGVALASFTEASFNWIGFGSAMASNITNQSRNVLSKKFMAKKEECLDNINLFSV 278 SL P+V GV++AS TE SFNW+GFGSAM SNI R++ SKK M +D+ N+++ Sbjct: 244 SLAPVVIGVSMASLTELSFNWLGFGSAMISNIAFTYRSIYSKKAMTG----MDSTNVYAY 299 Query: 279 IT 280 I+ Sbjct: 300 IS 301 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4073 (314 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57011897 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2827 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57896315 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48285622 225 7e-61 >48285622 Length = 173 Score = 225 bits (573), Expect = 7e-61, Method: Compositional matrix adjust. Identities = 110/130 (84%), Positives = 112/130 (86%), Gaps = 2/130 (1%) Query: 101 PTDRKMRTDRFSYRDAPYXXXXXXXXXXXXXDNLCKNCKRPGHFARECPNVAICHNCSLP 160 P DRK+R+DRFSYRDAPY DNLCKNCKRPGHFARECPNVAICHNC LP Sbjct: 46 PLDRKIRSDRFSYRDAPYRRDGGRRGFSR--DNLCKNCKRPGHFARECPNVAICHNCGLP 103 Query: 161 GHIASECTTKSLCWNCREPGHMASNCPNEGICHTCGKAGHRARDCTAAPMPPGDLRLCNN 220 GHIASECTTKSLCWNCREPGHMASNCPNEGICHTCGKAGHRARDCTA PMPP DLRLCNN Sbjct: 104 GHIASECTTKSLCWNCREPGHMASNCPNEGICHTCGKAGHRARDCTAPPMPPXDLRLCNN 163 Query: 221 CYKQGHIAVD 230 CYKQGHIA D Sbjct: 164 CYKQGHIAAD 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1835 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 263 5e-73 >Contig31581 Length = 128 Score = 263 bits (673), Expect = 5e-73, Method: Compositional matrix adjust. Identities = 128/128 (100%), Positives = 128/128 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGIIEPSLMALARKYNQEKMICRKCYARLHPRAVNCRKKKCGHSNQ 120 IQKESTLHLVLRLRGGIIEPSLMALARKYNQEKMICRKCYARLHPRAVNCRKKKCGHSNQ Sbjct: 61 IQKESTLHLVLRLRGGIIEPSLMALARKYNQEKMICRKCYARLHPRAVNCRKKKCGHSNQ 120 Query: 121 LRPKKKIK 128 LRPKKKIK Sbjct: 121 LRPKKKIK 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4757 (473 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4544 (447 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24826 882 0.0 >Contig24826 Length = 447 Score = 882 bits (2279), Expect = 0.0, Method: Compositional matrix adjust. Identities = 421/436 (96%), Positives = 431/436 (98%) Query: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDAT+PKYS+ARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSRARYDEIVKEVSSYLKK 180 Query: 181 IGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPSDKPLRLPLQD 240 +GYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPSDKPLRLPLQD Sbjct: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETG+IKPGMVVTF PTGLTTEVKSVEMHHEA+QEALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRGYVASNSKDDPAKEAANF AQVIIMNHPGQIG GYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKF 360 Query: 361 GEILTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 E++TKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKAVEKKDPSG 436 VAVGVIK+VEKKDP+G Sbjct: 421 VAVGVIKSVEKKDPTG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2928 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4216 (332 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11002 62 1e-11 >Contig11002 Length = 231 Score = 62.4 bits (150), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 55/197 (27%), Positives = 89/197 (45%), Gaps = 12/197 (6%) Query: 7 RVLVTGAAGQIGYALVPMIARGVMLGADQPVILHLLDIEFAAEALKGVKMELIDAAFPLL 66 +V V GAAG IG L +L P++ HL + A + I+ + Sbjct: 28 KVAVLGAAGGIGQPLA-------LLMKLNPLVSHLSLYDIAGTPGVAADVSHINTRSEV- 79 Query: 67 KGVVATTDVVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKYAAANCK 126 KG + +A G ++ ++ G PRK GM R D+ + N I K +A+ KY N Sbjct: 80 KGYAGEEQLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTTAIAKY-CPNAL 138 Query: 127 VLVVANPANTNALILKEF---APSIPEKNISCLTRLDHNRALGQISERLNVQVSDVKNVI 183 + +++NP N+ I E A EK + +T LD RA + + NV V++V + Sbjct: 139 INMISNPVNSTVPIAAEVLKKAGKYDEKRLFGVTTLDVVRAKTFYAGKANVNVAEVNVPV 198 Query: 184 IWGNHSSSQYPDVNHAT 200 + G+ + P + AT Sbjct: 199 VGGHAGVTILPLFSQAT 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig288 (499 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3447 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4515 (469 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11077 226 7e-61 >Contig11077 Length = 317 Score = 226 bits (575), Expect = 7e-61, Method: Compositional matrix adjust. Identities = 138/321 (42%), Positives = 190/321 (59%), Gaps = 25/321 (7%) Query: 45 SDDEVMSLYERWLAEHGKAYNGLGEKEKRFQIFKDNLKFIDEHNALNLSYKLGLNRFADL 104 S V+S + R+ +GK Y + E + R++IF +N K I N LSY L +NRFAD Sbjct: 11 SSHHVLS-FARFAHRYGKKYESVEEMKLRYEIFLENKKLIRSTNRKGLSYTLAVNRFADW 69 Query: 105 SNDEYRSTFLGTKPRAMNRLSKTKSDRYAPRVGDQ-LPDSVDWRKEGAVTAVKDQGQCGS 163 S +E+ LG A N + TK + ++ D LP+S +W++EG VT VKDQG CGS Sbjct: 70 SWEEFARHRLGA---AQNCSATTKGNH---KLTDAVLPESKNWKEEGIVTPVKDQGHCGS 123 Query: 164 CWAFSTICAVEGINKIVTGDLISLSEQELVDCDKTY-NEGCNGGLMDYAFEFIINNGGID 222 CW FST A+E G ISLSEQ+LVDC + N GCNGGL AFE+I NGG+D Sbjct: 124 CWTFSTTGALEAAYVQAFGKQISLSEQQLVDCAGDFNNNGCNGGLPSQAFEYIKYNGGLD 183 Query: 223 SEDDYPYKGYDSTCDTYRKNARVVSIDSYEDVPTYDEKALKKAVA-NQPIAVAIEGGGRE 281 +E YPY G D C +N V +DS ++ E+ LK AVA +P++VA + + Sbjct: 184 TEAAYPYVGVDGACKFSSENVGVQVVDSV-NITLGAEEELKHAVAFVRPVSVAFQ-VVQS 241 Query: 282 FQLYSSGVFTG-RCGTA---LDHGVAVVGYGTEHGSDYWIVRNSWGDSWGESGYIRME-- 335 F+ Y SGV+T CG++ ++H V VGYG E G +W+++NSWG SWG++GY +ME Sbjct: 242 FRFYKSGVYTSDTCGSSSMDVNHAVLAVGYGVEDGVPFWLIKNSWGQSWGDNGYFKMEYG 301 Query: 336 RNLGNSATGKCGIAMEPSYPV 356 +N+ CG+A SYPV Sbjct: 302 KNM-------CGVATCASYPV 315 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4260 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig403 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26743 298 5e-83 >Contig26743 Length = 696 Score = 298 bits (764), Expect = 5e-83, Method: Compositional matrix adjust. Identities = 157/239 (65%), Positives = 186/239 (77%), Gaps = 5/239 (2%) Query: 2 RQESDTIKPTEQKAPGAKVDLHGREPESSSNFETGEGISTSGFRTDTWPD--LSSFEKSE 59 +QES TIKPTEQK G+K DL R+ ESS NF+T EGISTS F D+WPD L++ KSE Sbjct: 41 KQESHTIKPTEQKTHGSKFDLQDRKLESSPNFDTSEGISTSEFGMDSWPDSSLANVAKSE 100 Query: 60 QHCMAEANQLEKGAELIQNSNEAKEQ--FVDYGWATIGSFDDLDQIFSNDDTIFSHGSLG 117 QHC+AEA QL+K E+ QNSNE KEQ VDYGWA IGSFDDLD+IFSNDDTIF + SLG Sbjct: 101 QHCIAEAIQLDKDGEIFQNSNEGKEQGDIVDYGWANIGSFDDLDRIFSNDDTIFGNVSLG 160 Query: 118 NVDELWSS-RDATNSPIKAFPLTSDSPSCGSGALRNVSEHSQVKTEYVQQDEQAISPVSG 176 N DELWSS RDAT+SPIKAFP++SDSPS SGA+ N SE+ ++KT+Y+Q+D Q+I+P G Sbjct: 161 NADELWSSSRDATDSPIKAFPVSSDSPSFTSGAVTNASEYLEIKTDYIQKDNQSITPGYG 220 Query: 177 TTDYSASHGLQNAPATVDHVEYAVGKSRTTEKEQTVSDLGNSTVTNSYQPAVNSSSSTE 235 DYSAS+GLQNA A +DHVEYA GKS+T EKEQ+ D G ST+TNS A NSSS E Sbjct: 221 KMDYSASYGLQNAHAALDHVEYAGGKSKTMEKEQSDMDTGRSTLTNSSLNAENSSSPNE 279 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1884 (315 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig338 (345 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2102 (485 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5185 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1895 (361 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48279658 294 2e-81 >48279658 Length = 186 Score = 294 bits (752), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 149/176 (84%), Positives = 159/176 (90%), Gaps = 5/176 (2%) Query: 21 SLLDTSSSFHGAPLARVQPLKAASSSNGHGLSVSMSAS--TNAYDLSNFKFEPIKESIVS 78 SLLD SSFHGAP+ R+Q KAA ++NG GLSVSMSA+ T +YDLS FKF+PIKESIVS Sbjct: 13 SLLD--SSFHGAPMVRLQLAKAAPANNG-GLSVSMSANGLTPSYDLSAFKFDPIKESIVS 69 Query: 79 REMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGG 138 REMTRRYMTDMITYADTD GAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGG Sbjct: 70 REMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGG 129 Query: 139 QLFSAMVVRKPAHHFLSELGIDYDEKDDYVVIKHAALFTSTIMSKLLARPNVKLFN 194 QLFSAMVVRKPAH FL+ELGIDYDE+D+YVVIKHAALFTSTIMSKLLARPNVKLF Sbjct: 130 QLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFT 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3040 (280 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7498 119 6e-29 >Contig7498 Length = 333 Score = 119 bits (298), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 74/243 (30%), Positives = 118/243 (48%), Gaps = 13/243 (5%) Query: 51 PHHSLAELAQKHGPLMHLRLGYVDXXXXXXXXXXXQFLKTHDANFSSRPPNSGAKYMAYN 110 PH +L L K+GP+ +G + T+D+ SSRP G K+++Y+ Sbjct: 67 PHITLGALVDKYGPIFTFNIGIHSALVINTWEAAKECFTTNDSIVSSRPATLGIKHLSYD 126 Query: 111 YQDLVFRPYSPRWRQFRKISSVHLFSGKALDDLKHVRQEEVAVLAHAL-------ANAGS 163 + F PY P WR+ RK++S+ L S + L+ LK VR EV + L + GS Sbjct: 127 FAMFGFSPYGPYWRKIRKLTSLELLSNRRLELLKSVRVSEVEMRLKKLYKRWTERKDGGS 186 Query: 164 KV---VNLAQLLNLCTVNALGRVMVGRRVFG--DGSGSDDPKADEFKSMVVEMMVLAGVP 218 V + Q T+N + R++ +RV +G+ +D+ +A ++ + E L G+ Sbjct: 187 SADISVEMKQWFGDLTLNVILRMIAEKRVLNVVNGNSNDEKEARAWQKAMREFFHLVGMF 246 Query: 219 NIGDFIPCLEWLDLQGVASKMKKLHKRFDDFLMAIVEDHKKSTGTAA-HVDMLTTLLSLQ 277 +GD IP L WLDL G MKK K D +M +E+HK+ D + +LS+ Sbjct: 247 VLGDAIPWLWWLDLGGHQKAMKKTAKALDSIVMGWLEEHKQRRAKGQDQQDFMGVMLSVL 306 Query: 278 EDA 280 + A Sbjct: 307 DGA 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158350790 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 86 4e-19 >Contig7384 Length = 326 Score = 86.3 bits (212), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 48/125 (38%), Positives = 64/125 (51%), Gaps = 1/125 (0%) Query: 23 ESNEEDPGLVMNFYSDSCPQAEEIVREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDAXX 82 + E + LV NFYS SCP E IV + V + T + LR HDC V+ CDA Sbjct: 18 QGKESEGQLVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEGCDASI 77 Query: 83 XXXXXXXXXXEKEMDR-SFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLG 141 + D S F + + K+A+E +CPGVVSC+DIL ++AR+ VV G Sbjct: 78 IIASPNGDAEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAG 137 Query: 142 GPFIP 146 GP P Sbjct: 138 GPSFP 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3590 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48414076 101 4e-24 >48414076 Length = 145 Score = 101 bits (251), Expect = 4e-24, Method: Compositional matrix adjust. Identities = 61/116 (52%), Positives = 68/116 (58%), Gaps = 2/116 (1%) Query: 1 MKVIAAYLLAVLGGKTSPTAEDIKTILGAVGAEADEDRIQLLLKEVKGKDITELIASGRE 60 MKV+AAYLLAVLGGK+SP+A D+K ILG+VGAEAD D+I+LLL EVKGKDITELIASGRE Sbjct: 30 MKVVAAYLLAVLGGKSSPSAADLKDILGSVGAEADGDKIELLLAEVKGKDITELIASGRE 89 Query: 61 KLXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 114 KL DDDMGFSLFD Sbjct: 90 KLASVPSGGGGAVAYSAPAAGGGGGAAVPAAAEQKKEEKVEEKEESDDDMGFSLFD 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5093 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5682 290 2e-80 >Contig5682 Length = 246 Score = 290 bits (742), Expect = 2e-80, Method: Compositional matrix adjust. Identities = 157/228 (68%), Positives = 172/228 (75%), Gaps = 25/228 (10%) Query: 30 VVMMRKRVFSETESQITTDDESSACVDLKLNLSS----------KDGSSTAEKSKSLMMN 79 V++MRKR FSETES I+TD +S CVDLKLNLS+ KDGS AEKSK+ N Sbjct: 26 VIVMRKRGFSETESDISTD--ASTCVDLKLNLSNNSKETNSTGGKDGS--AEKSKT---N 78 Query: 80 KNKEKNVDLXXXXXXX--XXXXQVVGWPPVRSFRKNMLSAQKSSTTD-ESK-----AGGN 131 K K N+D QVVGWPPVRSFRKNM +A + ST D ES+ + N Sbjct: 79 KEKNNNLDFRASDPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNN 138 Query: 132 AALVKVSMDGAPYLRKVDLNMYKTYPQLSDALAKMFSSFTIGNCGSQGTIDFMNERKLMD 191 A LVKVSMDGAPYLRKVDL MYK+YP+LSDALAKMFSSFTIGNCGSQG DFMNERKLMD Sbjct: 139 AVLVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMD 198 Query: 192 LLNDSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLA 239 +LN SDYIPTY+DKDGDWMLVGDVPWEMFVESCKRLRIMK KEAVGL Sbjct: 199 VLNGSDYIPTYQDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLG 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2068 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4096 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158361591 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21889 83 3e-18 >Contig21889 Length = 267 Score = 83.2 bits (204), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 8/93 (8%) Query: 5 VTVDVIHTVFSAFGTVQKIAIFEKNCQTQALVQYPDIATAAVAREALEGHCI-------Y 57 V++D++H VFSAFG V KI FEK QALVQ+ D TA A+ AL+ I Y Sbjct: 125 VSIDILHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKTALDSRIIPRYLLPEY 184 Query: 58 DGGYCKLHLSYSRHTDLNVKAYSDKSRDYTIPD 90 G C L ++YS HTDL+VK S +SRDYT P+ Sbjct: 185 VGP-CTLRITYSGHTDLSVKFQSHRSRDYTNPN 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3499 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26529 300 5e-84 >Contig26529 Length = 148 Score = 300 bits (769), Expect = 5e-84, Method: Compositional matrix adjust. Identities = 143/148 (96%), Positives = 146/148 (98%) Query: 1 MASKRISKELKDLQKDPPASCSAGPVAEDMFHWQATIMGPGDSPFAGGVFLVSIHFPPDY 60 MASKRI+KELKDLQKDPPASCSAGPVA+DMFHWQATIMGPGDSPF+GGVFLVSIHFPPDY Sbjct: 1 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPGDSPFSGGVFLVSIHFPPDY 60 Query: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRVKYETTARSWTQKYAMG 148 PEIAHMYKTDR KYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRQKYEATARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4512 (440 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23352 783 0.0 >Contig23352 Length = 437 Score = 783 bits (2022), Expect = 0.0, Method: Compositional matrix adjust. Identities = 378/440 (85%), Positives = 401/440 (91%), Gaps = 3/440 (0%) Query: 1 MATAVSTVGAVNRXXXXXXXXXXXXXXXXXXFMGSSLKKVNSRFPSSKVSSGSFKIVAAE 60 MATAVST+G+VNR F+GSSLKKVNSRF +SKVSSGS +IVA+ Sbjct: 1 MATAVSTIGSVNRAPPNLNGSSSSASVPSSTFLGSSLKKVNSRFTNSKVSSGSLRIVAS- 59 Query: 61 SEIDEDTQTNKDKWKGLAFDESDDQQDITRGKGMVDTLFQAPMGDGTHMAIMSSYDYIST 120 +DED QT+KD+WKGLAFD SDDQQDITRGKG VD+LFQAP G GTH AIMSSY+YIST Sbjct: 60 --VDEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYIST 117 Query: 121 GLRTYNMDNMKDGFYIAPAFMDKLVVHITKNFMNLPNIKIPLILGIWGGKGQGKSFQCEL 180 GLR YN DN DG+YIAPAFMDKLVVHITKNFM LPNIK+PLILGIWGGKGQGKSFQCEL Sbjct: 118 GLRQYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCEL 177 Query: 181 VFAKMGISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGRM 240 VFAKMGISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGR+ Sbjct: 178 VFAKMGISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGRL 237 Query: 241 GGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIVVTGNDFSTLYAPLIRD 300 GGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPI+VTGNDFSTLYAPLIRD Sbjct: 238 GGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRD 297 Query: 301 GRMEKFYWAPTREDRIGVCTGIFKADSVPDSDIVKLVDTFPGQSIDFFGALRARVYDDEV 360 GRMEKFYWAPTREDRIGVC GIF++D+V DIVKLVDTFPGQSIDFFGALRARVYDDEV Sbjct: 298 GRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEV 357 Query: 361 RKWISGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADQYL 420 RKWI+GVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLAD+YL Sbjct: 358 RKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYL 417 Query: 421 SEAALGDANADAIDRGTFYG 440 SEAALGDAN+DA++ GTFYG Sbjct: 418 SEAALGDANSDAMNTGTFYG 437 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89555746 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3688 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89554576 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4417 (306 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3358 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4985 (517 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 280 5e-77 >Contig27182 Length = 447 Score = 280 bits (715), Expect = 5e-77, Method: Compositional matrix adjust. Identities = 161/434 (37%), Positives = 244/434 (56%), Gaps = 9/434 (2%) Query: 80 KRHLNVVFIGHVDAGKSTTGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDTNE 139 K H+N+V IGHVD+GKSTT G +++ G +D R I+++EKEA + ++ S+ A+++D + Sbjct: 5 KFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLK 64 Query: 140 EERLKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFE 199 ER +G T+++ FET T++DAPGH+ ++ NMI+G SQAD VL+I + G FE Sbjct: 65 AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFE 124 Query: 200 TGYERGGQTREHVQLAKTLGVSKLLVVVNKMDDPTVNWSKERYDEIESKMVPFLKTSGYN 259 G + GQTREH LA TLGV +++ NKMD T +SK RYDEI ++ +LK GYN Sbjct: 125 AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYN 184 Query: 260 VKKDVQFLPISGLMGTNMKTRLNKEICSWWDGPCLFEALDAIEVPLRDPKGPFRLPIIDK 319 K + F+PISG G NM R W+ GP L EALD I P R P RLP+ D Sbjct: 185 PDK-IAFVPISGFEGDNMIERSTN--LDWYKGPTLLEALDLINEPKRPSDKPLRLPLQDV 241 Query: 320 FK--DMGTTVMGKVESGSVREGDSLVVMPNKAHVKVLAIFIDEDRVKYAGPGENLRVRLS 377 +K +GT +G+VE+G V+ G + P +V ++ + + ++ A PG+N+ + Sbjct: 242 YKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVK 301 Query: 378 GIDDEDILAGFVLS-SVANPIPAVTEFYAQLQILELLENAIFTPGYKAVLHIHAVVEECE 436 + +D+ GFV S S +P F +Q+ I+ GY VL H + Sbjct: 302 NVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMN--HPGQIGNGYAPVLDCHTSHIAVK 359 Query: 437 IVDLIEEIDMXXXXXXXXXXLFVKNGAVIKCRIQVINMICMEKFADFPQLGRFTLRTEGK 496 +++ +ID F+KNG ++ + +E F+++P LGRF +R + Sbjct: 360 FAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQ 419 Query: 497 TIAVGKVIDAPSKK 510 T+AVG VI + KK Sbjct: 420 TVAVG-VIKSVEKK 432 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158358249 (174 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91034055 249 1e-68 >91034055 Length = 174 Score = 249 bits (637), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 118/176 (67%), Positives = 144/176 (81%), Gaps = 4/176 (2%) Query: 1 MADVAEKERRILVAVDEGEESMYALSWCLGNVV--SSKDTLILVYVKPPKAVYMPLDGTG 58 M DVAE ERRILVAVDEGEESM+ALSWCL NV +SKDTL+L++ KPP+AV+ LDGTG Sbjct: 1 MTDVAESERRILVAVDEGEESMHALSWCLKNVAGQNSKDTLVLLHAKPPRAVFTALDGTG 60 Query: 59 RSQSSSGYMFSSDLYATMENYSNEVANSVIEKAKNKCRDVLQEQDVKVETRIENGDPRDV 118 R + S Y+FSSD+ A E Y +VA+ V+EKA+ C+D+ + D+K ET++E+GDPRDV Sbjct: 61 RREDPSAYLFSSDILAATEKYGADVADCVMEKARKMCKDL--QPDLKAETKVESGDPRDV 118 Query: 119 ICHLVEQLGAHILVMGSRGYGLIKRAFLGSVSNHCAQNVNCPVLIVKKPKTNNGSK 174 IC +VE++ A +LVMGS GYG+IKRAFLGSVSNHCAQNV CPVLIVKKPKTN GSK Sbjct: 119 ICQMVERVRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPKTNAGSK 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158353766 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3026 (123 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158375176 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89547240 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1192 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 57895767 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89551636 (44 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1160 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5466 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20455 199 2e-53 >Contig20455 Length = 117 Score = 199 bits (505), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 95/115 (82%), Positives = 104/115 (90%) Query: 5 KSLFKKQHALERRKAEALRIREKYPERVPVIVEKAVKSDVPDIDKKKYLVPADLTVGQFG 64 KS FK +H LERR+AEA RIREKYP+R+PVIVEKA +SD+PDIDKKKYLVPADLTVGQF Sbjct: 3 KSSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFV 62 Query: 65 YVVRKRIKLGAEKAIFTFVNNVLPPQAALMSAIYEDNKDEDGFLYMTYSGENAFG 119 YVVRKRIKL AEKAIF FV N+LPP AA+MSAIYE+NKDEDGFLYMTYSGEN FG Sbjct: 63 YVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89542221 (196 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158350204 (81 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4581 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1924 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158352035 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3920 (552 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7755 503 e-144 >Contig7755 Length = 332 Score = 503 bits (1294), Expect = e-144, Method: Compositional matrix adjust. Identities = 248/327 (75%), Positives = 266/327 (81%), Gaps = 1/327 (0%) Query: 224 MKADKVDVVQRRVNLMXXXXXXXXXXXXXXXDSSYSFDRLREENNAIILAVGATKPRDLP 283 MK DKV++VQRRVNLM D YS +RLREENNAI+LAVGATKPRDLP Sbjct: 1 MKTDKVEIVQRRVNLMTEEGVNFVVNANIGNDPLYSLERLREENNAIVLAVGATKPRDLP 60 Query: 284 VPGRELSGVHFAMEFLHANTKSLLDSNLENGNYISAXXXXXXXXXXXXXXXXXXXXSVRH 343 VPGRELSGVHFAMEFL ANTKSLLDSNLE+GNYISA SVRH Sbjct: 61 VPGRELSGVHFAMEFLRANTKSLLDSNLEDGNYISAKGKKVVVIGGGDTGTDCIGTSVRH 120 Query: 344 GCTDIVNLELLPQPPQTRAPGNPWPQWPRIFRVDYGHAEVAAKFGKDPRTYEVLTKRFVG 403 GCT I+NLELLP+PP+TRAPGNPWPQWPR+FRVDYGH EVAAKFGKDPRTYEVLTKRFVG Sbjct: 121 GCTSIINLELLPEPPRTRAPGNPWPQWPRVFRVDYGHQEVAAKFGKDPRTYEVLTKRFVG 180 Query: 404 DENGVVKGIEVVRVKWEKDATGKFQFKEIEGSEEIIEADLVLLAMGFLGPEAAIAEKLGL 463 DENG VKG+EVVRVKWEKD TG+FQFKEIEGSEEI+EADLVLLAMGFLGPEA +AEKLGL Sbjct: 181 DENGAVKGLEVVRVKWEKDETGRFQFKEIEGSEEILEADLVLLAMGFLGPEATVAEKLGL 240 Query: 464 ECDNRSNFKADYGRFSTNVDGVFAAGDCRRGQSLVVWAISEGRQAAAQVDNYLCKEEEDH 523 E D RSN+KADYGRFSTNVDGVFAAGDCRRGQSLVVWAISEGRQAAAQVD YL EEED Sbjct: 241 ERDQRSNYKADYGRFSTNVDGVFAAGDCRRGQSLVVWAISEGRQAAAQVDKYLSNEEEDR 300 Query: 524 TDSNSSPESDLLKRHQEITKSQKTVAS 550 T SN S DL KRHQ+++K T +S Sbjct: 301 TISNGS-HPDLSKRHQDLSKRNPTGSS 326 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158355199 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2558 111 4e-27 >Contig2558 Length = 78 Score = 111 bits (277), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 51/71 (71%), Positives = 61/71 (85%) Query: 27 RGARLDWPDGAASRESMRAVFKLPRLPNLIMQHVDHSAGDLIELLQGLLRYEPTERLKAR 86 R LDWP+GA SRES++AV KL RL N++MQHVDHSAGDLI+LLQGLL+++P+ RL A Sbjct: 3 RCCPLDWPEGATSRESIKAVLKLHRLQNIVMQHVDHSAGDLIDLLQGLLKFDPSSRLTAP 62 Query: 87 EALRHPFFTRD 97 EALRHPFFTRD Sbjct: 63 EALRHPFFTRD 73 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig561 (371 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10279 110 3e-26 >Contig10279 Length = 76 Score = 110 bits (276), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 1/76 (1%) Query: 1 MAVPVSAIGFEGYEKRLEVCFFEPGLFADPKGMGLRSLSRAQINEILNPAECTIVSSLLN 60 MA+ SAIGFEGYEKRLE+ FFEP +F DP+G GLRSLS+AQI+E L AECTIVSSL N Sbjct: 1 MAMEGSAIGFEGYEKRLEIAFFEPSIFLDPEGRGLRSLSKAQIDEFLEQAECTIVSSLSN 60 Query: 61 DDLDSYVLSE-SSLFV 75 D++DSYVL E SSLF+ Sbjct: 61 DNVDSYVLXESSSLFI 76 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5162 (448 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8326 303 3e-84 >Contig8326 Length = 344 Score = 303 bits (777), Expect = 3e-84, Method: Compositional matrix adjust. Identities = 188/370 (50%), Positives = 222/370 (60%), Gaps = 46/370 (12%) Query: 1 MTSSFTHXXXXXXXXXXXXFDQDRTGSWNWG--LSDRSTEQQEH--------PKFKSHQX 50 MTSSFTH QDRT NWG SD S+ PKFKS Q Sbjct: 1 MTSSFTHLLTSNMENSG--IGQDRT---NWGGLFSDYSSNPNRFTDRNGTDIPKFKSLQP 55 Query: 51 XXXXXXXXXXXXXXYLVN--AFSPTDFLSSPMFLANSNTLPSPTTGAFSSQIFDWMSSSK 108 YL + AFSPTDFLSSPMFL++S L SPTTGAFSSQ+FDWM+++K Sbjct: 56 PSLPLSPPPVSPSSYLTSTPAFSPTDFLSSPMFLSSSYNLESPTTGAFSSQVFDWMNNTK 115 Query: 109 ENNSQQGAE--KEQKMFTDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQQQTWGFN 166 + +QQG + +E K+F+DF ++Q W F+ Sbjct: 116 D--TQQGIKDKEEPKLFSDFSFQPESRPATNLQSSSSMVSVEEPFKG-----ERQAWDFS 168 Query: 167 KTSRQEETVAEKTEVKSEVAPVQS------FNAAPKSEYTNCSTHSTQYVREQKSDDGYN 220 AEKT VKSE P+++ N APKS+Y + S +QY REQKSDDG+N Sbjct: 169 ---------AEKTGVKSEFEPIEANTQSNGLNGAPKSDYLH-SNQCSQYAREQKSDDGFN 218 Query: 221 WRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLDGQITQIVYKGSHNHAKPXXXXXX 280 WRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLDGQITQIVYKG+HNH KP Sbjct: 219 WRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLDGQITQIVYKGNHNHPKP--QSTR 276 Query: 281 XXXXXXXXXXXYAISDQSASTIYNPKIEAVTLQEDSNSASMGGEDEFEQNSPISNSNGAD 340 Y ISDQS T+ NPK+E+V+LQEDS+++ GEDEFEQNSPISNS GA+ Sbjct: 277 RSSSNSIQGSFYGISDQSVPTLSNPKVESVSLQEDSSTSI--GEDEFEQNSPISNSVGAE 334 Query: 341 DDNEPEAKRW 350 D+NEPEAKRW Sbjct: 335 DENEPEAKRW 344 Score = 79.7 bits (195), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Query: 384 DDGYRWRKYGQKVVKGNPNPRSYYKCTSTGCPVRKHVERASHDMRAVITTYEGKHNHDVP 443 DDG+ WRKYGQK VKG+ NPRSYYKCT CP +K VER S D + Y+G HNH P Sbjct: 214 DDGFNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVER-SLDGQITQIVYKGNHNHPKP 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4766 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10432 253 2e-69 >Contig10432 Length = 181 Score = 253 bits (646), Expect = 2e-69, Method: Compositional matrix adjust. Identities = 125/181 (69%), Positives = 148/181 (81%), Gaps = 4/181 (2%) Query: 1 MTSLSTSCLTG-PVLRLPSLLSPQNPNQRSLLSLTRNPDRIRGNRIVCKNLSVCPKASLR 59 ++S+ +SCLTG ++ PS+ S QN N +S LSL N R+ G + KN + C KA+ + Sbjct: 4 ISSVYSSCLTGSAAIQPPSIFSSQNLNHKSSLSL--NGKRL-GTGLQNKNFNFCVKAAQK 60 Query: 60 GNLEVAGLPTSVPVRVAHELLLAGHHYLDVRTPEEFSAGHPSGAVNIPYLYRVGSGMSKN 119 NLE G+PTSVPVRVAHELL AGH YLDVRTPEEFSAGH GAVNIPYLY+VGSGM+KN Sbjct: 61 RNLEAVGVPTSVPVRVAHELLQAGHKYLDVRTPEEFSAGHAPGAVNIPYLYKVGSGMTKN 120 Query: 120 PEFVKEVSSHFRKHDEIIVGCQLGKRSMMAATDLVAAGFTGITDMAGGYATWTQNGLPTE 179 EF+++VSSHFRKHDEIIVGCQLGKRSMMAATDL A+GFTGITD+AGGYA WTQ+GLPTE Sbjct: 121 QEFLEQVSSHFRKHDEIIVGCQLGKRSMMAATDLEASGFTGITDIAGGYAAWTQSGLPTE 180 Query: 180 L 180 + Sbjct: 181 I 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 77982831 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig934 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25110 140 2e-35 >Contig25110 Length = 205 Score = 140 bits (353), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 63/87 (72%), Positives = 77/87 (88%) Query: 94 SGIEIGTKLYVSNLHYGVTNEDIRELFSEIGELKRYAVHFDKNGRPSGSAEVVYTRRSDA 153 S IE GTKLY+SNL YGV+NEDI+ELFSE+G+LKRY VH+D++GR G+A+VV++RR+DA Sbjct: 18 SAIETGTKLYISNLDYGVSNEDIKELFSEVGDLKRYGVHYDRSGRSKGTADVVFSRRTDA 77 Query: 154 FAALKRYNNVLLDGKPMKIEIVGVNEG 180 AA+KRYNNV LDGKPMKIEIVG N G Sbjct: 78 AAAVKRYNNVQLDGKPMKIEIVGTNIG 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158352771 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5998 156 7e-41 >Contig5998 Length = 107 Score = 156 bits (394), Expect = 7e-41, Method: Compositional matrix adjust. Identities = 81/107 (75%), Positives = 84/107 (78%), Gaps = 7/107 (6%) Query: 1 MAMAKXXXXXXXXXXGISMAA-------ETQYHLDSARYGPGSLKSSQCPSQCTRRCSKT 53 MAMAK GISMAA + + LDS YGPGSLKS QCPSQCTRRCS+T Sbjct: 1 MAMAKLVCFLLLALLGISMAATQVMAKEQARNQLDSGGYGPGSLKSYQCPSQCTRRCSQT 60 Query: 54 QYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP 100 QYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP Sbjct: 61 QYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1557 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7292 102 4e-24 >Contig7292 Length = 258 Score = 102 bits (255), Expect = 4e-24, Method: Compositional matrix adjust. Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 1/75 (1%) Query: 1 MGEK-KVTIMVLKVDLQCEXXXXXXXXXXXXFPQIRDQTYDEKNNQVIIKVVCCSPEKIR 59 MGEK KVTIMVLKVDL C FPQIRDQ YDEK NQV+IKVVCCSPEKIR Sbjct: 1 MGEKEKVTIMVLKVDLGCHKCYKKVKKVLCKFPQIRDQIYDEKQNQVVIKVVCCSPEKIR 60 Query: 60 DKLCCKGGGAIKSID 74 DK+CCKGGGAIKSI+ Sbjct: 61 DKICCKGGGAIKSIE 75 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3572 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2569 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3361 (256 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4390 (667 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5971 550 e-158 >Contig5971 Length = 318 Score = 550 bits (1417), Expect = e-158, Method: Compositional matrix adjust. Identities = 273/296 (92%), Positives = 277/296 (93%) Query: 351 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 410 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS Sbjct: 2 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 61 Query: 411 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 470 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV Sbjct: 62 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 121 Query: 471 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKS 530 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNV+AEDKGTGKS Sbjct: 122 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRAEDKGTGKS 181 Query: 531 EKITITNDKGRLSQEEIERMXXXXXXXXXXXXXXXXXIDARNSLETYTYNMKNQINDKDK 590 EKITITNDKGRLSQEEI+RM IDARNSLETY YNMKNQINDKDK Sbjct: 182 EKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDK 241 Query: 591 LADKLESDEKEKIETAVKEALEWLDDNQTAEKEDYEEKLKEVEAVCNPIITAVYQR 646 LADKLESDEKEKIETA KEALEWLDDNQTAEKEDY+EKLKEVEAVCNPII+AVYQR Sbjct: 242 LADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISAVYQR 297 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5524 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13975 344 6e-97 >Contig13975 Length = 237 Score = 344 bits (883), Expect = 6e-97, Method: Compositional matrix adjust. Identities = 175/241 (72%), Positives = 202/241 (83%), Gaps = 4/241 (1%) Query: 1 MSGPQCCSNPPTLNPTSGSGHVEKLGGLDSYLTGSPDSKLAIVLVSDIFGYDAPNLRKLA 60 M+ +CCSNPP LNP+SGSGHVEKLGG DSY+TGSPDSKLA++LV D FGY+AP R LA Sbjct: 1 MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSKLAVLLVHDAFGYEAPKARMLA 60 Query: 61 DKIAAAGFFAVVPDFFYGDPYVPAADGSLDSLPAWLKGHGADKGFEDVKVVIEALKSKGV 120 DKIAAAGF V+PDFF DP+ +G L S+P W+K H DK ED K+VIEALKSKGV Sbjct: 61 DKIAAAGFIVVLPDFFNRDPF----NGDLASIPVWIKAHAPDKTIEDAKLVIEALKSKGV 116 Query: 121 CAIGAVGFCWGAKVVVELAKGDFIQAAVLAHPSFVTLDDIKAVKVPISILGAEIDRMSPP 180 AIGAVGFCWG K VVELAK DFIQAAVL HPSFVTLDDIKAVKVPIS+LGAEID+++PP Sbjct: 117 SAIGAVGFCWGGKGVVELAKHDFIQAAVLCHPSFVTLDDIKAVKVPISVLGAEIDQLTPP 176 Query: 181 ELVKQFEEALTAKSEIKSHVKIFPKVSHGWTVRYDVSDKEAVKPAEEAHKDMLDWFVNHV 240 E+VKQFEE LTAK EIKSHVKIFPK++HGWT+RY+ D+ AVK AEEAH+D+L WF+ H+ Sbjct: 177 EVVKQFEEVLTAKPEIKSHVKIFPKIAHGWTLRYNDEDEAAVKAAEEAHQDLLGWFLEHI 236 Query: 241 K 241 K Sbjct: 237 K 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5049 (364 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5164 (389 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9875 79 1e-16 >Contig9875 Length = 275 Score = 79.0 bits (193), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 55/177 (31%), Positives = 89/177 (50%), Gaps = 18/177 (10%) Query: 22 YVGNIHTQVTEPLLQEVFASTGAVESCKLIRKEKSS----YGFVHYFDRRCAALAIVSLN 77 +VGN+ V L +F S G VE ++I + + +GFV + + A A LN Sbjct: 91 FVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGFVTMSNVQEAESAARQLN 150 Query: 78 GRQLFGQPIKVNWAYASGQREDTS--------------GHFNIFVGDLSPEVTDATLFAC 123 G +L G+ ++VN+ + ED+S + ++VG+L+ V + L Sbjct: 151 GYELDGRALRVNYGPPPPRTEDSSFRGARGPRGGGGYDSNNRLYVGNLAWGVDNLALENL 210 Query: 124 FSVYSSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQSAINDLNGKWLASRQIRCNWA 180 FS +A+V++D+ +GRSRGFGFV++ + SAI L+G L R IR + A Sbjct: 211 FSEQGKVLEAKVVFDRDSGRSRGFGFVTYDTADEMNSAIESLDGVDLNGRSIRVSAA 267 Score = 78.6 bits (192), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 67/209 (32%), Positives = 92/209 (44%), Gaps = 24/209 (11%) Query: 99 DTSGHFNIFVGDLSPEVTDATLFACFSVYSSCSDARVMWDQKTGRSRGFGFVSFRNQQDA 158 + S +FVG+L V A L F + V++D+ TGRSRGFGFV+ N Q+A Sbjct: 83 EASPEPKLFVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGFVTMSNVQEA 142 Query: 159 QSAINDLNGKWLASRQIRCNWATKGAGTNEDKQSSDGKSVVELTNGSSEDGKXXXXXXXX 218 +SA LNG L R +R N+ T ED + S + Sbjct: 143 ESAARQLNGYELDGRALRVNYGPPPPRT-EDSSFRGARGPRGGGGYDSNN---------- 191 Query: 219 XXXXQYTTVYVGNLAPEVTQLDLHRHFYALGVGVIEEVRLQRD----KGFGFVRFSTHGE 274 +YVGNLA V L L F G + +V RD +GFGFV + T E Sbjct: 192 -------RLYVGNLAWGVDNLALENLFSEQGKVLEAKVVFDRDSGRSRGFGFVTYDTADE 244 Query: 275 AALAIQMGNTQSNLFGRQIKCSWGSKPTP 303 AI+ + +L GR I+ S ++P P Sbjct: 245 MNSAIESLDGV-DLNGRSIRVS-AAEPRP 271 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1068 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22807 192 4e-51 >Contig22807 Length = 267 Score = 192 bits (489), Expect = 4e-51, Method: Compositional matrix adjust. Identities = 93/101 (92%), Positives = 97/101 (96%) Query: 10 REQNNGSLLVRNIPLDCRPEELRTPFERFGLVRDVYIPKDYYTGEPRGFAFVQFVDSYEA 69 +EQNNGSLLVRNIPLDCR EELR PFER+G VRDVYIPKDYYTGEPRGFAF+QFVDSYEA Sbjct: 35 KEQNNGSLLVRNIPLDCRAEELRAPFERYGEVRDVYIPKDYYTGEPRGFAFIQFVDSYEA 94 Query: 70 AEAQYHMNGKIFAGREISVVLAAETRKRPEEMRQRTRVRGP 110 AEAQYHMNGKIFAGREISVV+AAETRKRPEEMRQRTRVR P Sbjct: 95 AEAQYHMNGKIFAGREISVVVAAETRKRPEEMRQRTRVREP 135 Score = 59.7 bits (143), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 37/66 (56%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Query: 188 DHERRPYSPGYDNGAGQAENGDGYDKKSRYDEEVEPRGNWRSPDKAXXXXXXXXXXXAEL 247 D +RRPYSPGYDN AG +NGD YDKK EE + R +WRSPD+A AEL Sbjct: 203 DGDRRPYSPGYDNVAGPNDNGDEYDKKP-MREEKDGRDHWRSPDRASRSPSGSRSRSAEL 261 Query: 248 SPRRSR 253 SP RSR Sbjct: 262 SPARSR 267 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2315 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1666 (421 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11372 178 2e-46 >Contig11372 Length = 541 Score = 178 bits (451), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 84/156 (53%), Positives = 104/156 (66%), Gaps = 1/156 (0%) Query: 5 SSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLKSRD 64 S SL GFRF PTD EL+ YYL+ K+ G + I +D+ K EPWDLP S +++ D Sbjct: 5 SMNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTTD 64 Query: 65 TEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHSSRAVGMKKTLVFHSGRAPKG 124 EW+FF DRKY N R NRAT +GYWK TGKDR + +GMKKTLVFH GRAPKG Sbjct: 65 PEWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQIKSDKILIGMKKTLVFHIGRAPKG 124 Query: 125 ARTNWVMHEYRLDNQELEKAGIVEKDAYVLCRIFQK 160 RTNWVMHEYR +EL+ + ++VLCR+F+K Sbjct: 125 KRTNWVMHEYRATQKELDGTN-PGQSSFVLCRLFKK 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig788 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9154 270 1e-74 >Contig9154 Length = 270 Score = 270 bits (691), Expect = 1e-74, Method: Compositional matrix adjust. Identities = 124/146 (84%), Positives = 139/146 (95%) Query: 110 LVPSSFPPGTDPNVVACFQIADQDGSGFIDDKELQKALSSYNQSFSMRTVHLLMYLFTQS 169 LVPS FPPGTDPNV+ACFQ+ADQDGSGFIDDKE+Q+ALSSYNQSFS+RTVHLLMYLFTQ+ Sbjct: 91 LVPSVFPPGTDPNVIACFQLADQDGSGFIDDKEMQRALSSYNQSFSLRTVHLLMYLFTQT 150 Query: 170 NSRKIGPKEFTAVFYSLQNWRGIFEKFDRDRSGKIDSNELRDALGSLGFSVSPAVLDLLV 229 N+RKIGPKEF A+FYSLQ+WRG+FE+FDRDRSG ID+NELRDAL SLGF+VSP VL+LLV Sbjct: 151 NTRKIGPKEFAALFYSLQSWRGVFERFDRDRSGFIDANELRDALLSLGFAVSPVVLELLV 210 Query: 230 SKFDKTGGHMKAIEYDNFIECCLTVK 255 SKFDKTGG +AIEYDNFIECCLTVK Sbjct: 211 SKFDKTGGKKRAIEYDNFIECCLTVK 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1568 (297 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6378 253 4e-69 >Contig6378 Length = 299 Score = 253 bits (645), Expect = 4e-69, Method: Compositional matrix adjust. Identities = 160/304 (52%), Positives = 179/304 (58%), Gaps = 19/304 (6%) Query: 1 MEFWGVEVKAGEPMKVKPDLGNVVHLSQACLGEAKKAADSVVIYGKAKEQKLVLGHLIPS 60 + FW VEVKAGEP+KV P+ +V+HLSQA LGE KK D VI+ K QKLVL +L Sbjct: 5 LGFWVVEVKAGEPLKVVPEESSVIHLSQATLGELKKGGDQCVIHVKVGNQKLVLANLSSD 64 Query: 61 QIPQLSFDLVFDEEFELSHNWKNGSVHFAGYQSVMGXXXXXXXXXXXXXXXXXXXXLPVI 120 +IPQ+ FDLVFD+EFELSHN K+GSVHF GYQ+ + LP+ Sbjct: 65 KIPQIPFDLVFDKEFELSHNLKSGSVHFCGYQTCLA------DESDEEDQSDSEEDLPLN 118 Query: 121 ATENGKVENAKPASAKNNAVKPESSGKQKVKIEEPTKXXXXXXXXXXXXXXXXXXXXXX- 179 T+NGKV AKPA K NAVKPESSGKQKV I EP K Sbjct: 119 FTDNGKVVAAKPAPPKTNAVKPESSGKQKVNIVEPIKDEDDSDDSDDIGDSDDDDDDRSS 178 Query: 180 ------XXXXXXXXXXXXXXXXTPAPKKPESKKRAQVSESAKTPVSAKKAKIDTTTPQKT 233 TP PKK SKKR S + KTPVSAKKAK TPQKT Sbjct: 179 DEDMLGADSSDEDDDDSEEEEETPTPKK-NSKKRPNES-TPKTPVSAKKAK--QVTPQKT 234 Query: 234 DAKKGGHTDTPHPAKK-GKTPAT-DKSKAQTPKSAGGNFSWGSCSKAFGSDGALQSHNKA 291 D KKG HT TPHPAKK GKTPAT DKSK QTPKSAGG+ S C+K+F SDGAL SH KA Sbjct: 235 DGKKGAHTATPHPAKKGGKTPATSDKSKPQTPKSAGGDHSCKPCNKSFNSDGALSSHKKA 294 Query: 292 KHSA 295 KH A Sbjct: 295 KHGA 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49513703 (69 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362365 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5225 (321 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10220 337 1e-94 >Contig10220 Length = 356 Score = 337 bits (865), Expect = 1e-94, Method: Compositional matrix adjust. Identities = 159/183 (86%), Positives = 173/183 (94%), Gaps = 3/183 (1%) Query: 108 MSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQAMLKKHEIFIVEAD 167 MSVLVTGAAGF+GSHCSLALKKRGDGVLGLDNFNSYYDPSLKR+RQA+LKKHE+F+VE D Sbjct: 1 MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQALLKKHEVFVVEGD 60 Query: 168 LNDGPMLTKLFDVVPFTHVLHLAAQAGVRYAMQNPQSYVASNIAGFVNLLEISKAANPQP 227 LND P+LTKLFDVVPFTH+LHLAAQAGVRYAMQNPQSYV+SNIAGFVNLLE++K ANPQP Sbjct: 61 LNDEPLLTKLFDVVPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLLEVAKRANPQP 120 Query: 228 AIVWASSSSVYGLNTENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYKPTTDLASGL 287 +IVWASSSSVYGLNT+NPFSELHRTDQPASLYAATKKAGEEIAHTYNHIY + +GL Sbjct: 121 SIVWASSSSVYGLNTDNPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSL---TGL 177 Query: 288 RKF 290 R F Sbjct: 178 RFF 180 Score = 70.1 bits (170), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Query: 277 YKPTTDLASGLRKFVKWYVSYYGIESRVKTE-SKKMMMSQQPEESA 321 YKPTTDLASGLRKFVKWYVSYYGIESRVK E SQQ +ES Sbjct: 311 YKPTTDLASGLRKFVKWYVSYYGIESRVKKEMDSGKKGSQQTDESG 356 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4871 (585 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5193 (545 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31992 142 1e-35 >Contig31992 Length = 566 Score = 142 bits (359), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 133/505 (26%), Positives = 221/505 (43%), Gaps = 52/505 (10%) Query: 35 WNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDNLIINVFNSLDEPFLLSWNGIQQRH 94 +NV + L Q ++N +PGP I + D LII+V N + W+GI Q Sbjct: 29 FNVNNLTVTRLCQNQSITVVNESYPGPTIYAREGDTLIIHVLNQSPYNITIHWHGIYQLL 88 Query: 95 NSFQDG-VYGTTCPIPPGRNLTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRILSRPRI 153 +++ DG Y T CPIPPG++ TY + Q G+ ++ +++ +A G + I + Sbjct: 89 SAWADGPAYVTQCPIPPGQSYTYKFNITGQEGTLWWHAHISWLRATV-HGALIIHPKAGQ 147 Query: 154 PVPFPDPSGDYTVLIGDWYKSNHTTLKAH-LDRGKKLPFPDGILING-------RGPNQ- 204 PFP P+ + +++GDWY N ++ L +G + ING NQ Sbjct: 148 SFPFPKPAKEVPIILGDWYSGNVVDIEQEGLSKGIAPNLSNAYTINGLPGDLYDCSQNQT 207 Query: 205 FSLTFEQGKTYRLRISNVGLQHSLNFRIQDHKMKLVEVEGTHTLQTTYSSLDVHVGQSYS 264 + L+ +GKTY LR+ N L L F+I +H M +V ++ ++T + + GQ+ Sbjct: 208 YQLSVVRGKTYLLRLINAALNTQLFFKIANHNMTVVAIDASYTTPYDTDVVVIAPGQTTD 267 Query: 265 VLVTADQPGHDYYIVVSSRFSTPIL------TTTGILHYSG--AGGQVSGPIPGGPTIQI 316 +LV +Q YY+ + S TT GI+ Y G + + P+P + Sbjct: 268 ILVKFNQLNGSYYMAATPYASADDTVGFDNSTTRGIIVYKGYTSSTPIMPPMPNPHDTPL 327 Query: 317 DWSLNQARSIRTNLTA--SGPR--PNPQGSYHYGL----INLTKTYILASAAGQVNGKQR 368 A TNLT GP P P+ + +NL + G N + Sbjct: 328 ------AHKFFTNLTGLPGGPHWVPVPRKVDEHMFVTVGVNLAMCPENTTCQGLFNNRFS 381 Query: 369 YGINSVSFV-PADTPLKLADYFKISGVFRVGSVSDRP-----TGGNLYLDTSVLGA---- 418 +N+ SF+ P +T + A + ++GV+ ++ P T NL LD S++ A Sbjct: 382 ASMNNESFMAPTNTSMLEAHFNNVNGVYTRDFPNEPPVKFDYTDTNLSLDLSLIFAPKST 441 Query: 419 -----DYRTFVEIVFQNDEDIV---QSYHLDGYQFFVVGMDGGKWTTASR-NGYNLRDAV 469 + + V++VFQN + HL G+ F V+ G + + +N + Sbjct: 442 KVKTLKFNSTVQLVFQNTAFLAIENHPMHLHGFDFHVLAQGFGNYDPINDPKKFNFVNPQ 501 Query: 470 ARSTTQVYPFSWTAIYLSLDNVGMW 494 R+T V W I +N G+W Sbjct: 502 VRNTIGVPVGGWAVIRFRANNPGIW 526 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 238017991 (94 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158355797 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89558627 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16126 242 5e-66 >Contig16126 Length = 234 Score = 242 bits (617), Expect = 5e-66, Method: Compositional matrix adjust. Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 2/150 (1%) Query: 8 KTVWVWTESKQVMTAAVERGWNTFVF--QSQKLADDWSSIALIDPLLMKEGGIFDSENTR 65 K VWVWTESKQVMTAAVERGWNTFVF QS++LAD+WSSIALID L ++EG I D EN R Sbjct: 85 KRVWVWTESKQVMTAAVERGWNTFVFPSQSRELADEWSSIALIDTLFIEEGAILDGENRR 144 Query: 66 VATVFEVSSPEELEQLQPENGVGENVVVDLLDWQVIPAENIVAAFQGSQKTVFAVSKTPV 125 VAT+ EV++P+ELE LQPE +GENVVVDLLDWQVIPAENIVAAFQGS KTVFAVSKT + Sbjct: 145 VATMLEVANPKELELLQPEKALGENVVVDLLDWQVIPAENIVAAFQGSGKTVFAVSKTAL 204 Query: 126 EAQVFFEALEHGLGGVVLKVEDVQAVLDLK 155 EAQVFFEALEHGLGGV+LK+E+V+A+LDLK Sbjct: 205 EAQVFFEALEHGLGGVILKIEEVKALLDLK 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 238018040 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4147 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18692 375 e-106 >Contig18692 Length = 209 Score = 375 bits (963), Expect = e-106, Method: Compositional matrix adjust. Identities = 178/193 (92%), Positives = 188/193 (97%) Query: 17 PHNDVKLFNRWTFEGVEVTDLSLQDYIGVNQAKHATYVPHTAGRYSVKRFRKAQCPIVER 76 PH DVKLFNRW+F+ V+V+D+SL DY+GV A+HATYVPHTAGRYSVKRFRKAQCPIVER Sbjct: 17 PHYDVKLFNRWSFDDVQVSDISLADYVGVVPARHATYVPHTAGRYSVKRFRKAQCPIVER 76 Query: 77 LTNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSA 136 LTNSLMMHGRNNGKKLMAVRI+RHAMEIIHLLTDLNP+QVIVDAVVNSGPREDATRIGSA Sbjct: 77 LTNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDLNPVQVIVDAVVNSGPREDATRIGSA 136 Query: 137 GVVRRQAVDISPLRRVNQAIYLLTTGARESAFRNIKTIAECLADELINAAKGSSNSYAIK 196 GVVRRQAVDISPLRRVNQAIYLLTTGARESAFRN+KTIAECLADELINAAKGSSNSYAIK Sbjct: 137 GVVRRQAVDISPLRRVNQAIYLLTTGARESAFRNVKTIAECLADELINAAKGSSNSYAIK 196 Query: 197 KKDEIERVAKANR 209 KKDEIERVAKANR Sbjct: 197 KKDEIERVAKANR 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1968 (414 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158362633 (109 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158351738 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 260657394 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158369394 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158357520 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29071 68 1e-13 >Contig29071 Length = 194 Score = 68.2 bits (165), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 11/136 (8%) Query: 16 ARSCDYSDGAWIYDPNASP-KYDHTCKEIFKGWNCISGNKSNGRELTKWRWKPNGCDLPT 74 A C++ G W+YD ++ P Y TC + ++C+ + + L K+RW+P C LP Sbjct: 49 AGKCNWFRGTWVYDASSKPPYYSSTCPFVDPQFDCLKYGRPDTAFL-KYRWQPFSCALPR 107 Query: 75 FDPVRFLHMYRNTSIGFIGDSLNRNMFVALFCSL-----KRVSSEVKKWRPFGADRGFTF 129 F+ + FL +R I F+GDSL+ N +V+L C L +S VKK TF Sbjct: 108 FNGLYFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTSYVKK----DGLASVTF 163 Query: 130 LQYNVTLAYHRTNLLA 145 Y V + +RT L Sbjct: 164 QDYGVQILLYRTPYLV 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 89550571 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226789991 128 8e-32 >226789991 Length = 126 Score = 128 bits (322), Expect = 8e-32, Method: Compositional matrix adjust. Identities = 72/109 (66%), Positives = 84/109 (77%), Gaps = 5/109 (4%) Query: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSSTKD 67 KI+I+KID LPARQVT+SKRRRG+ KKA ELSVLCD E ++IIFS TGKL + SSSSTKD Sbjct: 5 KIQIKKIDYLPARQVTFSKRRRGIFKKAGELSVLCDSEVAIIIFSQTGKLFDFSSSSTKD 64 Query: 68 VITRYESQTGDEGNLDQSSLD-LQ---HDCIKLSNEIADKSRVLRQMNG 112 VI RY S+TG E N DQ +LD LQ + I+LS E+ DKS LRQM G Sbjct: 65 VIARYNSRTGRE-NSDQPTLDQLQLEKKNKIRLSKELKDKSHKLRQMKG 112 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3250 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31690 318 3e-89 >Contig31690 Length = 159 Score = 318 bits (814), Expect = 3e-89, Method: Compositional matrix adjust. Identities = 152/159 (95%), Positives = 155/159 (97%) Query: 1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF 60 MSDEEH FESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF Sbjct: 1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF 60 Query: 61 VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 V IDIF KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD Sbjct: 61 VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 Query: 121 DALLTQLKDGFAEGKDLVVTVMSAMGEEQICALKDIGPK 159 D+LLTQ+KDGFAEGKDLVV+VMSAMGEEQICALKDIGPK Sbjct: 121 DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2005 (422 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5939 435 e-124 >Contig5939 Length = 292 Score = 435 bits (1118), Expect = e-124, Method: Compositional matrix adjust. Identities = 217/277 (78%), Positives = 234/277 (84%), Gaps = 8/277 (2%) Query: 128 TSVCGRRRDMEDAVSIHPKLFN-DGSDSDGCHFYGVYDGHGCSHVALKCKDRLHEIVKQD 186 TSVCGRRRDMEDAVSIHP + +S+G HFYGV+DGHGCSHVALKCKDRL+EIVKQ+ Sbjct: 2 TSVCGRRRDMEDAVSIHPSFLQKENPESNGTHFYGVFDGHGCSHVALKCKDRLYEIVKQE 61 Query: 187 LESQ-RVVQWKDTMERSFSKMDEEVQAGNRALQNPNCRCELQTPQCDAVGSXXXXXXXXP 245 LE++ VQWKD MERSF KMDEEVQ GN Q+ NCRCELQTPQCDAVGS P Sbjct: 62 LETEGESVQWKDAMERSFLKMDEEVQEGNLKAQSSNCRCELQTPQCDAVGSTAVVAVVTP 121 Query: 246 EKIIVSNCGDSRAVLCRKGAAVPLSSDHKPDRPDELLRIEAAGGRVIYWDGPRVLGVLAM 305 EKI+VSNCGDSRAVLCR GAAVPLSSDHKPDRPDEL+RIEAAGGRVIYWDG RVLGVLAM Sbjct: 122 EKIVVSNCGDSRAVLCRSGAAVPLSSDHKPDRPDELVRIEAAGGRVIYWDGARVLGVLAM 181 Query: 306 SRAIGDNYLKPYVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQKT 365 SRAIGDNYLKPYVISEPEVT+ DRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQ Sbjct: 182 SRAIGDNYLKPYVISEPEVTVTDRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQT- 240 Query: 366 PGASSGGDVADGESSAGVNSDKACADASILLTKLALA 402 A+S ++ A +SDKAC+DASILLTKLALA Sbjct: 241 --AASQSELC---CDAAASSDKACSDASILLTKLALA 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158379466 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28932 330 1e-92 >Contig28932 Length = 323 Score = 330 bits (846), Expect = 1e-92, Method: Compositional matrix adjust. Identities = 157/222 (70%), Positives = 181/222 (81%) Query: 5 KSGIAKDVTELIGKTPLVYLNHIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKG 64 K I DVTELIG TPLVYLN++VDGCVARIAAKLE MEPCSSVKDRI YSMI DAE KG Sbjct: 4 KFAIKNDVTELIGNTPLVYLNNVVDGCVARIAAKLESMEPCSSVKDRIAYSMIKDAEDKG 63 Query: 65 LITPGQSVLIEPTSGNTGIGLAFMAAAKQYRLIITMPASMSIERRIILRAFGAELVLTDP 124 LITPG++VLIE TSGNTGIGLAF+AA++ Y++ +TMP+SMSIERRI+L AFGAE+ LTDP Sbjct: 64 LITPGKTVLIEATSGNTGIGLAFIAASRGYKVKLTMPSSMSIERRIVLLAFGAEVYLTDP 123 Query: 125 AKGMKGAVQKAEEILAKTPNAYMLQQFENPANPKVHYETTGPEIWEGTGGKIDAFVSXXX 184 AKG+KGA KAEE+L+ TPN Y+L QFENPANPK+HYETTGPEIW TG K+DA VS Sbjct: 124 AKGIKGAFDKAEELLSDTPNGYILGQFENPANPKIHYETTGPEIWRDTGAKVDALVSGIG 183 Query: 185 XXXXXXXXXKYLKEKNPSVKLYGVEPVESPVLTGGKPGPHKI 226 K+LKE+NP +K+YGVEP ESPVL GG+ G H I Sbjct: 184 TGGTVAGTGKFLKEQNPEIKVYGVEPAESPVLNGGQAGKHLI 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158359113 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 158368865 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24188 229 3e-62 >Contig24188 Length = 264 Score = 229 bits (584), Expect = 3e-62, Method: Compositional matrix adjust. Identities = 128/197 (64%), Positives = 154/197 (78%), Gaps = 3/197 (1%) Query: 1 MAGRE-PRHLHRL-PQIVNTTALEDRVDLQQREIQSLLIDNQRLAATHVALKQDLTSAQS 58 MAGRE PR L RL P VNTTALEDR+ LQ REIQSLL+DNQRLAA HVALKQDL +AQ Sbjct: 1 MAGREHPRQLVRLTPLSVNTTALEDRIALQNREIQSLLVDNQRLAAAHVALKQDLAAAQH 60 Query: 59 DLRNLKAVAGQIKSERNAEVREVYDRSLKLDDELRGLDAMKAELSVVLNDIEDLSASRME 118 DLR+L VAG+ KSER+AEVREVY+R+LKLD E+R +D+M A+L+ DI++L +SR E Sbjct: 61 DLRHLSVVAGKAKSERDAEVREVYERALKLDAEVRAIDSMGADLARTRADIQELGSSRQE 120 Query: 119 LATELKTIQGEIERTRSDESKQFEARLDEIKTLKVEIEKGRAAIEIEKKTRASNLVHRQA 178 LA EL TI+GE+ RT+S+ K + + D I+T K EI+KGR AI+ EKKTRASNL HRQ Sbjct: 121 LAEELNTIEGELARTQSEAKKVVDIKAD-IETFKQEIKKGRDAIDNEKKTRASNLEHRQG 179 Query: 179 MEDYMAALALEIKKLHG 195 ME MAALA E+ KLHG Sbjct: 180 MEKTMAALAREMDKLHG 196 Database: apple.as.orf Posted date: Mar 27, 2017 5:36 AM Number of letters in database: 349,985 Number of sequences in database: 1580 Lambda K H 0.320 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1580 Number of Hits to DB: 65,297,731 Number of extensions: 2636502 Number of successful extensions: 7986 Number of sequences better than 1.0e-10: 389 Number of HSP's gapped: 7377 Number of HSP's successfully gapped: 492 Length of database: 349,985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 6.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 136 (57.0 bits)