BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33129 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2922 208 2e-56 >Contig2922 Length = 223 Score = 208 bits (529), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 108/207 (52%), Positives = 145/207 (70%), Gaps = 3/207 (1%) Query: 4 EVKLLKTWSSPFGLRAFWILKLKGVQFDFIDED-LSNKSPLLLQSNPVYKKVPVLIHNGK 62 +V +L WSSP+ R W LKLKGV +++++ED L NKS LL+ NPV+KKVPVL+H GK Sbjct: 3 QVTVLGAWSSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAGK 62 Query: 63 PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKEQEE 122 PI+ES VILEY++ETW QNPLLP+DP++RA ARFW KFGEDK +++ F+ +G++Q + Sbjct: 63 PIAESAVILEYIEETWPQNPLLPKDPHQRALARFWIKFGEDK-FGALFGFFMTEGEQQVK 121 Query: 123 AIGLAIETLKFLEEE-LKGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKERVP 181 A E L LEE+ L K+FFGG+++G+ADL GWLA + V E+ GVK IE E P Sbjct: 122 ATKERQEQLTILEEQGLGDKKFFGGDELGMADLEFGWLAWWMDVMSELAGVKGIEAETFP 181 Query: 182 LLAAWMQEVAEAPVIKESWPPHEKLVT 208 L AW+Q + P IKE P ++T Sbjct: 182 RLHAWIQRFKDIPTIKEHLPDRSAMLT 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65357 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4294 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61991 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88194 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3203 125 3e-31 >Contig3203 Length = 204 Score = 125 bits (313), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 57/81 (70%), Positives = 73/81 (90%) Query: 2 ASEKRLLTVDQGQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQL 61 A +KR L+V+Q + LEK+FEVENKLEPERK++LA++LGLQPRQVA+WFQNRRARWKTKQL Sbjct: 57 AEKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQL 116 Query: 62 EKDYDVLQNSYNSLKADYDNL 82 E+DY VL+ +Y+SLK +D+L Sbjct: 117 ERDYGVLKANYDSLKISFDSL 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11970 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs173106186 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82708 (301 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22106186 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57061 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36548 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82726 (394 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44440 (347 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96195 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35963 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53026 (441 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81965 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16106183 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86545 (400 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4775 565 e-163 >Contig4775 Length = 399 Score = 565 bits (1456), Expect = e-163, Method: Compositional matrix adjust. Identities = 267/383 (69%), Positives = 303/383 (79%), Gaps = 10/383 (2%) Query: 18 EDEPARSYQSXXXXXXXXXXXXNSLAEILPLPDTPGGPWKVYGVARRPKPNWNADHLVEY 77 EDE R+ QS NSLAEILPL DTPGGPWKVYGVARRP+PNWNADH VEY Sbjct: 27 EDEGPRTPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEY 86 Query: 78 VQCDVSDPEETQAMLSQLIDVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAVIPNAPNL 137 +QCDVSD ++ + LS L DVTHIFYVTWTNRSTEAENC+ N +M RNVL +VIPNAPNL Sbjct: 87 IQCDVSDADDAKGKLSPLTDVTHIFYVTWTNRSTEAENCEANAAMLRNVLGSVIPNAPNL 146 Query: 138 RHVCLQTGTKHYLGPFEAFGKIKPYDPPFTEDMPRLDAPNFYYTLEDILFEEVEKKEELS 197 +H+CLQTG KHY+G FE++GKI+P+D PFTED+PRLD PNFYYT ED+LFEEVEK+EEL+ Sbjct: 147 KHICLQTGAKHYIGSFESWGKIQPHDSPFTEDLPRLDVPNFYYTQEDLLFEEVEKREELT 206 Query: 198 WSVHRPDTIFGFSPYSLMNLVGALCVYAAVCKHEGIPLRFPGTKAAWECYSIASDADLIA 257 WSVHRPDTIFGFSPYS+MN+VG+LCVYAA+CKHEG+ LRFPGTKAAW C S ASDADLIA Sbjct: 207 WSVHRPDTIFGFSPYSMMNIVGSLCVYAAICKHEGVLLRFPGTKAAWNCLSTASDADLIA 266 Query: 258 EHQIWAAVDPYAKNEAFNCNNGDVFKWKHLWKVLAEQFGIEDYGLSXXXXXXXXXXXXTQ 317 E IWAAVDPYA+NEAFN NNGDVFKWK WKVLAE + Sbjct: 267 EQHIWAAVDPYARNEAFNINNGDVFKWKQFWKVLAEN----------FGIEEFGFEEEGE 316 Query: 318 RVKLAEFMKGKEGVWEEIVRENQLQPTRLDEVGAWWFVDLVLTGEAKLASMNKSKEHGFS 377 V L + M+GK GVWEEIV+ENQL PT+L+EVG WWFVD VL+GE+ MNKSKEHGF Sbjct: 317 VVGLQKLMEGKSGVWEEIVKENQLVPTKLEEVGVWWFVDAVLSGESMFGCMNKSKEHGFV 376 Query: 378 GFRNSKNSFITWIDKAKGYKIVP 400 GFRNS+NS +TWIDK K YKIVP Sbjct: 377 GFRNSRNSLVTWIDKMKAYKIVP 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs204106188 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92759 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105992 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4317 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26435 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 76 2e-16 >89552756 Length = 189 Score = 75.9 bits (185), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 48/177 (27%), Positives = 83/177 (46%), Gaps = 11/177 (6%) Query: 70 GSINRYVREHCRDITESIVRNFTRHILNGLAYLHSTNTIHRDIKGANLLVDASG----VV 125 GS+ +++++ R I G+ YLH N +H D+K NLLV+ V Sbjct: 4 GSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQRPVC 63 Query: 126 KLADFGMAKHLTGLSYELSLKGSPNWMAPEVIKAVMQKDGNPKLALAVDIWSLGCTVIEM 185 K+ D G++K ++G+ WMAPE++ + + +D++S G + E+ Sbjct: 64 KIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSG-----KSHMVTEKIDVYSFGIVMWEL 118 Query: 186 LTGKPPWSEFEGPQAMFKVLNRT--PPIPEMLSSEGKDFLLRCFLRNPVERPSAVEL 240 LTG P+++ + ++N T P IP E K + C+ P +RPS E+ Sbjct: 119 LTGDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEI 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60385 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75192 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs171106184 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4515 245 1e-67 >Contig4515 Length = 469 Score = 245 bits (625), Expect = 1e-67, Method: Compositional matrix adjust. Identities = 111/172 (64%), Positives = 127/172 (73%) Query: 3 FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGT 62 FQLY SG+FTGRCGT+LDHGV VGYGTE+G+DYWIV+NSWG SWGE GYIRMERN+ + Sbjct: 282 FQLYSSGVFTGRCGTALDHGVAVVGYGTEHGSDYWIVRNSWGDSWGESGYIRMERNLGNS 341 Query: 63 LTGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXAVCDNYYSCPESNTCCCVFEYGNSC 122 TGKCGIAME SY VCDNY+SCPESNTCCC+++Y N C Sbjct: 342 ATGKCGIAMEPSYPVKIGQNPPNPGPSPPSPIKPPQVCDNYFSCPESNTCCCIYQYQNYC 401 Query: 123 FAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGSEGIATHP 174 FAWGCCPLE ATCCDDHYSCCP DYP+CNV AGTC +SK NP+ + + P Sbjct: 402 FAWGCCPLEGATCCDDHYSCCPSDYPVCNVNAGTCQLSKGNPMSVKALKRTP 453 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59000 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38703 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7708 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22280 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64592 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30017 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27272 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54852 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78136 (347 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 169 2e-44 >Contig1666 Length = 421 Score = 169 bits (429), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 83/156 (53%), Positives = 104/156 (66%), Gaps = 3/156 (1%) Query: 10 SQLNLPPGFRFYPTDEELLVQYLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEK- 68 S +L PGFRF+PTDEEL+ YL RKVAG+ F I +D+YK +PW LP K+ + Sbjct: 5 SSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLKSRD 64 Query: 69 -EWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKG 127 EWYFFS DRKY N SR NR GYWK TG D+ + R VG+KK LVF+ G+APKG Sbjct: 65 TEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHSSRAVGMKKTLVFHSGRAPKG 124 Query: 128 TKTNWIMHEYRL-FEPSRKNGSSKLDDWVLCRIYKK 162 +TNW+MHEYRL + K G + D +VLCRI++K Sbjct: 125 ARTNWVMHEYRLDNQELEKAGIVEKDAYVLCRIFQK 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54271 (51 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36395 (380 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100466 (345 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3652 215 3e-58 >Contig3652 Length = 310 Score = 215 bits (547), Expect = 3e-58, Method: Compositional matrix adjust. Identities = 113/302 (37%), Positives = 170/302 (56%), Gaps = 32/302 (10%) Query: 1 MATPLNKRFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLIIESK 60 M++ + +SA +RT +W+FSQEIP+D+ V VGE +F LHKF LV+K YIRKL+ ES Sbjct: 19 MSSKKKELLTSALKRTSEWIFSQEIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLVSEST 78 Query: 61 EADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCENNLA 120 + +++ I L ++PGG E FE AAKFCYG+NFEI+ N+A LRC +E+L MT++Y NL Sbjct: 79 DDEISVIELPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVSEYLLMTEEYAIGNLV 138 Query: 121 GRTEDFXXXXXXXXXXXXXXXXKSCEALLPLAEDLLIVQRCIDVATAKACYEANFPC--- 177 GRT+ + + E+ LP+AE + +V RCID C ++ F C Sbjct: 139 GRTDAYLNEVALKSLAGAVSVLHTAESFLPIAEKVKLVSRCIDAIAYMTCKDSQF-CLSG 197 Query: 178 ---------------RTPP--NWWTEELSIIDIEFFSRIIAAMKKRGAKALTIASALITY 220 +T P +WW E+L+++ I+ F R + AM RG K + L+ Y Sbjct: 198 RSDSGNESLSSSAVYQTKPIVDWWAEDLTVLRIDTFQRALIAMMARGFKQYALGPILMLY 257 Query: 221 TERSLRDLVRDHSAGNGTKSSDAQSTNSQVRYQQRELLESIVSLMPSEKAAFPIN-FLCC 279 ++SLR +R + + +++R +LE+IVSL+P EK + FLCC Sbjct: 258 AQKSLRGNIRQGK----------EKIEPRQEHEKRVVLETIVSLLPREKIQCQLAFFLCC 307 Query: 280 LL 281 + Sbjct: 308 FV 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74272 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3203 76 3e-16 >Contig3203 Length = 204 Score = 75.9 bits (185), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 44/103 (42%), Positives = 58/103 (56%), Gaps = 7/103 (6%) Query: 126 DEDGDTSRKKLRLSKDQSAILEESFKEHNTLNPXXXXXXXXXXGLRPRQVEVWFQNRRAR 185 +E G + KK RLS +Q LE++F+ N L P GL+PRQV VWFQNRRAR Sbjct: 51 EESGHVAEKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRAR 110 Query: 186 TKLKQTEVDCEFLKR-------CCENLTEENRRLQKEVQELRA 221 K KQ E D LK ++L +N+ L KE++EL+A Sbjct: 111 WKTKQLERDYGVLKANYDSLKISFDSLQHDNQALHKEIKELKA 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36641 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60159 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3391 63 2e-12 >Contig3391 Length = 390 Score = 62.8 bits (151), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 28/74 (37%), Positives = 45/74 (60%) Query: 46 WAISLLLNNRHALKRAHEELDQQVGKERAVDESDTQNLVYLQAIIKETLRLYPAGPLLAP 105 WA++ L+ N ++A +ELD+ +G ER + E+D L YLQ + KE LR++P PL+ P Sbjct: 317 WAMAELIKNPRVQQKAQKELDRVIGLERVMTETDFSGLPYLQCVAKEALRMHPPTPLMLP 376 Query: 106 REAMEDCTVSGYHV 119 A + + GY + Sbjct: 377 HRANANVKIGGYDI 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66686 (338 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8647 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16055 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27028 (238 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103613 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64862 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3724 106 1e-25 >Contig3724 Length = 251 Score = 106 bits (265), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 51/85 (60%), Positives = 63/85 (74%) Query: 165 QPTCPINAXXXXXXXXXXXXXVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLN 224 + TCPI+ VHIGLG+PV N CCPVL GL+ELEAA+CLCT +++KLLN Sbjct: 165 KDTCPIDTLKLGACVDLLGGLVHIGLGDPVVNECCPVLSGLVELEAAVCLCTALKIKLLN 224 Query: 225 LNIFIPLALPALITCGKTPPPGFVC 249 LNIF+P+AL L+TCGK+PPPGF C Sbjct: 225 LNIFVPIALQLLVTCGKSPPPGFTC 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9104 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104818 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 123 4e-31 >Contig2950 Length = 216 Score = 123 bits (309), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 66/152 (43%), Positives = 89/152 (58%), Gaps = 11/152 (7%) Query: 2 IWDXXGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVG 61 IWD GQER+R ITS+YYRGA G ++VYDVT +F NV++WL E+ + N+ +LVG Sbjct: 65 IWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVG 124 Query: 62 NKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTNGEQAFMAMAASIKDRMASQPSMN 121 NK DL + VS E AKAFA+ FMETSA +S N E AF + I ++ S+ ++ Sbjct: 125 NKADLRHLRAVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIY-QVVSRKALE 183 Query: 122 NARPPTVQIKGQPV----------AQKSGCCS 143 P KGQ + +K+GCCS Sbjct: 184 VGDDPAAVPKGQTINVGGKDDVSAIKKAGCCS 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96106185 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25519 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29709 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99245 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61199 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43896 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73216 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95113 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69600 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs159106185 (315 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27951 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1399 194 3e-52 >Contig1399 Length = 143 Score = 194 bits (493), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 88/144 (61%), Positives = 119/144 (82%), Gaps = 1/144 (0%) Query: 92 FRDDSKKTTMRLVEMESSYLTVDFFRKLPQDMERGGNPTAPSAADRYTEGHFRRIGSNVS 151 R++SKK T++LV+ME SYLTVDFFRKLPQD+++GGNP+ S DRY + + RRIGSNV Sbjct: 1 MREESKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPSH-SLFDRYNDSYLRRIGSNVL 59 Query: 152 SYVGMVSETLKNTIPKAVVHCQVKEAKRSLLDHFYAQLGKKEGKQLAQLLDEDPMLMERR 211 +YV MV +L+N+IPK+VV+CQV+EAKRSLLD F+ +GK + KQL+ LL+EDP +MERR Sbjct: 60 AYVNMVCASLRNSIPKSVVYCQVREAKRSLLDRFFTDMGKLDAKQLSSLLNEDPAVMERR 119 Query: 212 QQCAKRLELYKSARDEIDSVSWTR 235 AKRLELY+SA+ E+D+V+W++ Sbjct: 120 SALAKRLELYRSAQAEMDTVAWSK 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42834 (50 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54723 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101682 (347 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs208106187 (302 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18608 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30681 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 63 2e-12 >89552756 Length = 189 Score = 62.8 bits (151), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 13/131 (9%) Query: 1 MPNRSVQDHLTSRFQATLPWNTRLKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLD-- 58 M N S++ L + T+ RL IA DAA G+ YLH I+ D K N+L++ Sbjct: 1 MVNGSLKQFLQKK-DRTIDRRKRLIIAMDAAFGMEYLHGK---NIVHFDLKCENLLVNMR 56 Query: 59 --EQWNAKLSDFGLARLGPSDGLSHVSTAVVGTIGYAAPEYI--QTGRLTYKSDIWSFGV 114 ++ K+ D GL+++ + VS V GT+ + APE + ++ +T K D++SFG+ Sbjct: 57 DPQRPVCKIGDLGLSKVKQQ---TLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGI 113 Query: 115 FLYELITGRRP 125 ++EL+TG P Sbjct: 114 VMWELLTGDEP 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35401 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4564 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65452 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62644 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80643 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63673 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2427 323 5e-91 >Contig2427 Length = 260 Score = 323 bits (828), Expect = 5e-91, Method: Compositional matrix adjust. Identities = 149/208 (71%), Positives = 173/208 (83%), Gaps = 2/208 (0%) Query: 1 MGGAVGYGNLYSQGYGTNTAALSTALFNNGXSCGSCYEMKCENDPKWCLPG--SIIVTAT 58 MGGA GYGNLYSQGYG NTAALSTALFNNG SCG+C+E+KC +DP+WC G SI VTAT Sbjct: 51 MGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTAT 110 Query: 59 NFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFT 118 NFCPPN A +DNGGWCNPP HFD+A P FL+IA+Y+AGIVP+S+RR+PC KKGGIRFT Sbjct: 111 NFCPPNFAQPSDNGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFT 170 Query: 119 VNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLT 178 +NGH YFNLVL+TNV GAGD+ SVS+KG+ TGW MSRNWGQNWQSNS L GQ+LSF++ Sbjct: 171 INGHKYFNLVLVTNVAGAGDIVSVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVR 230 Query: 179 ASDGRTVTSNNVVPGNWQFGQTFEGGQF 206 SD R+ T+ NV P NWQFGQT+ G F Sbjct: 231 GSDRRSSTTYNVAPANWQFGQTYSGKNF 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93621 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3402 208 2e-56 >Contig3402 Length = 192 Score = 208 bits (529), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 110/181 (60%), Positives = 126/181 (69%), Gaps = 16/181 (8%) Query: 40 ELANSQQKNPEDSENKNQRVVLALYDALKSRDVETVHKILAPDLEWWFHGPPTHQFMMHL 99 ELA SQ+ + DS++ N R+VL LYDAL SRDV TVH I+A DLEWWFHGPPTHQF+M + Sbjct: 28 ELALSQEPD-SDSDSSNHRLVLTLYDALSSRDVATVHTIVAADLEWWFHGPPTHQFLMRM 86 Query: 100 LTGXXXXXXXXXXXFVFVPLSITSFGPIVLAEGCDHSRQISWVHAWTVADGIITQVREYF 159 LTG FVF P S+ S GP+VL EG D +++ISWVHAWTV DGI+TQVREYF Sbjct: 87 LTGEKNDES-----FVFRPQSVCSVGPVVLVEGSDPAKEISWVHAWTVTDGIVTQVREYF 141 Query: 160 NTSLTVTRFGKDLSGQSQRKKSPPSDFPSTAEINPVHCPSVWESSVSNRDGKSVPGLVLA 219 NTSLTVTR G + K STAEI HCPSVWES SN GKSVPGLVLA Sbjct: 142 NTSLTVTRLGNSTTKSKISK--------STAEITSYHCPSVWES--SNPVGKSVPGLVLA 191 Query: 220 L 220 + Sbjct: 192 I 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57144 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs145106181 (301 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91166 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6613 (344 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81812 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10163 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46488 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37779 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25409 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 71 7e-15 >Contig3804 Length = 391 Score = 71.2 bits (173), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 35/83 (42%), Positives = 45/83 (54%), Gaps = 6/83 (7%) Query: 146 PKAVPMKHVSNAQVAKPTKL-----YRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTXXX 200 PK V N+Q K K YRG+RQR WGKW AEIR P+ R+WLGTF+T Sbjct: 94 PKTVKSVEC-NSQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEE 152 Query: 201 XXXXXXXXXXKLRGEFARLNFPH 223 ++RG+ A++NFP Sbjct: 153 AARAYDAEARRIRGKKAKVNFPE 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11732 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67400 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36796 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68699 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4980 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24434 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2330 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4097 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97786 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100716 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18453 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40125 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8517 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104138 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64315 (311 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70486 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69533 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58599 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105279 (292 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89542277 102 3e-24 >89542277 Length = 231 Score = 102 bits (253), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 74/235 (31%), Positives = 114/235 (48%), Gaps = 21/235 (8%) Query: 39 PMAASTTSIKPVDQTIIRRSADYGPTIWSFDYIQSLDSKYKGESYARQLEKLKEQVSAML 98 P A KP ++RR+A++ P++W + + Q+E+LK+ V + Sbjct: 7 PAAECQIISKP---EVVRRTANFKPSVWGDRFTNYAEDIRTQAQMQEQVEELKQVVRKEV 63 Query: 99 QQDNKVVDLDPLHQLDLIDNLHRLGVSYHFEDEIKRTLDRIHNK-----NTNKSLYATAL 153 D D QL LI + RLGV+YHFE EI++ L+RIH + + LY AL Sbjct: 64 FTDAAA---DSSRQLKLIAAIQRLGVAYHFETEIEQALERIHATYQDIHDDDGDLYNVAL 120 Query: 154 KFRILRQYGYNTPVKESFSRFMDEKGSFKLSSHSDECKGMXXXXXXXXXXXXXXSSIFRD 213 +FR+LR++GYN + F++F D G FK S +D GM ++ + Sbjct: 121 RFRLLRRHGYNVSC-DVFNKFKDTNGDFKKSLVTD-VSGM-LCFYEAAHLRVHGETLLEE 177 Query: 214 AIRFTTAYLKEWVAKHDIDKNDDEYLCTLVKHALELPLHWRMRRLEARWFIDVYE 268 A+ FTT +L+ A + L T + ALE PL M RL AR ++ +Y+ Sbjct: 178 ALVFTTTHLESASAISSL-------LKTPITEALERPLLKTMERLGARRYMSIYQ 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60403 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158361591 70 2e-15 >158361591 Length = 219 Score = 70.5 bits (171), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 41/86 (47%), Positives = 51/86 (59%), Gaps = 6/86 (6%) Query: 8 LKVIFILQVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPEN 67 + V I VFSAFG V KI FEK QALVQ+ D TA+ A+ AL+G I + Sbjct: 5 VTVDVIHTVFSAFGTVQKIAIFEKNCQTQALVQYPDIATAAVAREALEGHCI------YD 58 Query: 68 MGPCTLRITYSAHTDLSVKFQSHRSR 93 G C L ++YS HTDL+VK S +SR Sbjct: 59 GGYCKLHLSYSRHTDLNVKAYSDKSR 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21917 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42535 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67272 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1742 108 2e-26 >Contig1742 Length = 369 Score = 108 bits (271), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 81/174 (46%), Positives = 98/174 (56%), Gaps = 39/174 (22%) Query: 20 GKKIGVTVTEKLSPVYEKVAGAGSTLMSKIPG--TTNTG---SEKEHGVGAQDKGVSVKD 74 GK I TV EKLSPVY KVAGAG+ +MSK G T +TG S + G +DK SVKD Sbjct: 193 GKPITSTVAEKLSPVYGKVAGAGTAVMSKFKGGSTASTGRDTSTEAVGEAGKDKRGSVKD 252 Query: 75 YFAEKLRPGEEDRALSQVITEALRKKKAKQENKSTSSRPVTEVVSDALHNRNEEPEEITS 134 Y EKL PGEEDRALS+VI+E L+ K V E D+ ++ Sbjct: 253 YLVEKLSPGEEDRALSKVISEKLQIHKPG----------VKEQGGDS----------ASA 292 Query: 135 RPMGKVTESEEVARRLGTTEHDTSNEGIDSSFVNNSNMGVVGKIKGAVGSWFGG 188 +PMGKVTESEEV +RLG+T EG D+ VN KI+ +VGS GG Sbjct: 293 KPMGKVTESEEVRQRLGST------EGNDNYVVN--------KIEDSVGSMLGG 332 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84538 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4512 385 e-110 >Contig4512 Length = 440 Score = 385 bits (989), Expect = e-110, Method: Compositional matrix adjust. Identities = 183/216 (84%), Positives = 191/216 (88%) Query: 1 MCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPII 60 MC L INDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPI+ Sbjct: 225 MCALFINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIV 284 Query: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQS 120 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIF+ D+V D DIVKLVDTFPGQS Sbjct: 285 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCTGIFKADSVPDSDIVKLVDTFPGQS 344 Query: 121 IDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIV 180 IDFFGALRARVYDDEVR W LVNSKE PTFEQP+MT+EKLLEYGNM+V Sbjct: 345 IDFFGALRARVYDDEVRKWISGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 404 Query: 181 QEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 216 QEQENVKRVQLAD+YLSEAALG+ANADAI G FYG Sbjct: 405 QEQENVKRVQLADQYLSEAALGDANADAIDRGTFYG 440 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86125 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30943 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105558 (358 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94948 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60752 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69364 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58905 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101605 (113 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80727 (341 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19180 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47702 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 112 1e-27 >Contig1161 Length = 148 Score = 112 bits (281), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 1/119 (0%) Query: 35 VTQRLQKELMSLMMSGGDLGVSAFPEGESIFTWIGTIEGGKGTMYEGLSYKLSLHFPLDY 94 ++R+ KEL L SA P E +F W TI G + Y G + +++HFP DY Sbjct: 2 ASKRILKELKDLQ-KDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 95 PFKPPQVKFETMCFHPNVDQYGNICLDILQDKWSSAYDCRTILLSIQSLLGEPNPESPL 153 PFKPP+V F T FHPN++ G+ICLDIL+++WS A +LLSI SLL +PNP+ PL Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPL 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93496 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83766 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23937 (65 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39715 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2866 82 2e-18 >Contig2866 Length = 330 Score = 82.0 bits (201), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 43/150 (28%), Positives = 72/150 (48%), Gaps = 7/150 (4%) Query: 10 LTSRFNALGLSNKDLVALAGGHTIGQARCTSFRAHIYNETN--IDASFARTRQGNCPRAN 67 + +F+A+G+ +VAL G H++G+ C +Y E + ++ CP + Sbjct: 176 VLEKFSAMGIDTPGVVALLGAHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLKKCP--D 233 Query: 68 GTGDNNLAPL---DLQTPTSFDNNYFKNLVNRKGLLHSDQQLFNGGSTDSQVRTYSNNPS 124 D D TP FDNNY++N+++ KGL+ D QL T V+ + + Sbjct: 234 AIPDPKAVQYVRNDRGTPMIFDNNYYRNILDNKGLMMVDHQLATDKRTKPYVKKMAKSQD 293 Query: 125 TFSSDFVAGMIKMGDISPLTGSRGEIRKNC 154 F +F + + +PLTG +GEIR+ C Sbjct: 294 YFFKEFTRAFTILSENNPLTGDKGEIRQQC 323 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86870 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99356 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78954 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5788 154 5e-40 >Contig5788 Length = 224 Score = 154 bits (388), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 73/131 (55%), Positives = 95/131 (72%), Gaps = 4/131 (3%) Query: 81 RSLSQVLNFMDQMTENPFFSGTRG----GLRRGWDAKETDDALNLSIDMPGLGKEDVRVS 136 RSLSQVLN MDQ ENP+ + RG G RRGWD KET+D+L L +DMPGL KEDV++S Sbjct: 94 RSLSQVLNLMDQFMENPYLAAYRGLGAGGSRRGWDVKETEDSLLLRMDMPGLNKEDVKIS 153 Query: 137 LEQNTLVIRXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEE 196 +EQ TL ++ RR+++R+DLP K+Y + IKAEMKNGVLK+ VPKVKEE Sbjct: 154 VEQGTLTVKGEGKDPEGEEDGGRRFSTRLDLPAKIYELNSIKAEMKNGVLKLVVPKVKEE 213 Query: 197 ERADVFQVKVD 207 E+ +VF+VK++ Sbjct: 214 EKKNVFEVKIE 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25592 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16351 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs648 (238 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35726 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63760 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85452 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94336 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4661 96 3e-22 >Contig4661 Length = 251 Score = 95.5 bits (236), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 59/145 (40%), Positives = 75/145 (51%), Gaps = 16/145 (11%) Query: 41 VRAASTPPVKQGADRPLWFASKQSLSYLDGSLPGDYGFDPLGLS-DPEGTGGFIEPKWLA 99 V + S K A + W S YL GSLPGD GFDPL L+ DPE KW Sbjct: 39 VTSPSASSFKVEAKKGEWLPGLPSPGYLTGSLPGDNGFDPLALAEDPENL------KWFV 92 Query: 100 YGEVINGRYAMLGAVGAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFV 159 E++NGR+AMLG G + PE+L G+I W+ AG Y+A TLFV Sbjct: 93 QAELVNGRWAMLGVAGMLLPEVLTSIGII---NVPKWYD------AGKAEYFASSSTLFV 143 Query: 160 LEMALMGFAEHRRFQDWANPGSMGR 184 +E L + E RR+QD NPGS+ + Sbjct: 144 IEFILFHYVEIRRWQDIKNPGSVNQ 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97567 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22021 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4775 286 5e-80 >Contig4775 Length = 399 Score = 286 bits (733), Expect = 5e-80, Method: Compositional matrix adjust. Identities = 134/178 (75%), Positives = 148/178 (83%) Query: 39 NSLAEILLRSDTPVGPWKVYGVARHPRPNWNDDYPVEYIQCDVSDQEDTQAKLSKLTDIT 98 NSLAEIL SDTP GPWKVYGVAR PRPNWN D+PVEYIQCDVSD +D + KLS LTD+T Sbjct: 49 NSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEYIQCDVSDADDAKGKLSPLTDVT 108 Query: 99 HIFYVTWASRRTEAENCQINGAMFHNVLSSVIPNAPNLRHICLQTGGKHYVGPFEFVGKI 158 HIFYVTW +R TEAENC+ N AM NVL SVIPNAPNL+HICLQTG KHY+G FE GKI Sbjct: 109 HIFYVTWTNRSTEAENCEANAAMLRNVLGSVIPNAPNLKHICLQTGAKHYIGSFESWGKI 168 Query: 159 PSHDPPFTEDLPRLNVTLFYYTLEDILFKEIDKREGLTWSVHRPHGIFGFSXYSLMNI 216 HD PFTEDLPRL+V FYYT ED+LF+E++KRE LTWSVHRP IFGFS YS+MNI Sbjct: 169 QPHDSPFTEDLPRLDVPNFYYTQEDLLFEEVEKREELTWSVHRPDTIFGFSPYSMMNI 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42309 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43713 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17126 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54924 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1166 89 1e-20 >Contig1166 Length = 136 Score = 88.6 bits (218), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 52/105 (49%), Positives = 64/105 (60%), Gaps = 2/105 (1%) Query: 21 VSRSHKAGLQFPVGRIARFLKAGKYAE-RVGAGAPXXXXXXXXXXXXXXXXXXGNAARDN 79 VSRS +AG+QFPVGRI R LK A RVGA A GNA++D Sbjct: 29 VSRSSRAGIQFPVGRIHRQLKQRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDL 88 Query: 80 KKNRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLPK 124 K RI PRH+QLA+R DEEL L+ TIA GGV+P+IH++L+ K Sbjct: 89 KVKRITPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINK 132 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48309 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18494 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21219 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52434 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25776 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 89 6e-21 >89552756 Length = 189 Score = 89.0 bits (219), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 2/93 (2%) Query: 1 MAPEFLRGEPS--NEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQN 58 MAPE L G+ EK DVYSFG+++WEL+T +P+ + A ++G + R IP Sbjct: 90 MAPELLSGKSHMVTEKIDVYSFGIVMWELLTGDEPYTDMHCASIIGGIVNNTLRPQIPTW 149 Query: 59 TSPVLASLMESCWADDPAQRPSFANIVESLKKL 91 P SLMESCW +PAQRPSF+ I + L+ + Sbjct: 150 CDPEWKSLMESCWGSEPAQRPSFSEISQKLRNM 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84445 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs167106188 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68010 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2138 (77 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22808 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82041 (309 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22543 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32325 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44620 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73702 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33185 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158373278 189 6e-51 >158373278 Length = 103 Score = 189 bits (480), Expect = 6e-51, Method: Compositional matrix adjust. Identities = 89/97 (91%), Positives = 93/97 (95%) Query: 32 FPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQ 91 +PLTL FSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQ Sbjct: 2 YPLTLQFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQ 61 Query: 92 DLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKH 128 DLLDQPN ADPAQT+GYQLFIQ+PAEYKRRV+QQAK Sbjct: 62 DLLDQPNAADPAQTEGYQLFIQEPAEYKRRVKQQAKQ 98 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103953 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51332 (318 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78801 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10052 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11581 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43283 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39205 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42863 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19328 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 85 2e-19 >Contig2950 Length = 216 Score = 85.1 bits (209), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 55/167 (32%), Positives = 83/167 (49%), Gaps = 14/167 (8%) Query: 6 FIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQ 64 K V +GD VGK+ +L +T N F + T+ F+ + VD V +WDTAGQ Sbjct: 12 LFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQ 71 Query: 65 EDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELR-HYAPGVPIILVGTKLDLR 123 E Y + YRGA +L + + ++ENV ++W+ ELR H + I+LVG K DLR Sbjct: 72 ERYRAITSAYYRGAVGALLVYDVTRHVTFENV-ERWLKELRDHTDSNIVIMLVGNKADLR 130 Query: 124 DDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVF 170 H AV + A+ R+ + ++E S+ NV+ F Sbjct: 131 --------HLRAVSVEDAKAFAERE---NTFFMETSALESMNVENAF 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97586 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28459 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs126106184 (292 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22657 (276 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61780 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 116 9e-29 >Contig4694 Length = 351 Score = 116 bits (290), Expect = 9e-29, Method: Compositional matrix adjust. Identities = 55/135 (40%), Positives = 87/135 (64%), Gaps = 3/135 (2%) Query: 5 LNIKDEEMIEFFENGLQGMRMNYYPPCPQPEKVMGLSPHSDAAALTILLQLNEVEGLQVK 64 L + ++ +F++ +R+N+YPPCP PE +G+ H D ALT+L Q +EV GL+VK Sbjct: 183 LGLPEDRFKGYFKDQTSFIRLNHYPPCPSPELALGVGRHKDGGALTVLAQ-DEVGGLEVK 241 Query: 65 K--DGKWIPVTPLPDAFIVNIGDTLEIITNGTYRSIEHRAVVNSVQERLSVATVYSVRYD 122 + DG+WI V P P+A+I+N+GD +++ +N Y S+EHR +VNS +ER SV + + Sbjct: 242 RKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHRVMVNSEKERFSVLFFLNPAHY 301 Query: 123 GEVYPASSLISEKTP 137 EV P L +++ P Sbjct: 302 TEVKPLEELTNKQNP 316 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47542 (355 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 164 8e-43 >Contig4694 Length = 351 Score = 164 bits (414), Expect = 8e-43, Method: Compositional matrix adjust. Identities = 95/301 (31%), Positives = 156/301 (51%), Gaps = 28/301 (9%) Query: 71 ACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEGFGQAFVVSEE 130 ACK WGFFQ++NHGV EKV+ + FF +EEK+K + V G+ +E Sbjct: 56 ACKNWGFFQVINHGVPLEMREKVETTARKFFAQPLEEKRKIRRDEKCVVGYYD----TEH 111 Query: 131 QK--LDWADIFS-MITLPVXXXXXXXXXXXXXXX------------XDTLEVYSMELKSL 175 K DW +++ ++ P + +E YS E++ L Sbjct: 112 TKNVRDWKEVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREVMEDYSQEVEKL 171 Query: 176 AMNLISKMGKVLNIKDEELREFFENGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILL 235 ++ L+ + L + ++ + +F++ +R+N+YPPCP PE +G+ H DG ALT+L Sbjct: 172 SLKLMGLIALSLGLPEDRFKGYFKDQTSFIRLNHYPPCPSPELALGVGRHKDGGALTVLA 231 Query: 236 QINEVEGLQI--KNDGKWIPITPLPNAFIVNIGDTLEIITNGTYRSIEHRAIVNSLQERL 293 Q +EV GL++ K DG+WI + P PNA+I+N+GD +++ +N Y S+EHR +VNS +ER Sbjct: 232 Q-DEVGGLEVKRKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHRVMVNSEKERF 290 Query: 294 SIATFYTKRLDGEIYPASSLISEKTPALFRRVTVEEYFRNRYARELRGKSQLDDLRIQNG 353 S+ F E+ P L +++ PA + + ++ LR S L+ +N Sbjct: 291 SVLFFLNPAHYTEVKPLEELTNKQNPAKYTPYSWGKFLT------LRKLSNFKKLKAENI 344 Query: 354 Q 354 Q Sbjct: 345 Q 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41683 (117 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42594 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52127 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49233 (326 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74261 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38375 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77012 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12574 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82250 (371 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67211 (534 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs14331 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59112 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 112 2e-27 >Contig4694 Length = 351 Score = 112 bits (280), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 87/261 (33%), Positives = 120/261 (45%), Gaps = 29/261 (11%) Query: 17 GTIPAEFVRPEKEQPASATYHGPAPEIPTIDLD-----DPVQD-----RLVRSIAEASRE 66 G + F++ + +P + A +P IDL D + D LVR I A + Sbjct: 2 GEVDPAFIQDPEHRPKLSIIE--ADGVPLIDLSPLTSADSISDPKAIEVLVREIGNACKN 59 Query: 67 WGIFQVTNHGIPSDLIGKLQAVGKEFFELPQEEKEVYSRPADAKDVQGY-GTKLQKEVEG 125 WG FQV NHG+P ++ K++ ++FF P EEK R D K V GY T+ K V Sbjct: 60 WGFFQVINHGVPLEMREKVETTARKFFAQPLEEKRKIRR--DEKCVVGYYDTEHTKNVRD 117 Query: 126 KKSWVDHLFHR-VWPPSSIN---------YRFWPNNPPSYRAVNEEYAKYMREVVDKLFT 175 K D L PSS + WP NPP R V E+Y++ + ++ KL Sbjct: 118 WKEVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMG 177 Query: 176 YXXXXXXXXXXXXKEAAGGDDIEYMLKINYYPPCPRPDLALGVVAHTDLSALTVLVPNEV 235 K D +++N+YPPCP P+LALGV H D ALTVL +EV Sbjct: 178 LIALSLGLPEDRFK--GYFKDQTSFIRLNHYPPCPSPELALGVGRHKDGGALTVLAQDEV 235 Query: 236 PGLQVFK--DDRWIDAKYIPT 254 GL+V + D WI + P Sbjct: 236 GGLEVKRKTDGEWIRVRPTPN 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38000 (392 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56536 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85578 (430 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95552 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91435 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5331 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79000 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105603 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39278 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4859 63 9e-13 >Contig4859 Length = 544 Score = 63.2 bits (152), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 30/56 (53%), Positives = 38/56 (67%) Query: 98 ASQLCGIDREARVLRYREKRKNRKFEKTIRYHSRKAYAETRPRIKGRFAKRAEADS 153 A L REA ++++R KRK+R FEK +RY SRK AE RPR+KG+F RA DS Sbjct: 481 ADSLRASQREAALIKFRLKRKDRCFEKKVRYQSRKILAEKRPRVKGQFVHRAHIDS 536 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44750 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100106185 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs662 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26023 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25616 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78642 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1445 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12237 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89842 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs137106189 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2618 (306 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44282 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9399 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82816 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27337 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32211 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92457 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29929 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18655 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55982 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88949 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47688 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10102 (280 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40482 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig258 162 4e-43 >Contig258 Length = 254 Score = 162 bits (411), Expect = 4e-43, Method: Compositional matrix adjust. Identities = 75/103 (72%), Positives = 90/103 (87%), Gaps = 2/103 (1%) Query: 1 MDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGS 60 MDGAPYLRKVDLK+Y +Y ELS+AL KMFS FTIG C S G+ +D ++ES+L+DLL+GS Sbjct: 143 MDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGM--KDFMNESKLIDLLNGS 200 Query: 61 EYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGLG 103 EYV +YEDKDGDWMLVGDVPW+MF ++C+RLRIMKGSEAIGL Sbjct: 201 EYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77124 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88183 (323 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17782 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57896440 62 3e-12 >57896440 Length = 244 Score = 61.6 bits (148), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 5/67 (7%) Query: 10 NFYAVLGLNKECTATELRNAYKKLALRWHPDRCSASGNAKFVDEAKKKFQTIQHAYSVLS 69 ++Y +L + K T EL+ AY+KLA++WHPD+ N EA+ KF+ I AY VLS Sbjct: 4 DYYKLLQVEKSATEDELKKAYRKLAMKWHPDK-----NPTNKKEAETKFKQISEAYEVLS 58 Query: 70 DANKRLL 76 D KR + Sbjct: 59 DPQKRAI 65 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56537 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56128 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103996 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64687 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs31178 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102106185 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76075 (343 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43787 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99914 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93563 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4405 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs876 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61313 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34817 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37806 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65146 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33157 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1663 192 1e-51 >Contig1663 Length = 176 Score = 192 bits (488), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 107/177 (60%), Positives = 122/177 (68%), Gaps = 8/177 (4%) Query: 6 VDQWTVTKPSRSDEVLDAVEQVRIANQVRAQIDSMAPKRPTKPNRSEPDFIAPTNDQSAA 65 V Q TVTKPSRSD VLDA EQ+RI+ Q++AQ +S APKRP KPNRSEPD +PT S Sbjct: 2 VGQSTVTKPSRSDHVLDADEQLRISTQIKAQFESAAPKRPMKPNRSEPD--SPTPALSIV 59 Query: 66 NG-NIPELDKLRSLQSQSHVGVIYSAEVNNTAQDEFVETQYYNQLVSIDKDHHTTGTGFI 124 + NIPEL KLR+LQSQSHV +I N+ QDEFV+TQYY +L SIDK HH TGTGFI Sbjct: 60 DQPNIPELHKLRTLQSQSHV-IISDEGANSLVQDEFVDTQYYKELNSIDKQHHMTGTGFI 118 Query: 125 RVANEGNGYNIRVGKGCDSGD----RPVYKSNPATNDWIPSVEYDQAFISSKPNRSE 177 RV E G N G G R ++SNPATNDWIP + D FISSKPNRSE Sbjct: 119 RVEREEEGSNDIQLTGIHGGSNGIVRAGFRSNPATNDWIPKTDEDLVFISSKPNRSE 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69044 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99071 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54021 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63669 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50155 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84306 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38831 (59 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs106138 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98185 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16714 (290 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88177 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42878 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35873 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103814 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5766 99 2e-23 >Contig5766 Length = 173 Score = 99.4 bits (246), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 48/55 (87%), Positives = 48/55 (87%) Query: 13 SFPPTNITTEQIQKYLDENKKLILAILDNQNLGKLTECAHYQAQLQKNLMYLAAI 67 S PP ITTEQIQK LDENKKLILAILDNQNLGKL ECA YQ QLQKNLMYLAAI Sbjct: 14 SLPPNTITTEQIQKCLDENKKLILAILDNQNLGKLAECAQYQTQLQKNLMYLAAI 68 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62191 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50906 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69360 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78137 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18778 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158352771 111 1e-27 >158352771 Length = 100 Score = 111 bits (278), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 51/66 (77%), Positives = 57/66 (86%) Query: 53 GSLQPQECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKR 112 GSL+ +C +CT RCSKTQY KPC+FFCQKCCAKCLCVP GFYGNK CPCYNNWKT++ Sbjct: 35 GSLKSSQCPSQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQ 94 Query: 113 GGPKCP 118 GGPKCP Sbjct: 95 GGPKCP 100 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85954 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27524 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9266 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81499 (276 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100262 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83869 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12861 (334 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 260659647 134 6e-34 >260659647 Length = 154 Score = 134 bits (338), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 65/148 (43%), Positives = 95/148 (64%) Query: 10 IPMTRDVSNYDEVAMQQXXXXXXXXXXXXXXRTQLYSAAEYFELSYTNDDQKQIVVETLK 69 + +R +DEV+M++ R QLYSAAEY E SY + +QKQ+V++ LK Sbjct: 3 LEQSRPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDNLK 62 Query: 70 DYAVKALVNTVDHLGSVTYKVNDLLDEKVDEVSDTEHRVSCIEQRLRTCQEYIDHEGLSQ 129 DYAV+ALVN VDHLG+V YK+ DLLD++ +VS + +V+C+ Q+L TC+ ++D EG Q Sbjct: 63 DYAVRALVNAVDHLGTVAYKLTDLLDQQTLDVSTMDLKVTCLNQKLFTCKTFMDKEGARQ 122 Query: 130 QSLVINTPKYHKRYILPVGETMHGAIRT 157 Q L+ P++HK YILP G ++ Sbjct: 123 QQLLPFIPRHHKHYILPNSVNKEGTFQS 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4259 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78990 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57118 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19853 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs90001 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29362 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64554 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59221 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3951 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig119 287 3e-80 >Contig119 Length = 300 Score = 287 bits (735), Expect = 3e-80, Method: Compositional matrix adjust. Identities = 138/188 (73%), Positives = 158/188 (84%), Gaps = 4/188 (2%) Query: 2 LEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXI 61 LEMD+EYEGN+EATGED+SVEP ++RRPFRALLDVGL++TTTGNRVF + Sbjct: 113 LEMDEEYEGNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDV 172 Query: 62 PHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDA 121 PHS+KRFAGFSKD K LDAE HRKYIYGGHVAAYM TL+EDEPEKYQ+HF+EYIKKGI+A Sbjct: 173 PHSEKRFAGFSKDSKSLDAETHRKYIYGGHVAAYMGTLIEDEPEKYQTHFSEYIKKGIEA 232 Query: 122 DGLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV- 180 +G+E LYKKVHAAIRADP KK+ KP PK+HKR+NLKKLTYEERK KL+ERLNA NSA Sbjct: 233 EGIEELYKKVHAAIRADPLEKKTAKPEPKQHKRFNLKKLTYEERKNKLIERLNAFNSAAQ 292 Query: 181 ---DEEDE 185 D +DE Sbjct: 293 GDEDSDDE 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73473 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24051 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78782 (62 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7027 (345 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1473 154 7e-40 >Contig1473 Length = 260 Score = 154 bits (389), Expect = 7e-40, Method: Compositional matrix adjust. Identities = 82/163 (50%), Positives = 103/163 (63%) Query: 63 IVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRVQRKSHR 122 IVLKV MHCE CARKV R LKGFEGVE+V TD K KV+VKG+ ADP+KV +R+Q+KS + Sbjct: 23 IVLKVDMHCEACARKVARALKGFEGVEEVTTDSKASKVVVKGKAADPIKVCERLQKKSGK 82 Query: 123 QVELLSPIXXXXXXXXXXXXXXXXXXXXXXXXXXXQVIIVVLKVHMHCEGCSLEIKKRIL 182 +VEL+SP+ V+ V+LKV MHCE C+ ++KRI Sbjct: 83 KVELISPLPKPPAEEEKKEEPKEPEKKEEKKEEPPAVVTVILKVRMHCEACAQVLQKRIR 142 Query: 183 RMEGVESAEPDLKNSQVTVKGVFDPPKLVDYVYKRTGKHAVIV 225 +++GVES D+ N QV V GV DP KL D VYK+T K IV Sbjct: 143 KIQGVESVVTDVGNDQVVVTGVVDPAKLADDVYKKTRKPVSIV 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36197 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6923 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78980 (276 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158354627 120 1e-29 >158354627 Length = 97 Score = 120 bits (300), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 54/84 (64%), Positives = 66/84 (78%), Gaps = 1/84 (1%) Query: 176 QLTKNLACEWAKDNIRTNTVAPWVIKTSMIKPFEEGPEGSEFLDGIARQTPIGRAGEPDE 235 QL KNLACEWAKDNIR N+VAPWV++T + +P +G L+ + +TP+GR GEP+E Sbjct: 1 QLAKNLACEWAKDNIRINSVAPWVVRTPLAEPMFTD-DGKSLLEAVISRTPLGRIGEPEE 59 Query: 236 VSSLVAFLCLPAASYITGQIICVD 259 VS+LVAFLCLPAASYITGQ CVD Sbjct: 60 VSALVAFLCLPAASYITGQTFCVD 83 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15336 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158354627 124 5e-31 >158354627 Length = 97 Score = 124 bits (311), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 3/93 (3%) Query: 172 QLTKNLACEWGKDNIRVNAVAPWIIRTSLIDSI-EKDPRVMEHASRLIPRTPIPRPGEPN 230 QL KNLACEW KDNIR+N+VAPW++RT L + + D + + A +I RTP+ R GEP Sbjct: 1 QLAKNLACEWAKDNIRINSVAPWVVRTPLAEPMFTDDGKSLLEA--VISRTPLGRIGEPE 58 Query: 231 EVSSVVAFLCLPAASYVTGQVFCIDGGYSVNGF 263 EVS++VAFLCLPAASY+TGQ FC+DGG ++NGF Sbjct: 59 EVSALVAFLCLPAASYITGQTFCVDGGMTINGF 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43015 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3057 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66689 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15036 (36 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104777 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5547 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63670 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96669 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63097 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64004 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100216 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47196 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45790 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40026 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100314 (451 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68006 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62122 (52 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39937 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20899 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32833 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70351 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86885 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10247 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33374 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5193 70 2e-14 >Contig5193 Length = 545 Score = 69.7 bits (169), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 66/247 (26%), Positives = 102/247 (41%), Gaps = 41/247 (16%) Query: 27 GEFNLLLSDWWHRSVHEQEVGLSSRPLRWIGEPQTLLINGRGQFNCSLAAHFSNGSAEQC 86 G++ +L+ DW+ +S H R + + P +LINGRG SL F G Sbjct: 162 GDYTVLIGDWY-KSNHTTLKAHLDRGKK-LPFPDGILINGRGPNQFSLT--FEQG----- 212 Query: 87 KLRGNEQCAPQILHVQPNKTYRLRIXXXXXXXXXXXXVKNHKMVVVEADGNYVQPFEVDD 146 KTYRLRI +++HKM +VE +G + Sbjct: 213 ------------------KTYRLRISNVGLQHSLNFRIQDHKMKLVEVEGTHTLQTTYSS 254 Query: 147 MDIYSGESYSVLLTTNQDPSHNYWISAGVRGRKPETPPALTLLNYHPTSASKIPLSPPPI 206 +D++ G+SYSVL+T +Q P H+Y+I V + TP T H + A P P Sbjct: 255 LDVHVGQSYSVLVTADQ-PGHDYYI---VVSSRFSTPILTTTGILHYSGAGGQVSGPIPG 310 Query: 207 TPRWD---DYDHSKSFSNKIFALMGSPKPPTNFHRRL-------TLLNTQNNINGFTKWA 256 P + ++S + A P P ++H L L + +NG ++ Sbjct: 311 GPTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYILASAAGQVNGKQRYG 370 Query: 257 INNVSLT 263 IN+VS Sbjct: 371 INSVSFV 377 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72575 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64538 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70098 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs162106182 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96823 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94206 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55503 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48074 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4306 320 4e-90 >Contig4306 Length = 275 Score = 320 bits (820), Expect = 4e-90, Method: Compositional matrix adjust. Identities = 150/232 (64%), Positives = 182/232 (78%), Gaps = 1/232 (0%) Query: 26 VAAAKVEQITAQLQTPSDTKAFDSVERIKDGFIHFKREKYEKNPALYSELAKGQSPKYMV 85 VAAAK++Q+TA+L+ + FD VE++K GF+HF+ EK+EK+ LY +LA GQSPK+MV Sbjct: 45 VAAAKIKQLTAELEEAGSNQ-FDPVEKLKSGFVHFRTEKFEKDVDLYGKLATGQSPKFMV 103 Query: 86 FACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVV 145 FACSDSRVCPSH+L+FQPGEAFVVRN+AN+VPP+D TK LHLKV NIVV Sbjct: 104 FACSDSRVCPSHILNFQPGEAFVVRNIANMVPPFDTTKHSGVGAAIEYAVLHLKVENIVV 163 Query: 146 IGHSACGGIKGLMSFPFDGNNSTDFIEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEA 205 IGHS CGGIKGLMS P DG ++DFIE+WV+I PAK+K+ + GD F DQCT EKEA Sbjct: 164 IGHSCCGGIKGLMSIPDDGTTASDFIENWVQICAPAKNKIKSSCGDLSFADQCTSLEKEA 223 Query: 206 VNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFGLSPPLSV 257 VNVSL NLLTYPFVRE +VN TLALKGG+YDFV G FELW LDF ++P L++ Sbjct: 224 VNVSLGNLLTYPFVREAVVNNTLALKGGHYDFVGGGFELWDLDFNITPNLTL 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87925 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs31373 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86931 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92287 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89042 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29916 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87522 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46499 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17185 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5788 76 1e-16 >Contig5788 Length = 224 Score = 76.3 bits (186), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 46/138 (33%), Positives = 75/138 (54%), Gaps = 23/138 (16%) Query: 80 RTVQQMMETMERIMEDPFAYGVTWPSQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGM 139 R++ Q++ M++ ME+P+ G RRG W ++ETE+ +R+D+PG+ Sbjct: 94 RSLSQVLNLMDQFMENPYLAAYRGLGA-----GGSRRG---WDVKETEDSLLLRMDMPGL 145 Query: 140 SRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNV-EF 198 ++ DVK+ VE+ L +K E G E EE+ G +STR+ LP + E Sbjct: 146 NKEDVKISVEQGTLTVKGE----------GKDPEGEED----GGRRFSTRLDLPAKIYEL 191 Query: 199 EKIQAEVKDGVLYITIPK 216 I+AE+K+GVL + +PK Sbjct: 192 NSIKAEMKNGVLKLVVPK 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4145 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26447 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104090 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22681 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72977 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55088 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25814 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4178 67 7e-14 >Contig4178 Length = 303 Score = 67.0 bits (162), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 60/214 (28%), Positives = 92/214 (42%), Gaps = 18/214 (8%) Query: 2 EALLRSQPGAPLTVNQQIICGAGAGVAVSFLACPTELIKCRLQAQSALAGSGQVGVAVKY 61 E ++++ A L+V + ++ G AG P E +K LQ Q+ +KY Sbjct: 28 EGVVKAPSLAVLSVCKSLVAGGVAGGVSRTAVAPLERMKILLQVQNPHN--------IKY 79 Query: 62 GGPVDVAKRVLRSEGGLRGLFKGLVPTMAREVPGNAAMFGVYE-------FVKQYMAGGQ 114 G V K + R+EG RGLF G AR VP +A F YE ++ + G + Sbjct: 80 SGTVQGLKYIWRTEG-FRGLFIGNGTNCARIVPNSAVKFFSYEQASKGILWMYREKTGNE 138 Query: 115 DTSQXXXXXXXXXXXXXXXCFWFSVYPTDVVKSVIQVDDYKNP-KFSGSIDAFKKILKSE 173 D +Q + YP D+V+ I V +P ++ G A +L+ E Sbjct: 139 D-AQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQTEASPYQYRGMFHALSTVLREE 197 Query: 174 GVKGLYKGFGPAMARSVPANAACFLAYEVTRSSL 207 G + LYKG+ P++ VP F YE + L Sbjct: 198 GPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL 231 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12246 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50257 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100144 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158375176 375 e-106 >158375176 Length = 258 Score = 375 bits (963), Expect = e-106, Method: Compositional matrix adjust. Identities = 175/242 (72%), Positives = 203/242 (83%) Query: 1 MNSMLMPSSSSKGLCQNLVVLVGGFETKTGEQWLAFRSDGKYSAADYAKLTSEKISKNHS 60 +N+ + SS G+CQNLV L+GGFETKTGEQWLAFR+DGKYSAADY K+ SE++SK+ + Sbjct: 7 LNAHISLQDSSDGICQNLVTLIGGFETKTGEQWLAFRNDGKYSAADYGKVMSERVSKSRA 66 Query: 61 AGESSWNRFETEQILKCRRYFVIKLFQGAMSGLAYMHDHDRLHQSLGPSSVILNTIVEKD 120 G WN+FE E+ +K RRYFV KL QG M GLAYMHD +RLHQSLGP+SVILNTIVE++ Sbjct: 67 GGGQVWNKFEQEETIKRRRYFVTKLLQGTMRGLAYMHDRERLHQSLGPASVILNTIVERE 126 Query: 121 AAYLVPRLRDLSFSVDISFQNLEEDPGTFSEGLWRRAAAAGAFTPMEKRAFGIADDVYEA 180 A YLVPRLRDL+F VDI + NLE PG SEGLWRRA+ AGAFTPM+KRAFG+ADD+YEA Sbjct: 127 AIYLVPRLRDLAFCVDIRYSNLEGRPGLLSEGLWRRASTAGAFTPMDKRAFGLADDIYEA 186 Query: 181 GLLLAYLAFVTFCEANVMDSLSLQRLLESTFRLDLQATREYCLADDRLLEAVKFLDLGEG 240 GL AYLAFV FCEA MD LSLQRLLE+TF+LDL ATREYCLADD LL+AVKFLDLG+G Sbjct: 187 GLFFAYLAFVPFCEAGTMDGLSLQRLLENTFQLDLGATREYCLADDGLLDAVKFLDLGDG 246 Query: 241 AG 242 AG Sbjct: 247 AG 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49496 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58194 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97309 (65 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12954 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15351 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68189 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93486 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29412 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34148 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47788 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41406 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95655 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55317 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6926 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21597 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80110 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57993 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72948 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66175 (260 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 93 1e-21 >Contig2005 Length = 422 Score = 93.2 bits (230), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 84/241 (34%), Positives = 109/241 (45%), Gaps = 67/241 (27%) Query: 23 RYGLSSMQGWRATMEDAHAAYPDL--DSSTS----FFGVYDGHGGKAVAKFCAKYLHQQV 76 R+G +S+ G R MEDA + +P L D S S F+GVYDGHG VA C LH+ + Sbjct: 124 RFGSTSVCGRRRDMEDAVSIHPKLFNDGSDSDGCHFYGVYDGHGCSHVALKCKDRLHE-I 182 Query: 77 LKHEAYSAGDLVTSAQKAFLRMDEMMRGQRGWRELAILGDKMDKFSGMIEGFIWSPKGGE 136 +K + S Q+ D M R FS M Sbjct: 183 VKQDLES--------QRVVQWKDTMER----------------SFSKM------------ 206 Query: 137 ANDHFDDWTSEEYKQHGFLRYLINRLLIGPHS--DFHGPTS---GSTACVAIIRDKQLVV 191 +E Q G NR L P+ + P GSTA VA++ ++++V Sbjct: 207 ----------DEEVQAG------NRALQNPNCRCELQTPQCDAVGSTAVVAVVTPEKIIV 250 Query: 192 ANAGDSRCVLSRKGQALNLSKDHKPDLEVEKDRILKAGGFI---QVGRVNGSLNLARAIG 248 +N GDSR VL RKG A+ LS DHKPD E RI AGG + RV G L ++RAIG Sbjct: 251 SNCGDSRAVLCRKGAAVPLSSDHKPDRPDELLRIEAAGGRVIYWDGPRVLGVLAMSRAIG 310 Query: 249 D 249 D Sbjct: 311 D 311 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99788 (347 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10194 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 245 1e-67 >158372667 Length = 230 Score = 245 bits (626), Expect = 1e-67, Method: Compositional matrix adjust. Identities = 127/233 (54%), Positives = 159/233 (68%), Gaps = 4/233 (1%) Query: 3 IRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXX 62 + IA G EA P+ RA + EF++T +F+FAG GS MA +KL GA+T + Sbjct: 1 MAKIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKL---GADT-TVALFFI 56 Query: 63 XXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLK 122 +ISGGH+NPAVT G GG+I+L R +LYWI QLL + +C LLK Sbjct: 57 AITHALVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLK 116 Query: 123 FVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFI 182 ++T G TT +L+SGVG V++EI++TF L++TVYAT +DPKKGSL + P GF+ Sbjct: 117 YLTGGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGFV 176 Query: 183 VGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYE 235 VGANILAGGAF GASMNPA SFGPALVSW W +HWVYWVGPLIGGGLAG +YE Sbjct: 177 VGANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYE 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29551 (50 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84643 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8874 (386 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16666 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4278 416 e-119 >Contig4278 Length = 257 Score = 416 bits (1070), Expect = e-119, Method: Compositional matrix adjust. Identities = 207/256 (80%), Positives = 226/256 (88%), Gaps = 5/256 (1%) Query: 3 AATSGAVLNGLGSSFINGGKKSQALLAG--TNRV---TXXXXXXXXXXLPPKKSWIPAVK 57 AAT+GA+LNGL S+F+ GGK+SQ+LL+ RV KKSWIPAVK Sbjct: 2 AATTGAMLNGLNSTFLCGGKRSQSLLSAGAAARVGGSVVAPKRFVVVAAAAKKSWIPAVK 61 Query: 58 GGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQTW 117 GGGN I+PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAM AVVGIFVGQ W Sbjct: 62 GGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMTAVVGIFVGQAW 121 Query: 118 SGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTA 177 SG+PWF+AGADP A+APFSFGSLLGTQLLLMGWVESKRWVDF+NPESQSVEWATPWS+TA Sbjct: 122 SGVPWFQAGADPSAVAPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSKTA 181 Query: 178 ENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIF 237 ENF+N TGEQGYPGGKFFDPL LAGTIKDGVYIPDTEKL+RL++AEIKH+RLAM+AMLIF Sbjct: 182 ENFSNFTGEQGYPGGKFFDPLGLAGTIKDGVYIPDTEKLERLQLAEIKHSRLAMLAMLIF 241 Query: 238 YFEAGQGKTPLGALGL 253 YFEAGQGKTPLGALGL Sbjct: 242 YFEAGQGKTPLGALGL 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104321 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9846 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74106183 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93799 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96440 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2922 57 9e-11 >Contig2922 Length = 223 Score = 56.6 bits (135), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 3/86 (3%) Query: 8 WRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPI-GYVPALVDGDFVVSDS 66 W S +RV L LKG++YEY +++ + S LK NP+ VP LV +++S Sbjct: 10 WSSPYVYRVIWALKLKGVDYEYVEEDVLHNK--SDRLLKYNPVHKKVPVLVHAGKPIAES 67 Query: 67 FAILMYLEEKYPQPPLLPSDLKRKAI 92 IL Y+EE +PQ PLLP D ++A+ Sbjct: 68 AVILEYIEETWPQNPLLPKDPHQRAL 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91836 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23442 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53955 (290 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83716 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12428 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71303 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58152 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1993 69 2e-14 >Contig1993 Length = 585 Score = 68.9 bits (167), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 30/95 (31%), Positives = 58/95 (61%) Query: 1 MLDRKVSLLSGGEKARLAFCKFMVKPSTLLVLDEPTNHLDIPSKEMLEEAISEYKGTVIT 60 M +K SGG + R+A + + T+L+LDEPTNHLD+ + LEE + +++ ++ Sbjct: 207 MQAKKTRDFSGGWRMRIALARALFINPTILLLDEPTNHLDLEACVWLEETLKKFERILVV 266 Query: 61 VSHDRYFVKQIVNRVVEVKDSNLQDYAGDYNYYLE 95 VSH + F+ + ++ ++ L+ Y+G+Y+ Y++ Sbjct: 267 VSHSQDFLNGVCTNIIHMQSKKLKIYSGNYDQYVQ 301 Score = 64.7 bits (156), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 29/84 (34%), Positives = 52/84 (61%) Query: 6 VSLLSGGEKARLAFCKFMVKPSTLLVLDEPTNHLDIPSKEMLEEAISEYKGTVITVSHDR 65 +S LS G+++R+ F + +L+LDEPTNHLDI + + L EA++E+ G ++ VSHD Sbjct: 498 MSNLSDGQRSRVIFAWLAFRQPQMLLLDEPTNHLDIETIDSLAEALNEWDGGLVLVSHDF 557 Query: 66 YFVKQIVNRVVEVKDSNLQDYAGD 89 + Q+ + + ++ + + GD Sbjct: 558 RLINQVAHEIWVCENQAVTRWEGD 581 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82150 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4398 109 1e-26 >Contig4398 Length = 192 Score = 109 bits (272), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 51/97 (52%), Positives = 64/97 (65%) Query: 114 DDYHSFVHGRLPYENLKPDPVXXXXXXXXXXXKIIFTNADKVHAVKVLSRLGLEDCFEGI 173 DD+HSFVHGRLPY LKPD V K+IFTN+DK H + VL RLG+EDCFE I Sbjct: 1 DDFHSFVHGRLPYNLLKPDHVLRGLLLSLPVRKVIFTNSDKNHTITVLKRLGIEDCFESI 60 Query: 174 ICFETLNPTHKNNVSDDEDDIAFVESAASTQLAPMAP 210 ICFETLNPT+ + S D ++ FV+ + + P +P Sbjct: 61 ICFETLNPTNSADGSADAEETDFVQQPNTDAVTPRSP 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48463 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91467 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49404 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69188 (430 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51345 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49303 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig303 103 3e-25 >Contig303 Length = 188 Score = 103 bits (257), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 48/61 (78%), Positives = 51/61 (83%) Query: 56 DCGGLCKQRCSLHSRPNLCNRACGTCCVRCKCVPPGTAGNRELCGSCYTDMTTHGNRTKC 115 DC LC+QRCSLHSR C RAC TCC RCKCVPPGT+GNRE CG CYTDMTTHGNR+KC Sbjct: 128 DCIPLCEQRCSLHSRKRTCMRACMTCCDRCKCVPPGTSGNRERCGKCYTDMTTHGNRSKC 187 Query: 116 P 116 P Sbjct: 188 P 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32065 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61082 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99047 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37079 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59665 (426 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33406 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25963 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21624 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78727 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4299 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50930 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11667 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4661 453 e-130 >Contig4661 Length = 251 Score = 453 bits (1166), Expect = e-130, Method: Compositional matrix adjust. Identities = 222/252 (88%), Positives = 235/252 (93%), Gaps = 4/252 (1%) Query: 1 MATVTTQASAAVFRP-CASKSRFLTGSSGKLNREVALKPVSS--SASFKVEAKKGEWLPG 57 MATVTTQASA V+RP SKSRFLTGSSGKL REVA +PV+S ++SFKVEAKKGEWLPG Sbjct: 1 MATVTTQASA-VYRPQITSKSRFLTGSSGKLTREVAFRPVTSPSASSFKVEAKKGEWLPG 59 Query: 58 LASPTYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIG 117 L SP YL GSLPGDNGFDPL LAEDPENLKW+VQAELVN RWAMLGV GMLLPEV T IG Sbjct: 60 LPSPGYLTGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIG 119 Query: 118 IINVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 177 IINVP+WYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP Sbjct: 120 IINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 179 Query: 178 NEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISD 237 NEVGYPGGIFNPLNFAPT+EAKEKE+ANGRLAMLAFLGF+VQHNVTGKGPF+NL+QH+SD Sbjct: 180 NEVGYPGGIFNPLNFAPTEEAKEKEIANGRLAMLAFLGFVVQHNVTGKGPFDNLVQHLSD 239 Query: 238 PWHNTIVQTLSG 249 PWHNTIVQTL G Sbjct: 240 PWHNTIVQTLRG 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41729 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1 (309 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59106187 (303 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16126 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87691 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2099 209 2e-56 >Contig2099 Length = 263 Score = 209 bits (532), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 113/209 (54%), Positives = 140/209 (66%), Gaps = 9/209 (4%) Query: 75 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWA 134 WYGPDR +L E P YLTGE PGDYG+D GLS P+ F+K + E+IH+RWA Sbjct: 47 WYGPDRVKYLGP---FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWA 103 Query: 135 MLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-E 191 MLGA G + PE + G G EAVWFK GA + L+Y G + + A+ A + Sbjct: 104 MLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQ 162 Query: 192 IVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAM 249 +VL+G E YRI G ++ED L+PGG FDPLGLA DP+ FA LKVKE+KNGRLAMF+M Sbjct: 163 VVLMGAVEGYRIAGGPLGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSM 222 Query: 250 LGFFLQAYVTGEGPVENLAKHLSDPFANN 278 GFF+QA VTG+GP+ENLA HL+DP NN Sbjct: 223 FGFFVQAIVTGKGPLENLADHLADPVNNN 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88578 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98572 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs106118 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54569 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13761 (473 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95618 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4628 98 2e-23 >Contig4628 Length = 524 Score = 97.8 bits (242), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 58/135 (42%), Positives = 78/135 (57%), Gaps = 13/135 (9%) Query: 1 MTEAGPVLSMCLGFAKQPFPT----KSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICI 56 MTEA + MC P P K GS G V EL +++ E G P + GE+CI Sbjct: 314 MTEATHL--MC----SNPLPEDGAHKPGSVGKPV-GQELAILN-ENGVVQPSDVSGEVCI 365 Query: 57 RGPQIMKGYLNDPEATAATIDVEGWLHTGDIGYVDDDDEVFIVDRVKEIIKFKGFQVPPA 116 RGP + KGY N+PEA A GW HTGD+G++D D + +V R+KE+I G ++ P Sbjct: 366 RGPNVTKGYKNNPEANKAAFTF-GWFHTGDVGFLDSDGYLHLVGRIKELINRGGEKISPI 424 Query: 117 EIEALLLSHPSIGDA 131 E++A+LLSHP I A Sbjct: 425 EVDAVLLSHPEICQA 439 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56347 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16121 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48016 (254 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs31770 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs810 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3391 67 1e-13 >Contig3391 Length = 390 Score = 66.6 bits (161), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 31/88 (35%), Positives = 54/88 (61%) Query: 17 LILTGSESTYLGIIWTLSLLLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVK 76 +I G ++T + W ++ L+ +P+ +KAQ+ELD +G +R + E+D L YL+ + K Sbjct: 303 MITAGMDTTAISGEWAMAELIKNPRVQQKAQKELDRVIGLERVMTETDFSGLPYLQCVAK 362 Query: 77 ETLRIYPPGPVTGIREAMEDCEIGGYHV 104 E LR++PP P+ A + +IGGY + Sbjct: 363 EALRMHPPTPLMLPHRANANVKIGGYDI 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15066 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88301 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83058 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74790 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2976 134 3e-34 >Contig2976 Length = 136 Score = 134 bits (336), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 69/122 (56%), Positives = 80/122 (65%), Gaps = 1/122 (0%) Query: 1 MAAITASVGTSSITPSVLVHKPSIVASSSPVLGLPAKAVKGKVRCSMEEKPSKQESKTNV 60 MA+ TAS TSS+T + LVHKPS+ A SS +L LP+ KGK+RCSME KP +ES +N+ Sbjct: 1 MASFTASTPTSSVTRAALVHKPSVGAPSSTILALPSIGNKGKLRCSMEAKPPMKESNSNI 60 Query: 61 GXXXXXXXXXXXXXXXX-XXXXLVDDRMSTEGTGLPFGLSNNLLGWILLGVFGLIWALYI 119 G LVDDR+STEGTGLPFGLSNNLLGWILLGVF LIW Y Sbjct: 61 GMSASLVAAALAATMSSPAAMALVDDRLSTEGTGLPFGLSNNLLGWILLGVFALIWTFYF 120 Query: 120 PY 121 Y Sbjct: 121 TY 122 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58068 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig258 175 2e-46 >Contig258 Length = 254 Score = 175 bits (443), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 103/229 (44%), Positives = 131/229 (57%), Gaps = 45/229 (19%) Query: 4 LLSFESDHLKATELRLGLPGSDKPSVRANNNKRAXXXXXXXXXXXXCAFNAGDDD----- 58 L++FE TELRLGLPG+ K + + + F++ +DD Sbjct: 20 LINFEE-----TELRLGLPGALKDGDQGVKSCSSGKRGFSETVDLKLNFSSENDDVSRSG 74 Query: 59 ---------ERDS----APPAKAQVVGWPPIRSYRKNTLQVQAKTSE---------SELC 96 E+D+ AP AKAQVVGWPP+RS+RKN + VQ K+++ S Sbjct: 75 RDGQVEIKKEKDASAAPAPRAKAQVVGWPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTST 134 Query: 97 RGMYVKVSMDGAPYLRKIDLKVYTCYPELLNALENMFQ-LTIGKYSER------------ 143 +VKVSMDGAPYLRK+DLK+Y Y EL AL MF TIG + Sbjct: 135 SAAFVKVSMDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGMKDFMNESKLI 194 Query: 144 EGYNGSDYAPTYEDKDGDWMLVGDVPWDMFITTCKRLRIMRGSEAKGLA 192 + NGS+Y P+YEDKDGDWMLVGDVPW+MF+ +CKRLRIM+GSEA GLA Sbjct: 195 DLLNGSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99128 (302 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41318 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96617 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77665 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104312 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs124106186 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73386 (634 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1996 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82956 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41088 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45089 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16961 (301 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12231 (62 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs106107 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93559 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93079 (56 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82881 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41998 (349 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69971 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52106181 (312 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25947 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91748 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3140 519 e-150 >Contig3140 Length = 264 Score = 519 bits (1336), Expect = e-150, Method: Compositional matrix adjust. Identities = 248/264 (93%), Positives = 256/264 (96%) Query: 1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE 60 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLI+ILRNRLKYALTYRE Sbjct: 1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE 60 Query: 61 VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK 120 VIAILMQRHVLVD KVRTDKTYP+GFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK Sbjct: 61 VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK 120 Query: 121 FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNV 180 FKLCKVRSVQFGQK IPYINTYDGRTIRYPDPLIKANDTIKLDLETNK+ +FIKFDVGNV Sbjct: 121 FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKVIDFIKFDVGNV 180 Query: 181 VMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPK 240 VMVTGGRNRGRVG+IKNREKHKGSFETIH+QDA GHEFATRLGNVFTIGKGTKPWVSLPK Sbjct: 181 VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPK 240 Query: 241 GKGIKLSIIEEARKRQALATSAAA 264 GKGIKL+IIEEARKRQA +A A Sbjct: 241 GKGIKLTIIEEARKRQAALQTATA 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40106185 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs153106186 (260 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs153106187 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41343 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5844 202 8e-55 >Contig5844 Length = 161 Score = 202 bits (514), Expect = 8e-55, Method: Compositional matrix adjust. Identities = 96/155 (61%), Positives = 122/155 (78%) Query: 5 NRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQDDESRNLLWSDTGSPLIPL 64 +R IGVA+DFSK SK AL+WAIDNL++KGDTL+IIHI + DESRN+LW+ +GSPLIPL Sbjct: 4 DRRIGVAMDFSKSSKNALQWAIDNLVDKGDTLHIIHINNNKHDESRNVLWAKSGSPLIPL 63 Query: 65 EEFRDQEVMKQYEXXXXXXXXXXXXAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSL 124 EFR+ EVMK+Y S+QK V+++ K+YWGDAR+KL +AVE +KLDSL Sbjct: 64 SEFRELEVMKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYWGDAREKLLQAVEDLKLDSL 123 Query: 125 VMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKD 159 VMGSRGLGT++R++LGSVSN+V+ A PVTIVKD Sbjct: 124 VMGSRGLGTLKRIVLGSVSNYVMTQAPIPVTIVKD 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58462 (290 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4398 262 1e-72 >Contig4398 Length = 192 Score = 262 bits (670), Expect = 1e-72, Method: Compositional matrix adjust. Identities = 127/207 (61%), Positives = 154/207 (74%), Gaps = 15/207 (7%) Query: 84 DDFHSYVHGRLPYMMLKPDPVLRNLLLSLPIRKVIFTNADKTHAARVLSRLGLEDCFERI 143 DDFHS+VHGRLPY +LKPD VLR LLLSLP+RKVIFTN+DK H VL RLG+EDCFE I Sbjct: 1 DDFHSFVHGRLPYNLLKPDHVLRGLLLSLPVRKVIFTNSDKNHTITVLKRLGIEDCFESI 60 Query: 144 ISFETLNSTDKGTVLVDQDASESERPTELFDIDDYCSRPNADLELPRTPVVCKPFEEAFE 203 I FETLN T+ D + + D+ +PN D PR+PV+CKPFE A+ Sbjct: 61 ICFETLNPTNSADGSADAEET------------DFVQQPNTDAVTPRSPVICKPFENAYV 108 Query: 204 QVFKIANINPRKTIFFDDSIRNLETGKRLGLHTVWVGTSHRAEGVDYALESIHNIKEALP 263 + FKIANINP++T+FFDDSIRNLET K++GL TVWVGTSHR + VD+ALESIHN++EALP Sbjct: 109 EAFKIANINPQRTLFFDDSIRNLETAKQVGLQTVWVGTSHRTKDVDHALESIHNMREALP 168 Query: 264 ELWEVAGENSESISYSGKVSIETSVIA 290 ELW E SE++ YS +V+IET V A Sbjct: 169 ELW---AEQSENVIYSREVAIETPVEA 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104404 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57895483 190 3e-51 >57895483 Length = 146 Score = 190 bits (483), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 94/127 (74%), Positives = 104/127 (81%), Gaps = 2/127 (1%) Query: 9 GGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADL 68 GGRR+NVFDPFSLD+WDPF GF L N+ S+A ETS FA RIDWKETP+AHVFKADL Sbjct: 9 GGRRSNVFDPFSLDIWDPFQGF--GPLMNSSSTAGETSAFAQTRIDWKETPEAHVFKADL 66 Query: 69 PGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQV 128 PGL+ G +LQISGERSKEQEEKNDKWHRVERSS KF+RRFRLPDNAKV+QV Sbjct: 67 PGLKKEEVKVELEEGNVLQISGERSKEQEEKNDKWHRVERSSVKFMRRFRLPDNAKVDQV 126 Query: 129 KASMENG 135 KA+MENG Sbjct: 127 KAAMENG 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104928 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs183106187 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23635 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4717 135 2e-34 >Contig4717 Length = 244 Score = 135 bits (341), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 79/227 (34%), Positives = 120/227 (52%), Gaps = 18/227 (7%) Query: 9 LCVGLNMVLSSSQ---------QIITTLPGFDGDLPFKLE--TGYIGVGQNDDVQLFYYF 57 LC+ + +S+S Q + G G P K + GY+ V + LFY+F Sbjct: 14 LCIAASPQISASTADYKNAYEAQKADRVIGLPGQPPVKFDQYAGYVTVNETHGRALFYWF 73 Query: 58 IESERSPEDDPLVLWLTGGPGCSGFS-GLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKV 116 E+ ++P+D PLVLWL GGPGCS G E+GP F + +K PK NPY+W Sbjct: 74 FEAVKTPQDKPLVLWLNGGPGCSSIGYGASEELGPF-FPQKGAK---PKLKYNPYTWNNA 129 Query: 117 ANIIFLDAPVGTGFSYANTWQGYI-MNDTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDS 175 AN++FL++PVG GFSY NT + + DT++A ++ FL W P + ++ YI G+S Sbjct: 130 ANLLFLESPVGVGFSYTNTTKDISQLGDTITAEDSHKFLINWFKRFPQYKSHDFYITGES 189 Query: 176 YSGIIVPMIVQHISD-GIDVGHRPRMNLKGYLLGNPLTDSTENQNSV 221 Y G VP + + + D + +N KG+++GN D +Q + Sbjct: 190 YGGHYVPQLSELVYDRNKNASKETYINFKGFMIGNAAIDDETDQKGL 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79752 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2917 62 3e-12 >Contig2917 Length = 150 Score = 62.4 bits (150), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 38/67 (56%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Query: 61 MLARGTTTA---NTAPAERTPSLAPEQRPQDQFPEPPSLKLSYKCSVCNKAFSSYQALGG 117 MLARG TA A P EQ E +L+LSYKCSVC+KAF+SYQALGG Sbjct: 1 MLARGGNRGPPVTTAAAASNPIPVTEQATSAPAKEN-NLELSYKCSVCDKAFNSYQALGG 59 Query: 118 HKASHRK 124 HKASHRK Sbjct: 60 HKASHRK 66 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53949 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38466 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38962 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48626 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98310 (347 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98309 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70312 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102609 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103630 (345 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3999 615 e-178 >Contig3999 Length = 397 Score = 615 bits (1585), Expect = e-178, Method: Compositional matrix adjust. Identities = 302/332 (90%), Positives = 315/332 (94%), Gaps = 4/332 (1%) Query: 14 PVLDKSEWVKGQAI-RQSTVS--VRSLPSGPSALTIRAGSYADELVKTAKTVASPGRGIL 70 PVLDKSEWVKGQ + RQ +VS VR PS S LTIRA SYADELVKTAKTVASPGRGIL Sbjct: 11 PVLDKSEWVKGQTLLRQPSVSSVVRCHPSATSGLTIRA-SYADELVKTAKTVASPGRGIL 69 Query: 71 AMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGK 130 AMDESNATCGKRLASIGLENTEANRQAYRTLLVT PGLG Y+SGAILFEETLYQST DGK Sbjct: 70 AMDESNATCGKRLASIGLENTEANRQAYRTLLVTVPGLGNYVSGAILFEETLYQSTVDGK 129 Query: 131 KMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVV 190 K+VDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVV Sbjct: 130 KIVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVV 189 Query: 191 SIPNGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEV 250 SIPNGPSALAVKEAAWGLARYAAI+QD+GLVPIVEPEILLDG+HGIDRTFEVA+ VWAEV Sbjct: 190 SIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHGIDRTFEVAQAVWAEV 249 Query: 251 FFYLAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSG 310 FFYLA+NNV+FEGILLKPSMVTPGAECKE+ATP+QVA+YTLKLL RRIPPAVPGIMFLSG Sbjct: 250 FFYLAQNNVLFEGILLKPSMVTPGAECKERATPEQVADYTLKLLQRRIPPAVPGIMFLSG 309 Query: 311 GQSEVEATLNLNAMNQGPNPWHVSFSYARALQ 342 GQSEVEATLNLNAMNQ PNPWHVSFSYARALQ Sbjct: 310 GQSEVEATLNLNAMNQSPNPWHVSFSYARALQ 341 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17317 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93976 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76267 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37597 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98427 (298 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64062 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34732 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2976 74 4e-16 >Contig2976 Length = 136 Score = 73.9 bits (180), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 44/124 (35%), Positives = 57/124 (45%), Gaps = 10/124 (8%) Query: 8 NFPALLPRSGFVPKGLTH-------ASPVYGMPAMATTRGRVRCSLEEXXXXXXXXXXXX 60 +F A P S L H +S + +P++ +G++RCS+E Sbjct: 3 SFTASTPTSSVTRAALVHKPSVGAPSSTILALPSIGN-KGKLRCSME--AKPPMKESNSN 59 Query: 61 XXXXXXXXXXXXXXXXXXXXXXXXVDERMTTEGTGLPFGLSNNTLGWILFGVFGLIWALY 120 VD+R++TEGTGLPFGLSNN LGWIL GVF LIW Y Sbjct: 60 IGMSASLVAAALAATMSSPAAMALVDDRLSTEGTGLPFGLSNNLLGWILLGVFALIWTFY 119 Query: 121 FIYT 124 F YT Sbjct: 120 FTYT 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95125 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49042 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40066 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18393 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22449 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34675 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41944 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53149 (737 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26457 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101205 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7008 (471 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59461 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig908 321 3e-90 >Contig908 Length = 216 Score = 321 bits (822), Expect = 3e-90, Method: Compositional matrix adjust. Identities = 161/215 (74%), Positives = 179/215 (83%), Gaps = 2/215 (0%) Query: 1 MASVSSPMASQLKSSFTSPVSRSLLTPRGISGSPFRVVPSKRSPRFIVKAIQSEKPTYQV 60 MAS ++PMASQLKS+FTSPVSR+LL P+G+S SP ++ PSKRS F +KA Q++KP +QV Sbjct: 1 MAS-AAPMASQLKSTFTSPVSRALLAPKGLSASPLKLFPSKRSSSFTIKATQTDKP-FQV 58 Query: 61 IQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPFVK 120 IQPINGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHG+LLVGPFVK Sbjct: 59 IQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFVK 118 Query: 121 AGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFNEGEPSTAPGLTLTGRKKEPDQL 180 AGPLRNTE+ VVILS+CLT+YGIASF EGEPSTAP LTLTGRKKEPDQL Sbjct: 119 AGPLRNTEVAGAAGSLAAAGLVVILSVCLTMYGIASFKEGEPSTAPSLTLTGRKKEPDQL 178 Query: 181 QTADGWAKXXXXXXXXXISGVIWAYFLLYVLNXXY 215 QTA+GWAK ISGV WAYFLLYVLN Y Sbjct: 179 QTAEGWAKFTGGFFFGGISGVTWAYFLLYVLNLPY 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25906 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1144 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56306 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24178 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101535 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3406 281 4e-78 >Contig3406 Length = 450 Score = 281 bits (718), Expect = 4e-78, Method: Compositional matrix adjust. Identities = 169/286 (59%), Positives = 183/286 (63%), Gaps = 42/286 (14%) Query: 2 DLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVVGVNADAYKPD-EP 59 ++GID+VIEGTGVFVD GAGKHIQAGAKKV+ITAP KG DIPTYVVGVN Y Sbjct: 171 EMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHSVAD 230 Query: 60 IISNASCTTNCLAPFVKVLDQKFGKYQKHLQKSSLSLCSDIIHLRKRQKVTQLDDRIFPM 119 I+SNASCTTNCLAPFVKVLD++FG Sbjct: 231 IVSNASCTTNCLAPFVKVLDEEFG------------------------------------ 254 Query: 120 CAGIIKGTMTTTHSYTGDQRLLDASHRDLRRARSAALNIVPTSTXXXXXXXXXXXXXXXX 179 I+KGTMTTTHSYTGDQRLLDASHRDLRRAR+AALNIVPTST Sbjct: 255 ---IVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGK 311 Query: 180 XNGIALRVPTPNXXXXXXXXXXSKITF-AEDVNAAFRDSADNELKCILXVCDEPLVXVDF 238 NGIALRVPTPN +K AEDVN AFR +AD LK IL VCD PLV VDF Sbjct: 312 LNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFRKAADGPLKGILAVCDVPLVSVDF 371 Query: 239 XCSDVFSNRDSSLTLVMGDXMXKVXAWYDNXWGYSQRXVDFADIXA 284 C+DV S DSSLT+VMGD M KV AWYDN WGYSQR VD A + A Sbjct: 372 RCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA 417 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59697 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9074 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80410 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27617 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18472 (412 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2603 675 0.0 >Contig2603 Length = 401 Score = 675 bits (1741), Expect = 0.0, Method: Compositional matrix adjust. Identities = 342/412 (83%), Positives = 364/412 (88%), Gaps = 11/412 (2%) Query: 1 MALVKPISKFSTIATTTKPRFSYPKATCTSLSTRFCTIXXXXXXXXXXXXXXXXXXXXXN 60 MALVKP++ F + T P+F T +S S ++ T+ Sbjct: 1 MALVKPMTNFGNVTT---PKFG---NTRSSSSGKWSTMIRMSSSSSTTKKGKGAP----- 49 Query: 61 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEF 120 K AIKETLL PRFYTTDFDEMETLFNTEIN LNQAEFEALLQEFKTDYNQTHFVRNKEF Sbjct: 50 KKAIKETLLAPRFYTTDFDEMETLFNTEINNNLNQAEFEALLQEFKTDYNQTHFVRNKEF 109 Query: 121 KEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR 180 KEAAD +QGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR Sbjct: 110 KEAADNLQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR 169 Query: 181 HAGFLNKGLSDFNYALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKAN 240 HAGFLNKGLSDFN ALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKAN Sbjct: 170 HAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKAN 229 Query: 241 PEFQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLN 300 PE+QCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLW RFFCLSVYVTMYLN Sbjct: 230 PEYQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWCRFFCLSVYVTMYLN 289 Query: 301 DCQRTAFYEGIGLDTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRRLDRMVEINERLL 360 DCQRTAFYEGIGL+TKEFDMHVIIETNRTTARIFPAVLDVENPEFKR+LDRMVEIN++L+ Sbjct: 290 DCQRTAFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINQKLI 349 Query: 361 AVGATDDIPLVKNLKRIPLIAALASELLATYLMPPVDSGSVDFAEFEPELVY 412 AVG +DDIPLVKNL RIP++AALASELLA YLMPP++SGSVDFAEFEP++VY Sbjct: 350 AVGESDDIPLVKNLNRIPIVAALASELLAAYLMPPIESGSVDFAEFEPQVVY 401 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42174 (337 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101711 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44201 (378 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8947 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24412 (388 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68903 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs194106183 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158370739 291 2e-81 >158370739 Length = 180 Score = 291 bits (744), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 134/179 (74%), Positives = 157/179 (87%), Gaps = 2/179 (1%) Query: 1 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCM 60 MASSM+SS TVA+ NRA + QASMVAPF GLKS+SAFP T+K N DIT++ASNGGRVQCM Sbjct: 1 MASSMMSSATVASVNRAPV-QASMVAPFNGLKSASAFPVTRKAN-DITTLASNGGRVQCM 58 Query: 61 KVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGY 120 +VWPP GLKKFETLSYLPPLS E+L KE+ YLLR+ W+PCLEFELE G+VYREH +SPGY Sbjct: 59 QVWPPVGLKKFETLSYLPPLSVESLAKEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGY 118 Query: 121 YDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 179 YDGRYWTMWKLPM+GCTDA+QV+ E+ E +K YP +F+RIIGFDN RQVQC+SF+A KP Sbjct: 119 YDGRYWTMWKLPMFGCTDASQVIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKP 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1613 (476 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41514 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52071 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5193 360 e-102 >Contig5193 Length = 545 Score = 360 bits (923), Expect = e-102, Method: Compositional matrix adjust. Identities = 173/230 (75%), Positives = 197/230 (85%) Query: 1 MKLVEVEGTHTIQTTYSSLDVHVGQSYSVLVTMDQPPQDFYIAVSTRFTNKVLTSTGTLH 60 MKLVEVEGTHT+QTTYSSLDVHVGQSYSVLVT DQP D+YI VS+RF+ +LT+TG LH Sbjct: 237 MKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTADQPGHDYYIVVSSRFSTPILTTTGILH 296 Query: 61 YSNSAHXXXXXXXXXXTTQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKL 120 YS + T QIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLIN+++T L Sbjct: 297 YSGAGGQVSGPIPGGPTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYIL 356 Query: 121 ESSAGQVNGKQRYAVNSVSFIPADTPLKLADYFKIGGVFRVGSIQDQPTGGNIYLDTSVM 180 S+AGQVNGKQRY +NSVSF+PADTPLKLADYFKI GVFRVGS+ D+PTGGN+YLDTSV+ Sbjct: 357 ASAAGQVNGKQRYGINSVSFVPADTPLKLADYFKISGVFRVGSVSDRPTGGNLYLDTSVL 416 Query: 181 GADFRGFIEIVFQNHENIVQSWHIDGYNFWVVGMNGGVWTPASRNEYNLR 230 GAD+R F+EIVFQN E+IVQS+H+DGY F+VVGM+GG WT ASRN YNLR Sbjct: 417 GADYRTFVEIVFQNDEDIVQSYHLDGYQFFVVGMDGGKWTTASRNGYNLR 466 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52926 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3643 286 6e-80 >Contig3643 Length = 279 Score = 286 bits (732), Expect = 6e-80, Method: Compositional matrix adjust. Identities = 133/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (0%) Query: 63 MGPVLSSSPINIYLVWYGRWPNYQKLLIKDFILSISPXXXXXKPSVSDWWRTVSLYTDQT 122 MGPVLSS PINIYL+WYGRW QKLLIKDF+LSIS PSV++WWRTVSLYTDQT Sbjct: 1 MGPVLSSHPINIYLIWYGRWSLPQKLLIKDFLLSIS-TTAAPSPSVAEWWRTVSLYTDQT 59 Query: 123 GANVSRTVLIAGEHSDHLYSHGKSLTRLSVQQVIGTAVESAPFPVDHKNGIFLILTADDV 182 GANVSR+V++AGEH+D YS GK+LTRLSVQQVIG AV SAPFP DHK+GI+L+LT+DDV Sbjct: 60 GANVSRSVVVAGEHADVKYSQGKALTRLSVQQVIGNAVRSAPFPADHKHGIYLVLTSDDV 119 Query: 183 TMQDYCRAVCGFHYFTFPSMVGYTMPYAWIGNSTKQCPEVCSYPFAVP 230 TMQD+CRAVCGFHYFTFPSMVGYT+PYAWIGNS KQCPEVC+YPFA+P Sbjct: 120 TMQDFCRAVCGFHYFTFPSMVGYTLPYAWIGNSAKQCPEVCAYPFALP 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41385 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86377 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82072 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2233 128 4e-32 >Contig2233 Length = 595 Score = 128 bits (321), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 88/281 (31%), Positives = 134/281 (47%), Gaps = 19/281 (6%) Query: 3 LIRFCRKLERLWILDSIGDRGLRVVAFTCKELQELRVFPSGVD-------NAAVTEEGLV 55 LI+ C L L + IGDRGL V+A CK+L+ LR+ G D + V++ GL+ Sbjct: 310 LIQKCPNLIVLETRNVIGDRGLEVLAQNCKKLRRLRI-ERGADEQEMEDEDGVVSQRGLM 368 Query: 56 AISAGCPKLHSLLYFCQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFG 115 AI+ GC +L L + +TN +L + ++ N T FRL +LDRE + V+ PLD G Sbjct: 369 AIAQGCLELEYLAVYVSDITNTSLECIGTHSKNLTDFRLVLLDRE--EIVSDLPLDNGVR 426 Query: 116 AIVQSCKXXXXXXXXXX---XTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKK 172 A+++ C+ TD+ Y+G Y+ + + + + G +D G+ GC Sbjct: 427 ALLRGCQKLRRFALYLRPGGLTDKGLFYVGQYSPNVRWMLLGYVGETDTGLEDFSRGCPS 486 Query: 173 LRKLEIRDSPFGNTALLTDVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIIN--- 229 L+KLE+R F AL V + ++R LW+ + G L P N+E+I Sbjct: 487 LQKLEMRGCCFSERALANAVMQLPSLRYLWVQGYRGSGTGHDLLGMARPYWNIELIPPRR 546 Query: 230 ---EDDQMEFSLDDRQKVGKMYLYRTLVGPRKDAPDFVWTL 267 D E + + Y +L GPR D PD V L Sbjct: 547 VDVSDQSGEAETVVVEHPAHILAYYSLAGPRTDFPDSVIPL 587 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55139 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54601 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82862 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92249 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94242 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9665 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs136106187 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs191106188 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75388 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62677 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34689 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1900 526 e-152 >Contig1900 Length = 451 Score = 526 bits (1355), Expect = e-152, Method: Compositional matrix adjust. Identities = 250/256 (97%), Positives = 254/256 (99%) Query: 1 VSTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 60 VSTSVVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS Sbjct: 177 VSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 236 Query: 61 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF 120 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF Sbjct: 237 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF 296 Query: 121 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAAIKTKRTIQFVDWCPTGFKCGIN 180 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGIN Sbjct: 297 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN 356 Query: 181 YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEG 240 YQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY+KRAFVHWYVGEGMEEG Sbjct: 357 YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG 416 Query: 241 EFSEAREDLAALEKDY 256 EFSEAREDLAALEKDY Sbjct: 417 EFSEAREDLAALEKDY 432 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18122 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158360568 110 2e-27 >158360568 Length = 108 Score = 110 bits (275), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 58/91 (63%), Positives = 66/91 (72%) Query: 17 SMLQTMVVAANGQGGRHYDSKHYGPGTVKSYQCPGKCDTRCSQTQYRKPXXXXXXXXXXX 76 SMLQTMV+A +G GG H + YGPG++KSYQCP +C RCS+TQY KP Sbjct: 18 SMLQTMVMANHGHGGHHKGNNQYGPGSLKSYQCPSQCTRRCSKTQYHKPCMFFCQKCCSK 77 Query: 77 XXXVPPGYYGNKAVCPCYNNWKTKEGGPKCP 107 VPPG+YGNKAVCPCYNNWKTKEGGPKCP Sbjct: 78 CLCVPPGFYGNKAVCPCYNNWKTKEGGPKCP 108 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36939 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 67 1e-13 >Contig3037 Length = 313 Score = 67.0 bits (162), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 26/40 (65%), Positives = 34/40 (85%) Query: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKV 40 +II L +LLGN+W+ IA LP RTDN+IKNYWNTH+K+K+ Sbjct: 77 LIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKL 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89949 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2427 302 1e-84 >Contig2427 Length = 260 Score = 302 bits (774), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 149/228 (65%), Positives = 168/228 (73%), Gaps = 10/228 (4%) Query: 22 GGWINAHATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNNGLSCGACFQIMC 81 G W AHATFY YGNLYSQGYG NTAALSTALFNNGLSCGACF+I C Sbjct: 32 GPWQEAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKC 91 Query: 82 ANDPQWCLRG--SIIVTATNFCPP--------GGWCDPPNHHFDLSQPVFQHIAQYRAGI 131 +DP+WC G SI VTATNFCPP GGWC+PP HFDL+ P+F IA+Y+AGI Sbjct: 92 GDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMFLKIAEYKAGI 151 Query: 132 VPVIYRRVRCKRNGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTRWQPMSRNWG 191 VPV YRRV C + GGIRFTINGH YFNLVL+TNV GAGD+ +VS+KG+ T W PMSRNWG Sbjct: 152 VPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAGAGDIVSVSVKGTNTGWMPMSRNWG 211 Query: 192 QNWQSNSYLNGQSLSFVVTTSNGHSVVSYNVAPPNWSFGQTYTGRQFR 239 QNWQSNS L GQ+LSF V S+ S +YNVAP NW FGQTY+G+ FR Sbjct: 212 QNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQFGQTYSGKNFR 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33140 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 152 1e-39 >Contig1161 Length = 148 Score = 152 bits (383), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 72/145 (49%), Positives = 97/145 (66%) Query: 8 RRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMA 67 +RI+KE + L +P SA P ++M ++ I+GP SPY GGVF + + P +YP Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFK 63 Query: 68 APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENI 127 PKV F TK++HPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDDPL I Sbjct: 64 PPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 123 Query: 128 AKHWKTNEAEAVETAKEWTRLYASG 152 A +KT+ ++ TA+ WT+ YA G Sbjct: 124 AHMYKTDRSKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3081 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3566 110 4e-27 >Contig3566 Length = 175 Score = 110 bits (275), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 61/161 (37%), Positives = 95/161 (59%), Gaps = 12/161 (7%) Query: 7 QTMVVGIDDSEQSTYALQWTLDHFFANSTVNPPFKLVIVHARPSPSAVIGLAGP-GAV-- 63 + ++V +D+SE S YAL W +D+ + N P L+I A+P P+ I A P G+ Sbjct: 16 KPVMVAVDESECSHYALMWVIDNLKESINTNSP--LLIFMAQPPPANNITFAAPLGSARM 73 Query: 64 ------EVLPHVDSDFKKIAARVVEEAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHH 117 E ++ + +K+ ++E AK+IC+S V V + GDA+ +C AV KH+ Sbjct: 74 YCPPTPEFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEI-GDAKTAICAAVLKHN 132 Query: 118 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPK 158 +LV+G G G IKRA+LGSVS+YC +A C V++VK+P+ Sbjct: 133 VKLLVLGERGLGKIKRAILGSVSNYCVLNAKCPVLVVKKPQ 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6004 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63748 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22323 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55995 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79764 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23665 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21714 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28553 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52884 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29046 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64340 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75520 (260 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11919 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21820 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105273 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25880 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81219 (348 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97065 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3005 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67006 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12644 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5815 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96674 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99190 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig303 99 1e-23 >Contig303 Length = 188 Score = 99.4 bits (246), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 48/66 (72%), Positives = 51/66 (77%) Query: 141 VRSNKDCIPLCAARCKAHSRPNVCGRACTTCCVRCKCVPPGTYGNREKCGKCYTDMTTRG 200 V+S KDCIPLC RC HSR C RAC TCC RCKCVPPGT GNRE+CGKCYTDMTT G Sbjct: 123 VKSKKDCIPLCEQRCSLHSRKRTCMRACMTCCDRCKCVPPGTSGNRERCGKCYTDMTTHG 182 Query: 201 NKPKRP 206 N+ K P Sbjct: 183 NRSKCP 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59703 (424 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68106183 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66047 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57895483 147 3e-38 >57895483 Length = 146 Score = 147 bits (370), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 77/130 (59%), Positives = 91/130 (70%), Gaps = 13/130 (10%) Query: 6 SIFGN----RSVFDPFSSDVWAPL---------GSSSNEVSTFASAQVDWKETREAHVFK 52 S+FGN +VFDPFS D+W P S++ E S FA ++DWKET EAHVFK Sbjct: 4 SLFGNGGRRSNVFDPFSLDIWDPFQGFGPLMNSSSTAGETSAFAQTRIDWKETPEAHVFK 63 Query: 53 ADLPGLXXXXXXXXXXDGRVLQISGERSVEKEDKNDKWHRVERGRGKFVRRFRLPENAKI 112 ADLPGL +G VLQISGERS E+E+KNDKWHRVER KF+RRFRLP+NAK+ Sbjct: 64 ADLPGLKKEEVKVELEEGNVLQISGERSKEQEEKNDKWHRVERSSVKFMRRFRLPDNAKV 123 Query: 113 DQVKASMENG 122 DQVKA+MENG Sbjct: 124 DQVKAAMENG 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59796 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2196 (83 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs168106181 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67005 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104791 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21106183 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40802 (41 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6371 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53503 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37497 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96109 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104240 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34540 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85196 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs113106184 (384 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4460 550 e-159 >Contig4460 Length = 431 Score = 550 bits (1418), Expect = e-159, Method: Compositional matrix adjust. Identities = 262/341 (76%), Positives = 289/341 (84%) Query: 44 TDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 103 TDKIIAEYIWIGGSG+D+RSK+RT+ PV PS+LPKWNYDGSSTGQAPG+DSEVILYPQ Sbjct: 75 TDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGDDSEVILYPQ 134 Query: 104 AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYTLL 163 AIFKDPFR GNNILV+CD+YTP GEPIPTNKRH AA++FS+ V+ E PWYGIEQEYTLL Sbjct: 135 AIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAQVFSNQKVIDEVPWYGIEQEYTLL 194 Query: 164 QKDVKWPLXXXXXXXXXXXXXXXXXXXADKAWGRDIVDSHYKACLYAGINISGINGEVMP 223 Q VKWPL ADK++GRDI D+HYKACLYAGINISG NGEVMP Sbjct: 195 QSSVKWPLGWPVGGYPGPQGPYYCGAGADKSFGRDISDAHYKACLYAGINISGTNGEVMP 254 Query: 224 GQWEFQVGPAVGISAGDQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHANYSTK 283 GQWE+QVGP+VGI AGD +W +RYILERITE AGVVLS DPKPI+GDWNGAG H NYSTK Sbjct: 255 GQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTK 314 Query: 284 SMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGNERRLTGKHETADINTFKWGVANRGASI 343 SMR +GGFEVIKKAI L LRH EHI+AYGEGNERRLTG HET +IN F WGVANRGASI Sbjct: 315 SMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGLHETQNINKFSWGVANRGASI 374 Query: 344 RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 384 RVGRDTEKEGKGY EDRRPASNMDPY VT+++AETTILW+P Sbjct: 375 RVGRDTEKEGKGYLEDRRPASNMDPYTVTALLAETTILWEP 415 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16230 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71989 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig561 368 e-104 >Contig561 Length = 371 Score = 368 bits (945), Expect = e-104, Method: Compositional matrix adjust. Identities = 181/226 (80%), Positives = 198/226 (87%), Gaps = 6/226 (2%) Query: 1 MALPVSAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSN 60 MA+PVSAIGFEGYEKRLEV FFEPG+FADP G GLRSLS+ Q++EIL PAECTIVSSL N Sbjct: 1 MAVPVSAIGFEGYEKRLEVCFFEPGLFADPKGMGLRSLSRAQINEILNPAECTIVSSLLN 60 Query: 61 EHLDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPAILKLAESLSLSVRSVRYTRGSFIF 120 + LDSYVLSESSLFVYPYKVIIKTCGTTKLL SIPAILKLAE+LSL+VRSVRY+RGSFIF Sbjct: 61 DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVRSVRYSRGSFIF 120 Query: 121 AGAQPFPHRSFSEEVAVLDGHFGKFGMDSTAFVMGSPDNTKRWHVYSASAEAGS------ 174 GAQP PHRSFSEEVAVLDGHF K G+ S A++MGSPDN+++WHVYSASAE S Sbjct: 121 PGAQPSPHRSFSEEVAVLDGHFSKLGLASRAYIMGSPDNSQKWHVYSASAELASLFWGTR 180 Query: 175 HVNPVYTLEMCMTGLDRKRASVFYKTNESSAAMMTEDSGIRKILPN 220 P YTLEMCMTGLDRK+ASVFYKTN SSAA+MTEDSGIRKILP Sbjct: 181 SSGPTYTLEMCMTGLDRKKASVFYKTNASSAAIMTEDSGIRKILPK 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71992 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig561 302 9e-85 >Contig561 Length = 371 Score = 302 bits (773), Expect = 9e-85, Method: Compositional matrix adjust. Identities = 150/203 (73%), Positives = 166/203 (81%), Gaps = 7/203 (3%) Query: 1 MGSPDNTKRWHVYSASAEAGSHV------NPVYTLEMCMTGLDRKRASVFYKTNESSAAM 54 MGSPDN+++WHVYSASAE S P YTLEMCMTGLDRK+ASVFYKTN SSAA+ Sbjct: 154 MGSPDNSQKWHVYSASAELASLFWGTRSSGPTYTLEMCMTGLDRKKASVFYKTNASSAAI 213 Query: 55 MTEDSGIRKILPKSEICDFEFDPCGYSMNSIEGDAVSTIHVTPEDGFSYASFEAVGYDFE 114 MTEDSGIRKILPKSEICDFEFDPCGYSMNSIEGDAVSTIHVTPEDGFSYASFE VGY+F+ Sbjct: 214 MTEDSGIRKILPKSEICDFEFDPCGYSMNSIEGDAVSTIHVTPEDGFSYASFETVGYNFK 273 Query: 115 VVKLTPLLERVLACFKPAEFSVALHSDIVGDEHGDTFMLDLKGYSCGEKIYEELGNNGSL 174 V LT L+ERVL CFKPAEFSV+LHS I E + F L+L GY CG YEELG G++ Sbjct: 274 DVNLTRLIERVLDCFKPAEFSVSLHSTIAASEELE-FPLELSGYCCGSTSYEELGLGGAV 332 Query: 175 IYYSFSRADCSTSPRSILKCCWS 197 IY+SF++ S SPRSILKCCWS Sbjct: 333 IYHSFNKDGGSQSPRSILKCCWS 355 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24180 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7741 (190 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59902 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74778 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51243 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78299 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2427 449 e-128 >Contig2427 Length = 260 Score = 449 bits (1154), Expect = e-128, Method: Compositional matrix adjust. Identities = 214/256 (83%), Positives = 232/256 (90%), Gaps = 1/256 (0%) Query: 4 FRMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQG 63 R+LC S+A SL ANA+IPG + GGPWQ AHATFYGGSDASGTMGGACGYGNLYSQG Sbjct: 6 LRLLCIASLA-SLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQG 64 Query: 64 YGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNG 123 YGVNTAALSTALFNNGLSCGACFE+KCG DP+WC G P+I +TATNFCPPNFAQPSDNG Sbjct: 65 YGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNG 124 Query: 124 GWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTN 183 GWCNPPR HFDLAMPMFLK+A+Y+AGIVPVSYRRVPC K+GGIRFTING +YFNLVLVTN Sbjct: 125 GWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTN 184 Query: 184 VAGAGDIVRVSVKGANTQWLSMSRNWGQNWQSNSQLVGQALSFRVTGSDRRTSTSWNVAP 243 VAGAGDIV VSVKG NT W+ MSRNWGQNWQSNS LVGQALSFRV GSDRR+ST++NVAP Sbjct: 185 VAGAGDIVSVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAP 244 Query: 244 ANWQFGQTFSGKNFRV 259 ANWQFGQT+SGKNFRV Sbjct: 245 ANWQFGQTYSGKNFRV 260 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95342 (288 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2700 152 2e-39 >Contig2700 Length = 202 Score = 152 bits (383), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 94/235 (40%), Positives = 124/235 (52%), Gaps = 48/235 (20%) Query: 57 WYPGAKAPEWLDGSLVGDYGFDPFGLGKPAEYLQYDYDSLDQNLAKNPAGDIIGTRIEAS 116 W PG P +LDGS GD+GFDP LG+ E Sbjct: 5 WMPGQPRPPYLDGSAPGDFGFDPLRLGEVPE----------------------------- 35 Query: 117 DMQSTPLQPYTEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGITWQDAGKVELVEG- 175 L+RF+E ELIH RWAMLA G L E L W A + + G Sbjct: 36 --------------NLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGG 81 Query: 176 -SSYLGQPLPF-SITTLIWIEVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEK 233 ++YLG P+P+ ++ T++ IE L I ++E QR+ E DPEK+ YPGG F DPLG + DP+K Sbjct: 82 QATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAF-DPLGYSKDPKK 140 Query: 234 KATLQLAEIKHARLAMVAFLGFAV-QAVVTGKGPLNNWATHLSDPLHTTILDTFI 287 ++ E+K+ RLA++AF+GF V Q+ G GPL N ATHL+DP H I D I Sbjct: 141 FEEYKVKEVKNGRLALLAFVGFVVQQSAYPGTGPLENLATHLADPWHNNIGDIII 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86437 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83834 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46148 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 303 4e-85 >Contig1161 Length = 148 Score = 303 bits (775), Expect = 4e-85, Method: Compositional matrix adjust. Identities = 144/148 (97%), Positives = 147/148 (99%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKSDKAKYEATARSWTQKYAMG 148 PEIAHMYK+D++KYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRSKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26492 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83855 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6443 (77 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18106185 (418 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73025 (382 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4695 754 0.0 >Contig4695 Length = 382 Score = 754 bits (1948), Expect = 0.0, Method: Compositional matrix adjust. Identities = 381/382 (99%), Positives = 382/382 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 Query: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT Sbjct: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240 Query: 241 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 300 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR Sbjct: 241 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 300 Query: 301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 360 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL Sbjct: 301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 360 Query: 361 ADYNIQKESTLHLVLRLRGGEF 382 ADYNIQKESTLHLVLRLRGG+F Sbjct: 361 ADYNIQKESTLHLVLRLRGGDF 382 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74143 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105224 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69106190 (396 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2870 225 2e-61 >Contig2870 Length = 408 Score = 225 bits (574), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 118/298 (39%), Positives = 180/298 (60%), Gaps = 11/298 (3%) Query: 103 LKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIAEAPKT 162 L G +F W+ LNV+FNI NKK+ N FPYP+ S + LA G + L+SWA + + Sbjct: 104 LVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLISWAVGLPKRAPM 163 Query: 163 DLEFWKSLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLFGETLPMP 222 D K L PVA H +GHV + VS + VAVSFTH IK+ EP F+ S+F+ G+++P+ Sbjct: 164 DSNQLKLLIPVAACHALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFILGQSIPLS 223 Query: 223 VYMSLLPIIGGCALAAVTELNFNMIGFMGAMISNLAFVFRNIFXXXXXXXXXXXXXNYYA 282 +++SL P++ G ++A++TEL+FN +GF+ AMISN++F +R+I+ N YA Sbjct: 224 LWLSLAPVVLGVSMASLTELSFNWLGFISAMISNISFTYRSIY--SKKAMTDMDSTNLYA 281 Query: 283 CLSMMSLLILTPFAIAVEGPQMWAAGWQKAIAQIG-----PNFVWWVAAQSIFYHLYNQV 337 +S+++L P A+ +EGPQ+ G+ AIA++G + VW +FYHLYNQ+ Sbjct: 282 YISIIALFFCLPPALILEGPQLLKHGFADAIAKVGLVKFITDLVW----VGLFYHLYNQL 337 Query: 338 SYMSLDQISPLTFSIGNTMKRXXXXXXXXXXFHTPVQPVNALGAAIAILGTFIYSQAK 395 + +L++++PLT ++GN +KR F + +G AIAI G IYS K Sbjct: 338 ATNTLERVAPLTHAVGNVLKRVFVIGFSIVIFGNKISTQTGIGTAIAIAGVAIYSYLK 395 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67856 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30488 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30197 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72430 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4401 (355 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4285 117 1e-28 >Contig4285 Length = 294 Score = 117 bits (292), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 94/307 (30%), Positives = 138/307 (44%), Gaps = 35/307 (11%) Query: 48 VGFIGLGNMGFRMASNLMKAGYKMAVHDVNCNVMKMFSDMGVPTKETPFEVAEASDVVIT 107 VGF+GLG MG +A NL++ G+K+ V + + ++ G +TP V Sbjct: 3 VGFLGLGIMGKAIAMNLLRHGFKVTVWNRTLSKCDELAEHGASVAQTPAAVVTKCKYTFA 62 Query: 108 MLPSSSHVLDVYNGPNGLLQ---GGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEKK 164 ML S L V G +G+++ GG ID ST+D TS IS A++ KK Sbjct: 63 MLSDPSAALAVVFGKDGIVEHVSGGKG-----YIDMSTVDAATSSKISEAIT------KK 111 Query: 165 DSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGA 224 + L+APVSG AE G L + G + Y P F +GK + Y G GNGA Sbjct: 112 GGY----FLEAPVSGSKKPAEDGQLVILAAGEQALYDEVLPAFNVIGKKSFYLGQVGNGA 167 Query: 225 AAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPV-----P 279 K+ N+ M M SE L L G+ S L IL+ + NP+ P Sbjct: 168 KMKLVVNMIMGSMMNAFSEGLVLAGRSGLDPSVLLDILDLGAIA-------NPMFRMKGP 220 Query: 280 GVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSK 339 +++G ++ F K KD+ LAL+ + V P+ + A + + K G Sbjct: 221 TMIQG-----SHPPAFPLKHQQKDMRLALSLGDDTSVSMPVAAAANEAFKKARSMGLGEL 275 Query: 340 DFSCVFQ 346 DFS V++ Sbjct: 276 DFSAVYE 282 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs117106181 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18129 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66981 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30223 (379 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4178 78 6e-17 >Contig4178 Length = 303 Score = 78.2 bits (191), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 66/239 (27%), Positives = 108/239 (45%), Gaps = 21/239 (8%) Query: 39 TFMCPLDVIKTRLQVHGLPEGTHXXXXXXXXXXXLQNILKNEGLKGLYRGLSPTLLALLP 98 T + PL+ +K LQV P L+ I + EG +GL+ G ++P Sbjct: 57 TAVAPLERMKILLQVQN-PHNIKYSGTVQG----LKYIWRTEGFRGLFIGNGTNCARIVP 111 Query: 99 NWAVYFAVYERL-KGLLRTH----GDGNSQLSVGKNMXXXXXXXXXXXXXXNPLWVVKTR 153 N AV F YE+ KG+L + G+ ++QL+ + P+ +V+ R Sbjct: 112 NSAVKFFSYEQASKGILWMYREKTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGR 171 Query: 154 LQTQGMRSNVVPYKSILSALRRISHEEGMRGLYSGILPSLAG-VSHVAIQFPAYERIKHY 212 + Q ++ Y+ + AL + EEG R LY G LPS+ G V +V + F YE +K + Sbjct: 172 ITVQ-TEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW 230 Query: 213 MAKK------DDTDVDKLNPGSVMIASSIAKVLASVITYPHEVVRSRLQEQGQNRKVDV 265 + K DTD L+ + + + A + + YP +V+R R+Q G + V Sbjct: 231 LIKSRPFGLVQDTD---LSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSHAASV 286 Score = 63.5 bits (153), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 54/203 (26%), Positives = 93/203 (45%), Gaps = 11/203 (5%) Query: 124 LSVGKNMXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRSNVVPYKSILSALRRISHEEGMR 183 LSV K++ PL +K LQ Q + + Y + L+ I EG R Sbjct: 39 LSVCKSLVAGGVAGGVSRTAVAPLERMKILLQVQNPHN--IKYSGTVQGLKYIWRTEGFR 96 Query: 184 GLYSGILPSLAG-VSHVAIQFPAYER-----IKHYMAKKDDTDVDKLNPGSVMIASSIAK 237 GL+ G + A V + A++F +YE+ + Y K + D +L P + A + A Sbjct: 97 GLFIGNGTNCARIVPNSAVKFFSYEQASKGILWMYREKTGNEDA-QLTPLLRLGAGACAG 155 Query: 238 VLASVITYPHEVVRSRLQEQGQNRKVDVQYAGVVDCVKKVFQKEGFPGFYRGCATNLLRT 297 ++A TYP ++VR R+ Q + QY G+ + V ++EG Y+G +++ Sbjct: 156 IIAMSATYPMDMVRGRITVQTEAS--PYQYRGMFHALSTVLREEGPRALYKGWLPSVIGV 213 Query: 298 TPSAVITFTSYEIIQSFLLRVLP 320 P + F YE ++ +L++ P Sbjct: 214 VPYVGLNFAVYESLKDWLIKSRP 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98775 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93807 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21536 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74366 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45360 (378 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158357520 73 3e-15 >158357520 Length = 260 Score = 72.8 bits (177), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 68/248 (27%), Positives = 106/248 (42%), Gaps = 33/248 (13%) Query: 63 CNIFQGKWVYDA-SYPLYSH-CPFVDPEFDCQKYGRPDDIYL-KYRWQPFSCSIPRFNGL 119 C+ G W+YD + P Y H C + ++C + + L K+RW+P C +P F+ + Sbjct: 19 CDYSDGAWIYDPNASPKYDHTCKEIFKGWNCISGNKSNGRELTKWRWKPNGCDLPTFDPV 78 Query: 120 YFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWVPKTKYSVVRT----AVLSSITFQEFG 175 FL +R I F+GDSL+ N + +L C + K S V+ TF ++ Sbjct: 79 RFLHMYRNTSIGFIGDSLNRNMFVALFCSL-----KRVSSEVKKWRPFGADRGFTFLQYN 133 Query: 176 LQILLYRTTYLVDLVREPA---GTVL---------RLDSIKGGNAWRG----MDMLIFNT 219 + + +RT L R A G VL R+D + W D+LIFNT Sbjct: 134 VTLAYHRTNLLARYGRWSANANGGVLESLGYKEGYRVDVDIPADTWAESLSFHDILIFNT 193 Query: 220 WHWWTHTGRSQPFD----YIREGRKLYKDMNRLVAFYKGLTTWARWVNFNVDPTKTKVFF 275 HWW + P + + G+ + + V F L +V + P K FF Sbjct: 194 GHWWWAPAKFDPINSPLLFFENGQPVVPPVLPDVGFDMVLKHMVMFVEKRMKPGAIK-FF 252 Query: 276 QGISPTHY 283 + SP H+ Sbjct: 253 RTQSPRHF 260 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102752 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100171 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94822 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42616 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5748 472 e-136 >Contig5748 Length = 265 Score = 472 bits (1215), Expect = e-136, Method: Compositional matrix adjust. Identities = 228/265 (86%), Positives = 240/265 (90%) Query: 1 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSAPQSIWYGPDRPKYLGP 60 MATSAIQQSAFAGQTAL+ SNE VRK+G GGRI+MRRTVKSAP+SIWYGPDRPKYLGP Sbjct: 1 MATSAIQQSAFAGQTALKPSNELVRKIGSLGGGRISMRRTVKSAPESIWYGPDRPKYLGP 60 Query: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK 120 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+LSK Sbjct: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSK 120 Query: 121 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXX 180 NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYR+ Sbjct: 121 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGGP 180 Query: 181 XXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE 240 AFDPLGLADDP+ FAELKVKE+KNGRLAM SMFGFFVQAIVTGKGPIE Sbjct: 181 LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIE 240 Query: 241 NLYDHIADPVANNAWAYATNFVPGK 265 NLYDH+ADPVANNAWAYATNFVPGK Sbjct: 241 NLYDHVADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75309 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105081 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67511 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24696 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91241 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3572 162 8e-43 >Contig3572 Length = 108 Score = 162 bits (411), Expect = 8e-43, Method: Compositional matrix adjust. Identities = 84/106 (79%), Positives = 97/106 (91%) Query: 69 MLDSGGMPSSHSATVSALAVAIGLQEGSGSPSFAIAVVLACIVMYDASGVRLHAGRQAEL 128 MLDSGGMPSSHSA V+AL VA+GL +G+G +FA+A+VLA IVMYDA+GVRLHAGRQAEL Sbjct: 1 MLDSGGMPSSHSALVTALTVAVGLDQGTGGAAFALALVLALIVMYDATGVRLHAGRQAEL 60 Query: 129 LNQIVCEFPPDHPLSSVRPLRELLGHTPLQVVAGGILGCVVAFLMR 174 LNQI+CE PP+HPLS+VRPLR+ LGHTP+QVVAG ILGCVVAFLMR Sbjct: 61 LNQILCELPPEHPLSTVRPLRDSLGHTPVQVVAGAILGCVVAFLMR 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49471 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76512 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1214 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92350 (61 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76516 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig449 291 3e-81 >Contig449 Length = 182 Score = 291 bits (745), Expect = 3e-81, Method: Compositional matrix adjust. Identities = 136/175 (77%), Positives = 155/175 (88%), Gaps = 1/175 (0%) Query: 4 MSLIFSLFVGL-LMVVLVSSAKFDDLYQTSWAFDHVQYDGDTLKLNLDNYSGAGFASKSK 62 MSL S+ +GL L LVSSAKFD+L+Q WA DH Y+G+ L + LDNYSGAGF+SK+K Sbjct: 8 MSLFLSVILGLSLFSGLVSSAKFDELFQPYWASDHFTYEGELLHMKLDNYSGAGFSSKNK 67 Query: 63 YLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYVNGV 122 Y+FGKV++QIKLV GDSAGTVTAFYMSSDGP HNEFDFEFLGNTTGEPY VQTN+Y+NGV Sbjct: 68 YMFGKVTVQIKLVEGDSAGTVTAFYMSSDGPLHNEFDFEFLGNTTGEPYSVQTNIYINGV 127 Query: 123 GNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKDQ 177 GNREQRLDLWFDPTK+FH+YS+ WNQRQVVFLVDETPIRVHTN+E KG+PFPKDQ Sbjct: 128 GNREQRLDLWFDPTKDFHSYSIFWNQRQVVFLVDETPIRVHTNMESKGVPFPKDQ 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11412 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103596 (61 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57664 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68303 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73743 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105095 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94093 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65078 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79560 (319 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 117 1e-28 >Contig4694 Length = 351 Score = 117 bits (292), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 84/291 (28%), Positives = 139/291 (47%), Gaps = 26/291 (8%) Query: 5 PVISLENINGAERAAIL-EKINEACENWGFFELVNHGIEPEFMDTVERLTKAHYRKCMEQ 63 P+ S ++I+ + +L +I AC+NWGFF+++NHG+ E + VE + + + +E+ Sbjct: 33 PLTSADSISDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTARKFFAQPLEE 92 Query: 64 RFKELVASRALEG---IQTEVNDMDWEST--FYVRH---LPQST----------INEVPD 105 + K + + G + N DW+ F V +P ST N+ P+ Sbjct: 93 KRKIRRDEKCVVGYYDTEHTKNVRDWKEVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPE 152 Query: 106 LDEEYRKVMXXXXXXXXXXXXXXXXXXXXXXXXXXGYLKKVFHGANGPTFGTKVSNYPPC 165 E R+VM K F T ++++YPPC Sbjct: 153 NPPELREVMEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQ---TSFIRLNHYPPC 209 Query: 166 PKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLK--DGQWIDVPPLRHSIVVNLGDQIEV 223 P P+L G+ H D G + +L QD+ V GL++ + DG+WI V P ++ ++N+GD I+V Sbjct: 210 PSPELALGVGRHKDGGALTVLAQDE-VGGLEVKRKTDGEWIRVRPTPNAYIINVGDVIQV 268 Query: 224 ITNGKYKSVEHRVVSQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKK 274 +N +Y+SVEHRV+ ++ E R S+ F NP + P L K+ K Sbjct: 269 WSNDEYESVEHRVMVNSEKE-RFSVLFFLNPAHYTEVKPLEELTNKQNPAK 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51828 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28926 (71 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52976 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35363 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77599 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51219 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103388 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs130106184 (411 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2880 734 0.0 >Contig2880 Length = 405 Score = 734 bits (1894), Expect = 0.0, Method: Compositional matrix adjust. Identities = 355/411 (86%), Positives = 381/411 (92%), Gaps = 6/411 (1%) Query: 1 MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSDLNFS 60 MSSKE+PTLGGTRIK RKRNIAA F+DAVVQIYLDNAGDLELIAK IESSDLNFS Sbjct: 1 MSSKERPTLGGTRIKTRKRNIAA------FADAVVQIYLDNAGDLELIAKSIESSDLNFS 54 Query: 61 RYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFL 120 RYGDTFFEVVFTGGRTQPGTTKPDEGERH YS+++ EP+RE I+P VIYIQKILRRRPFL Sbjct: 55 RYGDTFFEVVFTGGRTQPGTTKPDEGERHPYSVLESEPRREVIIPFVIYIQKILRRRPFL 114 Query: 121 IKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGL 180 IKNLENV RRF+QSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQP+LKDNLVGKGL Sbjct: 115 IKNLENVMRRFLQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPMLKDNLVGKGL 174 Query: 181 VLSFITDFFKEYLVDNSLDDLIAILKRGKMEDNLLDFFPSSKRSAEGFSEHFTKEGLIPL 240 VLSFIT+FFKEYL+DNSLDDLI+ILKRGK+EDNLLDFFP++KR+ E FSEHFTKEGL+ L Sbjct: 175 VLSFITEFFKEYLIDNSLDDLISILKRGKVEDNLLDFFPAAKRTEECFSEHFTKEGLVAL 234 Query: 241 VEYNEKKIFEVKLKDMKSTLTTQIAEETEMSEVIESVKQRVKDAKLPDIEVVRILWDILM 300 VEYNEKKIFEVKLKDMKS LTTQI EET+++EVIE+VKQRVKDAKLPD+EVVRILWD++M Sbjct: 235 VEYNEKKIFEVKLKDMKSALTTQITEETDIAEVIETVKQRVKDAKLPDVEVVRILWDVIM 294 Query: 301 DAVQWSGKXXXXXXXXXLRQVKTWAQLLNTFCTNAKLELELMYKVQMQCYEDAKLMKLFP 360 DAVQWSGK LRQVKTWAQLLN FCTN KLELELMYKVQMQCYEDAKLMKLF Sbjct: 295 DAVQWSGKNQQQNANAALRQVKTWAQLLNAFCTNGKLELELMYKVQMQCYEDAKLMKLFS 354 Query: 361 EIVRSLYDQDVLAEDTILYWFRKGTNPKGRQTFVKALEPFVKWLEEAEEEE 411 EIVRSLYDQDVLAEDTIL+WFRKGTNPKGRQTFVKALEPFVKWLEEAEEE+ Sbjct: 355 EIVRSLYDQDVLAEDTILHWFRKGTNPKGRQTFVKALEPFVKWLEEAEEED 405 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82372 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53942 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28826 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16106187 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18718 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16002 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96496 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27266 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94258 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64199 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52237 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87821 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2315 84 6e-19 >Contig2315 Length = 241 Score = 84.0 bits (206), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 57/180 (31%), Positives = 90/180 (50%), Gaps = 26/180 (14%) Query: 1 MEVDSP-----DGRNPNQLRPLACSCSILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNE 55 ME SP DGR P ++R + ++ +A GSA + G+TKV+AAVYGP+ +++ Sbjct: 1 MEFISPEGLRLDGRRPMEMRQIRAEIGVVSKADGSAMFEMGNTKVIAAVYGPREVQNRSQ 60 Query: 56 NPEK----------ASIEVIWKPRTGQIGKPEKEYEIILKRTLQSICILT-INPNTTTSF 104 A+ + R + + E +++++T++ CILT + P + Sbjct: 61 QLNANAFVRCEYTMANFSTGDRMRKPKGDRRSTEISLVIRQTMEE-CILTNLMPRSQIDI 119 Query: 105 IIQVVHDDGALLPCAINAACAALVDAGIPMKHLAVAICCCSAESGYC----ILDPTKLEE 160 +QV+ DG INAA AL DAGIPM+ L + CSA GY +LD +E+ Sbjct: 120 FVQVLQADGGTRSACINAATLALADAGIPMRDL---VTSCSA--GYLNNTPLLDLNYIED 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78040 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87083 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6568 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89889 (475 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17598 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15890 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78696 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26081 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540494 514 e-148 >89540494 Length = 290 Score = 514 bits (1323), Expect = e-148, Method: Compositional matrix adjust. Identities = 244/279 (87%), Positives = 259/279 (92%), Gaps = 2/279 (0%) Query: 16 VVSPWEVSS--SGKIDYDKLIDKFGCQRLDQSLVDRVQRLTGRPPHVFLRRGVFFAHRDL 73 +V+PW+V + GKIDYDKLID+FGCQR+DQSLVDRV+RLT RPPHVFLRR VFFAHRDL Sbjct: 12 IVNPWKVEAKEGGKIDYDKLIDQFGCQRIDQSLVDRVRRLTSRPPHVFLRRDVFFAHRDL 71 Query: 74 NDILDAYEKGEKFYLYTGRGPSSEALHLGHLVPFMFTKYLQDAFKVPLVIQLTDDEKCMW 133 N+ILDAYE+G+KFYLYTGRGPSSEALHLGHL+PFMFTKYLQDAFKVPLVIQLTDDEKCMW Sbjct: 72 NEILDAYERGDKFYLYTGRGPSSEALHLGHLIPFMFTKYLQDAFKVPLVIQLTDDEKCMW 131 Query: 134 KNLSVEESQRLARENAKDIIACGFDVTKTFIFSDFDYVGGAFYKNMVKVAKCVTYNKVVG 193 KN+SVEESQRLARENAKDIIACGFDVT+TFIFSDFDYVGGAFYKNMVKV KCVTYNKVVG Sbjct: 132 KNISVEESQRLARENAKDIIACGFDVTRTFIFSDFDYVGGAFYKNMVKVGKCVTYNKVVG 191 Query: 194 IFGFTGEDHIGKVSFPPVQAVXXXXXXXXXXXXGKDHLRCLIPCAIDQDPYFRMTRDVAP 253 IFGFTGEDHIGKVSFPPVQAV G+D+LRCLIPCAIDQDPYFRMTRDVAP Sbjct: 192 IFGFTGEDHIGKVSFPPVQAVPSFPSSFPHLFSGQDNLRCLIPCAIDQDPYFRMTRDVAP 251 Query: 254 RIGYHKPALIESSFFPALQGETGKMSASDPNSAIYVTDS 292 RIGYHKPALIES FFPALQGETGKMSASDPNSAIYVTDS Sbjct: 252 RIGYHKPALIESLFFPALQGETGKMSASDPNSAIYVTDS 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64600 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39988 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104648 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3529 (355 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6779 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13337 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3170 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43708 (321 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69121 (366 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84151 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92660 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73710 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95758 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103490 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5275 223 7e-61 >Contig5275 Length = 247 Score = 223 bits (568), Expect = 7e-61, Method: Compositional matrix adjust. Identities = 116/200 (58%), Positives = 143/200 (71%), Gaps = 24/200 (12%) Query: 48 NPLRLSVN-------HEEMK-MVTKRNS--RGFSAVCYASPLTARNLQWISTISSTVLML 97 NPLR+S++ ++E+K M K+ S RG SAVCYA+P++ N+QWI+TIS LM Sbjct: 45 NPLRVSISRNVWISGNDELKLMKNKKKSIRRGMSAVCYAAPISVHNIQWIATISLATLMF 104 Query: 98 AKGTAVPKSFLVPLFALQAPADVISWIKGEYGIWXXXXXXXXXXXXXIP----------- 146 AKGTAV KSFLVPLFALQAP I+WIKGEYG+W P Sbjct: 105 AKGTAVQKSFLVPLFALQAPGSFITWIKGEYGLWAAFLALLVRLFFYYPAIHSNHLVSFG 164 Query: 147 ---GELELPFMALLLVIVAPHQVLTLRGTQQGAIISLVIAGYLAFQHFSRAGNLRKAFEQ 203 GELELP +ALL+VIVAP+QV++LRG Q+GAI+SLVIAGYLAFQHFSR G+L ++F++ Sbjct: 165 SYSGELELPLIALLVVIVAPYQVMSLRGKQEGAIVSLVIAGYLAFQHFSRTGSLNQSFDR 224 Query: 204 GSVVATLAIICITALSCLFL 223 GS+VATLAIICIT LSCLFL Sbjct: 225 GSIVATLAIICITVLSCLFL 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70246 (301 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25743 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9187 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs143106181 (380 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65106187 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158371956 243 8e-67 >158371956 Length = 208 Score = 243 bits (619), Expect = 8e-67, Method: Compositional matrix adjust. Identities = 116/197 (58%), Positives = 145/197 (73%), Gaps = 1/197 (0%) Query: 6 TDNNNNVHEPMLQSN-GXXXXXXXXXXXXXXXXXXXXFFQRIKKATWIELKNLFRLAAPA 64 + ++N + EP+L S +F R+++ATW+ELK LFRLAAPA Sbjct: 3 SSDDNELSEPILISKRSSSVQPVSSELEETLSNTELPYFHRLRRATWVELKILFRLAAPA 62 Query: 65 ILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYG 124 ++VY+LNN+++MSTQI+CGHLGNLELAA SLGNTGIQVFAYGLMLGMGSA ETLCGQAYG Sbjct: 63 VVVYLLNNVISMSTQIYCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG 122 Query: 125 AQKYDMLGVYLQRSAVILTATGIPLMVIYICSKQILLLLGEXXXXXXXXXXFVFGLIPQI 184 A KY+MLG+YLQRS ++L ATGIP+M IYI SK +LL LGE FV+GLIPQI Sbjct: 123 AHKYEMLGIYLQRSTILLMATGIPVMFIYIFSKPLLLALGESSTIASAAAIFVYGLIPQI 182 Query: 185 FAYAVNFPYKRFYRHKA 201 FAYA NFP ++F + ++ Sbjct: 183 FAYACNFPIQKFLQAQS 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53960 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77271 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78626 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61560 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9739 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79393 (371 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4113 636 0.0 >Contig4113 Length = 368 Score = 636 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. Identities = 307/368 (83%), Positives = 332/368 (90%) Query: 4 ISEITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKID 63 + E+TNV EYEA+AK+KLPKM YDYYASG+EDQWTL ENRNAFS+ILFRPRIL DVS ID Sbjct: 1 MGEVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNID 60 Query: 64 MTTTVLGFNISMPIMIAPTAFQKMAHPEGECXXXXXXXXXGTIMTLSSWATSSVEEVSST 123 MTTTVLGF ISMPIMIAPTAFQKMAHPEGE GTIMTLSSWATSSVEEV+ST Sbjct: 61 MTTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST 120 Query: 124 GPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLT 183 GPGIRFFQLYV K R+V AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRF LPP LT Sbjct: 121 GPGIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLT 180 Query: 184 LKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDAS 243 LKN+EGL +GKMDK +DSGLASYVA QIDRSL+WKDV+WLQTIT LPILVKGVLTAEDA Sbjct: 181 LKNFEGLDLGKMDKANDSGLASYVAGQIDRSLSWKDVQWLQTITKLPILVKGVLTAEDAR 240 Query: 244 LAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALA 303 L++Q GAAGIIVSNHGARQLDYVP+T+MALEEVV+AA+GR+PVFLDGGVRRGTDVFKALA Sbjct: 241 LSVQSGAAGIIVSNHGARQLDYVPSTIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALA 300 Query: 304 LGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWD 363 LGASG+F+GRPV FSLA +GEAGVRKVLQMLR+EFELTMALSGCRSLKEITRNHIV WD Sbjct: 301 LGASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITRNHIVADWD 360 Query: 364 TPGAVARL 371 P V RL Sbjct: 361 APRPVPRL 368 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98329 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37247 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3082 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65526 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81867 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101267 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61017 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41383 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99051 (533 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs116106187 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38092 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60654 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48903 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs31311 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78206 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7724 (276 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5772 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54979 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10524 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78173 (405 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4292 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92452 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 59 3e-11 >89540794 Length = 177 Score = 58.9 bits (141), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 25/48 (52%), Positives = 35/48 (72%) Query: 15 KLFVGGLAWETNSDTLRTYFEQFGDILEAVVITHKNTGRSKGYRFVTF 62 + FVGGLAW T++D L F FG+I+E+ +I + TGRS+G+ FVTF Sbjct: 9 RCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTF 56 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68410 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52149 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61125 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62373 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93856 (309 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94907 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45674 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8154 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550254 136 7e-35 >89550254 Length = 219 Score = 136 bits (343), Expect = 7e-35, Method: Compositional matrix adjust. Identities = 71/125 (56%), Positives = 81/125 (64%), Gaps = 35/125 (28%) Query: 48 SAVPDPHNLELWLTVHNHYSLLSYFFMAFVKASNLFFTGWINFKCVSLQVDGEIRQKGST 107 + VPDP +LELWL +VDGE+RQKGST Sbjct: 130 ATVPDPDDLELWL-----------------------------------KVDGEVRQKGST 154 Query: 108 KDMIFMIPYLISHISSIMTLFEGDVILTGTPQGVGPVKVGQKITAGITGLLDVHFDIEKR 167 KDMIF IP+LISHISSIMTL EGDVILTGTP+GVGPVK GQKITAGIT L+DV F++EKR Sbjct: 155 KDMIFKIPFLISHISSIMTLLEGDVILTGTPKGVGPVKAGQKITAGITNLVDVQFNVEKR 214 Query: 168 RRPGS 172 R+ S Sbjct: 215 RQGSS 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7246 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87569 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68601 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44596 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74025 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60125 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25481 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75694 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95626 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs162106184 (292 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20126 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96763 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3070 79 2e-17 >Contig3070 Length = 218 Score = 78.6 bits (192), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 39/70 (55%), Positives = 58/70 (82%), Gaps = 1/70 (1%) Query: 49 PSHPPYFQMITEALMALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGN 108 P+HPP+ +MITEA++AL++++GSS YAI K++EEKHK +LP +FRK+L + LK A G Sbjct: 15 PAHPPFSEMITEAIVALKERTGSSQYAITKFVEEKHK-QLPQSFRKLLLLNLKKLVASGK 73 Query: 109 LIKIRASYKL 118 L+K++AS+KL Sbjct: 74 LVKVKASFKL 83 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46485 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37583 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs251 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs158106188 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65605 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3840 113 8e-28 >Contig3840 Length = 186 Score = 113 bits (282), Expect = 8e-28, Method: Compositional matrix adjust. Identities = 60/135 (44%), Positives = 82/135 (60%), Gaps = 8/135 (5%) Query: 3 NKLASSHVRHDLP-PSSFGKCDLCDREKAFLFCEKGGMCICLTCDMVFHIG----HPRFL 57 NKLAS HVR L PS+ +CD+C+ AF +CE G +CL CDMV H+G H R+L Sbjct: 36 NKLASRHVRVGLATPSAVPRCDICENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHGRYL 95 Query: 58 VMRQKIQFPVEDPIWG--KPISR-PLNQAEIKREQNDPLEMTIGEDQQNHKVFPTAVADV 114 V+RQ++QFP + P P S+ P++Q E +R Q+ MTIG++ QNH+ P +AD Sbjct: 96 VLRQRVQFPGDKPSSNGEDPASQPPIDQGETRRVQHQQPRMTIGDNHQNHRASPVRLADA 155 Query: 115 RATSKAKRGNKMIDL 129 K NK+IDL Sbjct: 156 NDDGHVKMDNKLIDL 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51257 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20055 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41080 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11228 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 69 9e-15 >Contig1161 Length = 148 Score = 69.3 bits (168), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Query: 11 KELAEWQVNPPSGFKHK-ATDNLQRWVIEVNGAPGTLYANETYQLQVEFPEHYPMEAPQV 69 KEL + Q +PP+ +++ W + G P + YA + + + FP YP + P+V Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKV 67 Query: 70 IFLHPSPLHPHVYSNGHICLDILYDSWSPAMTV 102 F HP++ SNG ICLDIL + WSPA+T+ Sbjct: 68 AF-RTKVFHPNINSNGSICLDILKEQWSPALTI 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59303 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7897 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24531 (314 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3762 159 2e-41 >Contig3762 Length = 261 Score = 159 bits (403), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 82/202 (40%), Positives = 113/202 (55%), Gaps = 6/202 (2%) Query: 49 DQGFSTFFGGSNVKRINNGSMATLALDKSSGSGLVSRNKYYHGFFSAAIKLPSGLSSGVV 108 +Q F +G K +NN + TLALDK+SGSG SRN+Y G IKL G S+G V Sbjct: 25 NQDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKSRNQYLFGKIDMQIKLVPGNSAGTV 84 Query: 109 LAFYLSNADSYPHNHDEIDIELLGHDKRNDWVLQTNIYANGGVSTGREEKFYFWFDPTAQ 168 ++YLS+ S HDEID E LG+ + + L TN++ G RE++FY WFDPT Sbjct: 85 TSYYLSSLGS---AHDEIDFEFLGNLSGDPYTLHTNVFTQG--KGNREQQFYLWFDPTKD 139 Query: 169 HHYYSIIWNSHHIVFLVDNVPVREFPNTGAFSSVYP-SKPMSVYVTIWDGSQWATHGGKY 227 H YSI+WN I+F VD P+REF N + +P ++ M +Y ++W+ WAT GG Sbjct: 140 FHTYSILWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAMWIYSSLWNADDWATRGGLV 199 Query: 228 PVNYKYAPFVVSLAEMEMAGCV 249 ++ APF S C+ Sbjct: 200 KTDWSKAPFTASYRNFNAQACI 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69506 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1582 179 1e-47 >Contig1582 Length = 391 Score = 179 bits (454), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 98/209 (46%), Positives = 139/209 (66%), Gaps = 3/209 (1%) Query: 40 ASEKVFQLMDLMPS-DQFMSKGKKLQRLMGRIDFVDVSFRYSSREMVPVLQHVNISVNPG 98 ++ +F ++D D G ++ L G I+F VSF+Y +R VP+ Q + +++ G Sbjct: 116 SAASIFAILDRKSKIDASDDSGTTIENLKGEIEFSHVSFKYPNRPNVPIFQDLCLAIRYG 175 Query: 99 EVVAIAGLSGSGKSTLVNLLLRLYEPTNGQILIDGFPIKEVDIKWLRGRIGFVGQEPKLF 158 + VA+ G SGSGKST+V+LL R Y+P +G I +DG ++ + +KWLR ++G V QEP LF Sbjct: 176 KTVALVGESGSGKSTVVSLLQRFYDPDSGHITLDGTKLQTLQLKWLRQQMGLVSQEPILF 235 Query: 159 RMDISSNISYGCTRDIKQQDIEWAAKQAYAHDFIMSLPSGYETLVDDD--LLSGGQKQRI 216 I +NI+YG ++ + +I AA+ A AH FI SL GY+TLV + LSGGQKQR+ Sbjct: 236 NDTIRANIAYGKEGNVTEAEIIAAAELANAHKFISSLQKGYDTLVGERGVQLSGGQKQRV 295 Query: 217 AIARAILXDPTILILDEATSALDAESEHI 245 AIARAI+ P IL+LDEATSALDAESE + Sbjct: 296 AIARAIMKAPKILLLDEATSALDAESERV 324 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17061 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28242 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15423 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80225 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25001 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52163 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103577 (58 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29637 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30618 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93789 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158365522 233 6e-64 >158365522 Length = 211 Score = 233 bits (595), Expect = 6e-64, Method: Compositional matrix adjust. Identities = 105/137 (76%), Positives = 122/137 (89%) Query: 1 MHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEILFSRHCPIWYGYGGRLK 60 MH GWRS+YCMPKRPAFKGSAPINLSDRL+QVLRWALGSVEIL SRHCPIWYGYG LK Sbjct: 75 MHCHGWRSVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLK 134 Query: 61 FLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQISNLASIVFISLFLSIFATG 120 LERF+Y+N+ +YPLT+IPL+ YC+LPAVCLLT KFI+P+ISN ASI+F++LFLSI AT Sbjct: 135 SLERFSYINSVVYPLTSIPLIAYCSLPAVCLLTGKFIVPEISNYASIIFMALFLSIAATS 194 Query: 121 ILEMRWSGVGIDEWWRN 137 +LEM+W VGI +WWRN Sbjct: 195 VLEMQWGHVGIHDWWRN 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44252 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42555 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3250 299 4e-84 >Contig3250 Length = 159 Score = 299 bits (766), Expect = 4e-84, Method: Compositional matrix adjust. Identities = 144/159 (90%), Positives = 149/159 (93%) Query: 1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF 60 MSDEEH FESKADAGASKT+PQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHF Sbjct: 1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF 60 Query: 61 VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 V IDIFNGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD Sbjct: 61 VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 Query: 121 ENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 159 + LL+Q+KDGF GKDLVV+V AMGEEQI ALKDIGPK Sbjct: 121 DALLTQLKDGFAEGKDLVVTVMSAMGEEQICALKDIGPK 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56038 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs173106183 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 173 8e-46 >Contig1666 Length = 421 Score = 173 bits (439), Expect = 8e-46, Method: Compositional matrix adjust. Identities = 83/170 (48%), Positives = 113/170 (66%), Gaps = 5/170 (2%) Query: 1 MEAQASTELPPGFRFHPTDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEF 60 M Q+S L PGFRFHPTDEEL+ +YL+ + + I VDIYK +PW LP K++ Sbjct: 1 MGRQSSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKL 60 Query: 61 GEK--EWYFFSPRDRKYPNGTRPNRATVSGYWKATGTDKAIYGGSKYLGVKKALVFYKGR 118 + EWYFFS DRKY N +R NRAT GYWK TG D+ + S+ +G+KK LVF+ GR Sbjct: 61 KSRDTEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHSSRAVGMKKTLVFHSGR 120 Query: 119 PPKGIKTDWIMHEYRLNDPTRQPYKHNGSMKLDDWVLCRIYKKRQTGSRS 168 PKG +T+W+MHEYRL++ Q + G ++ D +VLCRI++K TG ++ Sbjct: 121 APKGARTNWVMHEYRLDN---QELEKAGIVEKDAYVLCRIFQKSGTGPKN 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37739 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 59 7e-12 >89552756 Length = 189 Score = 59.3 bits (142), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 43/104 (41%), Positives = 61/104 (58%), Gaps = 14/104 (13%) Query: 3 IAAGAAKGLEYLHDKANPPVIYRDFKSSNIL--LEEGFHP--KLSDFGLAKLGPVGDKSH 58 IA AA G+EYLH K +++ D K N+L + + P K+ D GL+K V ++ Sbjct: 25 IAMDAAFGMEYLHGKN---IVHFDLKCENLLVNMRDPQRPVCKIGDLGLSK---VKQQTL 78 Query: 59 VSTRVMGTYGYCAPEYAMTGQ---LTVKSDVYSFGVVFLELITG 99 VS V GT + APE ++G+ +T K DVYSFG+V EL+TG Sbjct: 79 VSGGVRGTLPWMAPEL-LSGKSHMVTEKIDVYSFGIVMWELLTG 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100626 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78025 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7740 (77 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16453 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61627 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84487 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158355803 86 5e-20 >158355803 Length = 153 Score = 85.5 bits (210), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 52/103 (50%), Positives = 56/103 (54%), Gaps = 44/103 (42%) Query: 10 NVKAKIQDKEGIPPDQQRLI---------------------------------------- 29 NVKAKIQDKEGIPPDQQRLI Sbjct: 25 NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL 84 Query: 30 ----TTLEVKSSDTINNVKSKIQDKEGIPPDQQRLIFAGINLK 68 TLEV+SSDTI+NVK+KIQDKEGIPPDQQRLIFAG L+ Sbjct: 85 TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE 127 Score = 67.8 bits (164), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 32/38 (84%), Positives = 36/38 (94%) Query: 31 TLEVKSSDTINNVKSKIQDKEGIPPDQQRLIFAGINLK 68 TLEV+SSDTI+NVK+KIQDKEGIPPDQQRLIFAG L+ Sbjct: 14 TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE 51 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57743 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1166 75 1e-16 >Contig1166 Length = 136 Score = 75.5 bits (184), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 46/99 (46%), Positives = 56/99 (56%), Gaps = 2/99 (2%) Query: 25 LQFPVGRIARFLKAGKYAE-RVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKTRIVPR 83 +QFPVGRI R LK A RVGA A GNA++D K RI PR Sbjct: 37 IQFPVGRIHRQLKQRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPR 96 Query: 84 HIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKT 122 H+QLA+R DEEL L+ TIA GGV+P+IH L+ K + Sbjct: 97 HLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINKTS 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64036 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52033 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7158 (61 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85456 (321 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44225 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36587 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9986 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89555746 96 1e-22 >89555746 Length = 130 Score = 95.9 bits (237), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 43/100 (43%), Positives = 63/100 (63%) Query: 6 TGKVGINYGRVANNLPSPEKVVELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNE 65 TG GINYGR+A+N+PSP+KV LL++ I V+ YD D +VL A + + + +VV PN Sbjct: 29 TGAYGINYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTGLDLVVGLPNG 88 Query: 66 ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFA 105 + +A+Q +WV+ N+ + P T I +AVGNEV Sbjct: 89 YVKDMSANQDHALDWVKENVQAFLPDTHIRGIAVGNEVLG 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68717 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71761 (366 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76394 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58089 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104403 (67 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42867 (334 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26683 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60255 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs169106190 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1245 553 e-160 >Contig1245 Length = 358 Score = 553 bits (1426), Expect = e-160, Method: Compositional matrix adjust. Identities = 264/361 (73%), Positives = 302/361 (83%), Gaps = 3/361 (0%) Query: 1 MARPVQLVSSVILLLCCXXXXXXXXXXFDDSNPIRLVSSDGLRDFETSVLQVIGQARHAL 60 MA P ++ ++ +L FD+SNPI+L +S+GLR+ + +QV+G H Sbjct: 1 MASP--RLTLLLSVLAAVVLISSAASSFDESNPIQL-ASEGLRELQDQFVQVLGHGCHVH 57 Query: 61 SFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQR 120 SFARFA RY K YES+EEM+ RF F++N LIRSTN KGLSY+LG+N+FADW+WEEFQR Sbjct: 58 SFARFAFRYEKKYESLEEMRRRFEIFAENKKLIRSTNRKGLSYKLGVNRFADWTWEEFQR 117 Query: 121 HRLGAAQNCSATTKGNHKLTADVLPETKDWRESGIVSPVKDQGHCGSCWTFSTTGSLEAA 180 HRLGAAQNCSATTKGNHKLT V P +K+WR+ GIV+PVKDQGHCGSCWTFSTTG+LEAA Sbjct: 118 HRLGAAQNCSATTKGNHKLTDAVPPLSKNWRDEGIVTPVKDQGHCGSCWTFSTTGALEAA 177 Query: 181 YHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNGGLDTEEAYPYTGKDGV 240 Y QAFGK ISLSEQQLVDCA AFNN GC+GGLPSQAFEY+KYNGGLDTEE YPYT KDG Sbjct: 178 YAQAFGKQISLSEQQLVDCAGAFNNFGCSGGLPSQAFEYVKYNGGLDTEEGYPYTAKDGA 237 Query: 241 CKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVDGFRFYKSGVYSSTKCG 300 CKFSSENVGVQVLDSVNITLG E+ L+HAV VRPVS+AF+VV FR YKSGVY+S CG Sbjct: 238 CKFSSENVGVQVLDSVNITLGDEEGLKHAVAFVRPVSIAFQVVSDFRLYKSGVYTSETCG 297 Query: 301 NTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVV 360 NTPMDVNHAV+AVGYGVE+GVPYWLIKNSWG++WGD+GYFKME GKNMCGIATCASYPVV Sbjct: 298 NTPMDVNHAVLAVGYGVENGVPYWLIKNSWGQSWGDNGYFKMEYGKNMCGIATCASYPVV 357 Query: 361 A 361 A Sbjct: 358 A 358 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76629 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96407 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33540 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77982401 328 2e-92 >77982401 Length = 185 Score = 328 bits (840), Expect = 2e-92, Method: Compositional matrix adjust. Identities = 161/185 (87%), Positives = 168/185 (90%) Query: 1 MGLLSXXXXXXXXXXXXXXLMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTVTYQKY 60 MGLLS LMVGLDNSGKTTIVL+INGEDTSV+SPTLGFNIKT+TYQKY Sbjct: 1 MGLLSIIRKIKRKEKEIRILMVGLDNSGKTTIVLRINGEDTSVVSPTLGFNIKTLTYQKY 60 Query: 61 TLNIWDVGGQRTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGASL 120 TLNIWDVGGQ+TIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSG+SL Sbjct: 61 TLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGSSL 120 Query: 121 LILANKQDINGALTPTEIAKVLNLEAMDKTRHWKIVGCSAYTGEGLLEGFDWLVQDIASR 180 LILANKQDI GALTP EIAKVLNL+AMDKTRHW IVGCSAYTGEGLLEGFDWLVQDIASR Sbjct: 121 LILANKQDIKGALTPEEIAKVLNLQAMDKTRHWNIVGCSAYTGEGLLEGFDWLVQDIASR 180 Query: 181 IYLLD 185 IY+LD Sbjct: 181 IYVLD 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44383 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93067 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62790 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81803 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94224 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11942 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47924 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3358 260 5e-72 >Contig3358 Length = 250 Score = 260 bits (664), Expect = 5e-72, Method: Compositional matrix adjust. Identities = 139/246 (56%), Positives = 168/246 (68%), Gaps = 44/246 (17%) Query: 1 MAFLVSPPEFSTKIFFNPNPHSTSQKSLSVLSNHEKLGSRARVRVSGI-------SEVGR 53 MA LV PE S F+ + ++ +N++K GS++ SGI SE+ R Sbjct: 1 MALLVPSPEISR--VFSNPNPNPNRNGFRFPTNNDKFGSKSVRVCSGIKDSAVRTSELDR 58 Query: 54 NVRLYGQFSAPVK----PSKEEEEKHNYYVNMGYAIRTLREEFPALFYKELSFDIYR--- 106 N+R YGQFSAPVK PSKE++EK YYVNMGYAIRTLREE P LF++ELS +IYR Sbjct: 59 NLRPYGQFSAPVKQGPKPSKEDQEKQEYYVNMGYAIRTLREELPELFFRELSLNIYRDDI 118 Query: 107 ---------------------------IFFRALWLDIISVWQPLENVIMVRWTIHGVPRV 139 IFF+ALW+D+ISV QPL+NV+MVRWTIHG+PRV Sbjct: 119 TFKDPINTFTGIENYKSIFSALRFHGQIFFKALWVDVISVLQPLDNVVMVRWTIHGMPRV 178 Query: 140 PWESRGRFDGTSEYKLDRNGKIYEHRVDNIALNSPPPKFRVLAVEDLIQSIGCPSTPKPT 199 PWESRGRFDGTSEYKLD+ GKIYEHRVDNIALNS PPKF++L V D++QS+GCPSTPKPT Sbjct: 179 PWESRGRFDGTSEYKLDKKGKIYEHRVDNIALNS-PPKFQMLGVGDIMQSLGCPSTPKPT 237 Query: 200 YFEISS 205 +FE SS Sbjct: 238 FFETSS 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43967 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2793 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22577 (308 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41106181 (389 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10231 (254 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80871 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158359626 356 e-100 >158359626 Length = 291 Score = 356 bits (913), Expect = e-100, Method: Compositional matrix adjust. Identities = 177/294 (60%), Positives = 210/294 (71%), Gaps = 24/294 (8%) Query: 13 CCGSTKFAKEMASASPFASLNQAVSAARHIWFNLVDVNGWLDAFSAHPQIGQSPS----- 67 CCGST+FAKEMA ASPF+SL +AV+ AR +WFN VDV GWL AFSAHPQIG SP Sbjct: 14 CCGSTQFAKEMAKASPFSSLEEAVTVARDVWFNKVDVTGWLQAFSAHPQIGHSPPSSSHP 73 Query: 68 --SQWSKAEQSTALATANESSSQELSDWNNRYRLRFGFIFIICASGRTAAEILAELKKRY 125 +QWSK EQSTA+ATA SS QELS WN RYR +FGF+F+ICASG++ ILAELKKRY Sbjct: 74 TSAQWSKGEQSTAIATATSSSLQELSQWNARYREKFGFVFLICASGKSTDGILAELKKRY 133 Query: 126 TNRPIIEFEIAAQEQMKITEXXXXXXXXXXXXXXXXTFQYSATAKTAEDRVSIIEGHLCA 185 NRPI+EFEIAA+EQMKITE + + T E S + Sbjct: 134 PNRPIVEFEIAAKEQMKITE-----------------LRLAKLFSTKEKVPSTGNVNPSV 176 Query: 186 STEASAGKISQIPTRTRLPITTHVLDVSQGSPAAGVEVRLEMWKGIQPRPLFGETDVSGW 245 + + ++ PTRTR PITTHVLD+S+GSP AG+EV LEMWKG QP P+FGE+ GW Sbjct: 177 AAKKVEAVKTETPTRTRPPITTHVLDISRGSPGAGIEVCLEMWKGHQPHPVFGESTTGGW 236 Query: 246 VYQGSSTTNKDGRCGQLMGMIEDLNPGFYKITFNTGKYCPEGFFPYVSIVFEIR 299 V+QGSSTTN DGR GQL+ + + +NPG Y+I+FNTGKYCP GFFPYVSIVFEIR Sbjct: 237 VFQGSSTTNSDGRSGQLLSIFDAVNPGIYRISFNTGKYCPGGFFPYVSIVFEIR 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64416 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68418 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95907 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20948 (62 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97733 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1576 103 9e-25 >Contig1576 Length = 164 Score = 103 bits (256), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 51/137 (37%), Positives = 89/137 (64%), Gaps = 4/137 (2%) Query: 55 TAPAQAATLLVIGPFLDNWLTDKRIYAYDYNIASVIFLILSCTIAVGTNLSQFICIGRFT 114 + P Q+ TLL+ GPFLD +LT++ ++++ Y ++F++LSC I+V N S F+ IG+ + Sbjct: 1 SCPYQSGTLLITGPFLDWFLTNQNVFSFKYTTQVLVFIVLSCLISVSVNFSTFLVIGKTS 60 Query: 115 AVSFQVLGHMKTILVLIMGFLFFGKEGLNFHVVLGMIIAVFGMIWYSNASTKPGGKERRS 174 V++QVLGH+KT LVL G+ + ++ +LG+++A+ GM+ YS T+ G +++ Sbjct: 61 PVTYQVLGHLKTCLVLTFGYTLL-HDPFDWRNILGILVALMGMVLYSYFCTREG--QKKV 117 Query: 175 SLPTTRPQKHGNLGESN 191 + T+ K G GES+ Sbjct: 118 AEEATQVLKAGE-GESD 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs195106183 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig303 65 8e-14 >Contig303 Length = 188 Score = 65.5 bits (158), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 34/53 (64%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Query: 60 RCRLSSRPNLCHRACGTCCARCNCVPPGTAGNTEVC-PCYANMTTHHGRRKCP 111 RC L SR C RAC TCC RC CVPPGT+GN E C CY +MTTH R KCP Sbjct: 136 RCSLHSRKRTCMRACMTCCDRCKCVPPGTSGNRERCGKCYTDMTTHGNRSKCP 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91356 (433 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13860 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29934 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64106189 (288 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54814 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83759 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41829 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81139 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54940 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100152 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33106181 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs115106185 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96229 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs14915 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100688 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56923 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58286 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101477 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig258 311 2e-87 >Contig258 Length = 254 Score = 311 bits (798), Expect = 2e-87, Method: Compositional matrix adjust. Identities = 169/249 (67%), Positives = 184/249 (73%), Gaps = 21/249 (8%) Query: 1 MINFEATELRLGLPXXXXXXXXXXXXXXXXXXXXXXXMKRGFADTVVDLKLNLSTK---- 56 +INFE TELRLGLP KRGF++TV DLKLN S++ Sbjct: 20 LINFEETELRLGLPGALKDGDQGVKSCSSG--------KRGFSETV-DLKLNFSSENDDV 70 Query: 57 -ESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQKDNEEGDNK 115 SG +E K K ASA A P AK+QVVGWPPVRSFRKNI+AVQK + + D Sbjct: 71 SRSGRDGQVEIKKEKDASAAPA-----PRAKAQVVGWPPVRSFRKNIVAVQKKSTDQDQA 125 Query: 116 AXXX--XXXNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMK 173 A + AFVKVSMDGAPYLRKVDLKLY+SYQELS ALGKMFSSFTIGNCGSQGMK Sbjct: 126 AEKSGSTSTSAAFVKVSMDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGMK 185 Query: 174 DFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPR 233 DFMNESKLIDLLNGS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPR Sbjct: 186 DFMNESKLIDLLNGSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPR 245 Query: 234 AVEKCKNRS 242 AVEK KNRS Sbjct: 246 AVEKFKNRS 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34637 (336 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98430 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77739 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17012 (364 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72556 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80709 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38944 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83469 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63212 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70579 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7970 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2876 191 1e-51 >Contig2876 Length = 258 Score = 191 bits (485), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 90/114 (78%), Positives = 100/114 (87%) Query: 1 MKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYE 60 MKGDYYRYLAEFK GD+RK A+ +M +Y+AA A TDL PTHPIRLGLALNFSVFYYE Sbjct: 124 MKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYYE 183 Query: 61 ILNSSEKACTMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQE 114 ILNS E+AC +AKQAF+EAI+ELDTL EESYKDSTLIMQLLRDNLTLWTSD+ E Sbjct: 184 ILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPE 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75205 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26204 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57835 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44263 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11168 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11568 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3826 61 5e-12 >Contig3826 Length = 597 Score = 60.8 bits (146), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 30/84 (35%), Positives = 51/84 (60%) Query: 68 ANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFGQPKGYAYVEFLQSE 127 A E S+++F GN+ Y+ ++V + F++ G V V + +D G KGY +VEF +E Sbjct: 335 ATPETSGSKTLFAGNLSYNIEQKDVVEFFKNVGQVVDVRLSSDADGNFKGYGHVEFATAE 394 Query: 128 AVQEALHLNESELHGRQLKVTVKR 151 Q+A+ LN S+L GR +++ + R Sbjct: 395 EAQKAVGLNGSDLFGRPIRLDLAR 418 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18794 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104345 (340 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69293 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs740 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79506 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78333 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20670 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs14660 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40476 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26729 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67798 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5249 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76152 (290 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50623 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75504 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs153106185 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82779 (314 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12614 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37297 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34972 (77 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41093 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79718 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7972 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67057 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53549 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73368 (58 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5614 87 1e-20 >Contig5614 Length = 75 Score = 87.4 bits (215), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 41/53 (77%), Positives = 43/53 (81%) Query: 4 RMFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHYFSREKEELKL 56 +MFPGMFMKKPDK ALKQL+ HV MFG WVV IRVTPYLLH EKEELKL Sbjct: 21 KMFPGMFMKKPDKKEALKQLKVHVGMFGAWVVAIRVTPYLLHALCGEKEELKL 73 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38911 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77660 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6106186 (109 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100012 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34284 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66719 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42241 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11882 (83 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78621 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51137 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95088 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20256 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41958 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87016 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3566 157 2e-41 >Contig3566 Length = 175 Score = 157 bits (398), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 79/158 (50%), Positives = 104/158 (65%), Gaps = 8/158 (5%) Query: 3 KKKVMVAIDESECRHYALQWALENLGDAI-SKSDLIIFTARPTEFIYV-------QASMF 54 +K VMVA+DESEC HYAL W ++NL ++I + S L+IF A+P + A M+ Sbjct: 15 EKPVMVAVDESECSHYALMWVIDNLKESINTNSPLLIFMAQPPPANNITFAAPLGSARMY 74 Query: 55 GAAPPDLLMSIQENQKKXXXXXXGRAKEICAKHGVVAETMTEMGDPKIVICEAAEKHKIQ 114 P+ ++QEN +K RAK+ICA HGV A+T+TE+GD K IC A KH ++ Sbjct: 75 CPPTPEFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEIGDAKTAICAAVLKHNVK 134 Query: 115 LLIVGSHSRGPIQRAFLGSVSNYCVHNAKCPVLVVRKP 152 LL++G G I+RA LGSVSNYCV NAKCPVLVV+KP Sbjct: 135 LLVLGERGLGKIKRAILGSVSNYCVLNAKCPVLVVKKP 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23191 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28197 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61925 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25868 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76009 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6310 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64173 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52138 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95107 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29712 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59973 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158358249 110 4e-27 >158358249 Length = 174 Score = 110 bits (276), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 62/178 (34%), Positives = 100/178 (56%), Gaps = 20/178 (11%) Query: 28 GKKKMKVMVAIDESAESVNALKWALDNLYGIVGFTPEAGGGGGILTIVHVQQPFQRFVLP 87 +K+ +++VA+DE ES+ AL W L N+ L +V+V+ P + +P Sbjct: 5 AEKERRILVAVDEGEESMYALSWCLGNVVS----------SKDTLILVYVKPP-KAVYMP 53 Query: 88 ALST-----SSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKM----VKAESLVLEG 138 T SS + +S + ++ E + +++ +A C+D + VK E+ + G Sbjct: 54 LDGTGRSQSSSGYMFSSDLYATMENYSNEVANSVIEKAKNKCRDVLQEQDVKVETRIENG 113 Query: 139 DPKDMICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVKPPKEQH 196 DP+D+IC EQ+ +LV+GSRG G IKRAFLGSVS++CA + CP++IVK PK + Sbjct: 114 DPRDVICHLVEQLGAHILVMGSRGYGLIKRAFLGSVSNHCAQNVNCPVLIVKKPKTNN 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67827 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs169106187 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 301 1e-84 >Contig1161 Length = 148 Score = 301 bits (770), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 143/148 (96%), Positives = 147/148 (99%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKSDKAKYESTARSWTQKYAMG 148 PEIAHMYK+D++KYE+TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRSKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2364 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67321 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67555 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4029 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2230 57 1e-10 >Contig2230 Length = 375 Score = 57.0 bits (136), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 21/47 (44%), Positives = 31/47 (65%) Query: 178 MRCAVCLXDFEPKEKVMLTPCNHMFHEDCIVPWVKSNAQCPVCXFSL 224 ++C+VCL D E + PC H FH +CI+PW++ ++ CPVC F L Sbjct: 238 LQCSVCLDDLEIGVEAKEMPCKHKFHGECILPWLELHSSCPVCRFLL 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46215 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32345 (190 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88716 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51829 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62609 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98630 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33343 (298 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3715 126 1e-31 >Contig3715 Length = 362 Score = 126 bits (317), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 72/131 (54%), Positives = 83/131 (63%), Gaps = 11/131 (8%) Query: 5 TITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRESNG 64 TITKQRE+WTEEEH+KFLEALKL+GR WR+IEEHVGTKTAVQIRSHAQKFFSKV +E G Sbjct: 55 TITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVAKELPG 114 Query: 65 CSTSXXXXXXXXXXXXXXXXXXXXXXXLAHP-PVKESLNPELSRTSLSPILSVSERENQS 123 HP P K + +PE R S SP SV+E+ +S Sbjct: 115 TGEGSLKPIEIPPPRPKRKPM--------HPYPRKHNGSPE--RRSPSPNFSVAEKGQES 164 Query: 124 PTSVMFAMGSD 134 PTSV+ GSD Sbjct: 165 PTSVLSVPGSD 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78797 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19677 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48779 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92264 (486 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig288 339 2e-95 >Contig288 Length = 499 Score = 339 bits (869), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 187/464 (40%), Positives = 251/464 (54%), Gaps = 37/464 (7%) Query: 48 CNIQNLNALEPRQKVESEAGVTEFWDQNNEQLQCANVAVFRQRIQQRGLLVPAYTNTPEI 107 C + + A EP ++E+EAG E WD N + QCA VAV R +++ GL +P YTN+P + Sbjct: 33 CMLNQIQAREPDNRIETEAGRIESWDYNQDDFQCAGVAVQRITVERNGLHLPFYTNSPRL 92 Query: 108 FYVVQGRGIHGVVFPGCAETXXXXXXXXXX----------------------------XX 139 YVVQGRG G+V PGC ET Sbjct: 93 LYVVQGRGQLGMVIPGCPETFEETEQSYEEQLQGSQQQGQGQQGRQQIGRRQGQQGQQES 152 Query: 140 XXXXXXHQKVRQLREGDVIALPAGAAHWIYNNGRDQLVLVALVDVGNSQNQLDQYFRKFY 199 HQKVR ++EGDVIA+PAG W YN+G LV V L D N NQLDQ R+FY Sbjct: 153 FEQLDRHQKVRPVKEGDVIAVPAGVTTWSYNDGDQSLVFVCLQDTSNLHNQLDQIPRRFY 212 Query: 200 LGGNPQPQLXXXXXXXXXXXXXXXXXXXXXX----XNLFRGFDERLLAEAFNVNPDLXXX 255 L GNPQ + N+F GFD RLLA+A N++ Sbjct: 213 LAGNPQDEFTQQGQSRHSIARQQGKIRHQQQGNNNNNVFAGFDTRLLADALNIDQQTAQQ 272 Query: 256 XXXXXXXXXXXXXVEEELRVLSPQRDRXXXXXXXXXTPSYERDNGFEETICTMKLRHNID 315 V+ L + P + NGFEE C MK++ NI Sbjct: 273 LQGQNDNRPQIVRVQGRLDFVQPPES----MREERQQQGRQGQNGFEEVFCHMKMKQNIG 328 Query: 316 KPSHADVYNPRAGRVTTVNRFNLPILRDLQLSAEKGNLYPNALLAPQWNLNAHSIVYVTR 375 KPS ADV++P+AGR++ +N ++P+LR L+LSAE+G Y NA+ +P WNLNAH + YV R Sbjct: 329 KPSMADVFSPQAGRISVLNGLSMPVLRHLRLSAERGFFYNNAIYSPHWNLNAHEVYYVIR 388 Query: 376 GNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRAGNRGLEWISFKTNDVAMTSQLA 435 G+ R+Q+V +NGE + D Q+R+GQL +VPQ AV+++A + G E+I+FKT D A+ + LA Sbjct: 389 GSARVQVVNDNGETILDDQVRQGQLFIVPQNHAVLQKAMSNGYEYIAFKTQDNAIINTLA 448 Query: 436 GRASVLRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPRS 479 GR SVLR LP V+ N++Q+ R +A+ LKYNRQE TV RS Sbjct: 449 GRTSVLRALPDVVLANAYQMDRQQARNLKYNRQE-TVALSSSRS 491 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23497 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2987 (65 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13607 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21414 (61 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60808 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs115106187 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52491 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99541 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 192 1e-51 >Contig2950 Length = 216 Score = 192 bits (487), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 96/209 (45%), Positives = 126/209 (60%), Gaps = 2/209 (0%) Query: 3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDT 62 Y YLFK ++IGD+GVGKS LL +FT F TIGVEF R I +D+K +K QIWDT Sbjct: 9 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDT 68 Query: 63 AGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCD 122 AGQE +R+IT +YYRGA GALLVYD+TR TF ++ WL++ R H ++N+ IML+GNK D Sbjct: 69 AGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKAD 128 Query: 123 LAHRRAVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSNES 182 L H RAVS E+ + FA+ FME SA + NVE AF + IY+ + +V ++ Sbjct: 129 LRHLRAVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEVGDDP 188 Query: 183 YGIKVXXXXXXXXXXXXXXXXXQAGGCCS 211 V + GCCS Sbjct: 189 AA--VPKGQTINVGGKDDVSAIKKAGCCS 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23106181 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30918 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97445 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70679 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52096 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18552 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158357974 65 1e-13 >158357974 Length = 97 Score = 64.7 bits (156), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 43/98 (43%), Positives = 53/98 (54%), Gaps = 12/98 (12%) Query: 1 MARSLFKAKLLLAPVADGISLSIGRRGYAAAAP-----LGTISRTGIMEKNDLTPAVRED 55 MARS AKLL A V++ +I RRGYAA +P G ++ + +L ED Sbjct: 1 MARSFSNAKLLSALVSN----TIARRGYAAGSPGLAAVRGEVAAASVTRSVNLEKKSGED 56 Query: 56 SGASS---AWAPDPITGYYRPENRAVEIDPAELREMLL 90 S +W P+P TG Y PENRA EID AELR LL Sbjct: 57 KVGSVFKVSWVPNPKTGVYGPENRADEIDVAELRNALL 94 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52645 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34256 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7496 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 74 5e-16 >89550571 Length = 226 Score = 74.3 bits (181), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 36/75 (48%), Positives = 56/75 (74%), Gaps = 1/75 (1%) Query: 4 KKLQLQRIENKSRCQVTFSKRRSGLIKKARELSVLCDVDLALVIFSSRGRLYEFCSADSL 63 KK+++++I+N QVT+SKRR GL+KKARELSVLCD + +++IFS+ G+L E S+ S Sbjct: 7 KKIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCE-SSSSST 65 Query: 64 ASILERYQSRITEEA 78 ++ RY+S+ +E Sbjct: 66 KDVITRYESQTGDEG 80 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23028 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 69 5e-15 >89550571 Length = 226 Score = 68.9 bits (167), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 34/57 (59%), Positives = 45/57 (78%) Query: 5 RVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS 61 ++++++I+N RQVT++KRR GLLKKA ELSVLCD E ++IIFS GKL E SSS Sbjct: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSS 64 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32673 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17743 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42225 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30951 (59 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24443 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105838 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4695 456 e-131 >Contig4695 Length = 382 Score = 456 bits (1174), Expect = e-131, Method: Compositional matrix adjust. Identities = 231/234 (98%), Positives = 232/234 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 Query: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKGSTLHLVLRLRGCMQIFVE 234 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK STLHLVLRLRG MQIFV+ Sbjct: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK 234 Score = 456 bits (1174), Expect = e-131, Method: Compositional matrix adjust. Identities = 231/234 (98%), Positives = 232/234 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 137 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 196 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 197 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 256 Query: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKGSTLHLVLRLRGCMQIFVE 234 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK STLHLVLRLRG MQIFV+ Sbjct: 257 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK 310 Score = 446 bits (1148), Expect = e-128, Method: Compositional matrix adjust. Identities = 226/227 (99%), Positives = 226/227 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 213 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 272 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 273 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 332 Query: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKGSTLHLVLRLRG 227 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK STLHLVLRLRG Sbjct: 333 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG 379 Score = 302 bits (774), Expect = 9e-85, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 289 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 348 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 152 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 349 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69806 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs14479 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51106185 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25420 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70317 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158355199 161 7e-43 >158355199 Length = 105 Score = 161 bits (408), Expect = 7e-43, Method: Compositional matrix adjust. Identities = 80/97 (82%), Positives = 87/97 (89%), Gaps = 1/97 (1%) Query: 1 MMERVLGPLPQHMLKRVDRHAEKYVRRG-RLDWPEGAASRESIKSVMKLPRLQNLIMQHV 59 MMERVLGPLPQHM+ R DR AEKY RRG RLDWP+GAASRES+++V KLPRL NLIMQHV Sbjct: 1 MMERVLGPLPQHMVLRADRRAEKYFRRGARLDWPDGAASRESMRAVFKLPRLPNLIMQHV 60 Query: 60 DHSAGDLTHLLQGLLRYDPTDRLTAREALRHPFFTRD 96 DHSAGDL LLQGLLRY+PT+RL AREALRHPFFTRD Sbjct: 61 DHSAGDLIELLQGLLRYEPTERLKAREALRHPFFTRD 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91669 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72108 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4218 226 8e-62 >Contig4218 Length = 191 Score = 226 bits (575), Expect = 8e-62, Method: Compositional matrix adjust. Identities = 105/190 (55%), Positives = 135/190 (71%), Gaps = 2/190 (1%) Query: 1 MSFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP 60 M+F GT QKC C+KTVY V++L+AD ++HK+CF+C HCKGTLKLSNY+S EGVLYC+P Sbjct: 1 MAFAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP 60 Query: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSP--SKAASMFSGTQEKCASCSKTVYPL 118 HF+QLFK +G+ +K+F+ K + P + P SKA+ MF GT++KC C TVYP Sbjct: 61 HFDQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAASKASGMFGGTRDKCFGCKNTVYPT 120 Query: 119 EKVAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSAS 178 EKV V YHK CFKC+HGGC+ISPSNY A EG LYCKHH +QL +EKG+ + L Sbjct: 121 EKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIREKGNLSQLEGGGD 180 Query: 179 MKRAAASVPE 188 ++A A E Sbjct: 181 NEKATAVAAE 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60298 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15458 (555 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11592 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39821 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97092 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38499 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13926 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4263 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81333 (370 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4113 652 0.0 >Contig4113 Length = 368 Score = 652 bits (1682), Expect = 0.0, Method: Compositional matrix adjust. Identities = 318/370 (85%), Positives = 335/370 (90%), Gaps = 2/370 (0%) Query: 1 MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID 60 MGE+TNV EYEAIAK+KLPKM +DYYASG+EDQWTL ENRNAFS+ILFRPRILIDVS ID Sbjct: 1 MGEVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNID 60 Query: 61 MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWSTSSVEEVAST 120 M TTVLGFKISMPIMIAPTA QKMAHPEGEY GTIMTLSSW+TSSVEEVAST Sbjct: 61 MTTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST 120 Query: 121 GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLT 180 GPGIRFFQLYVYKDR+VVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLT Sbjct: 121 GPGIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLT 180 Query: 181 LKNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKDVKWLQTITKLPILVKGVLTAEDXX 240 LKNF+GLDLGKMD+ANDSGLA+YVAGQIDRSLSWKDV+WLQTITKLPILVKGVLTAED Sbjct: 181 LKNFEGLDLGKMDKANDSGLASYVAGQIDRSLSWKDVQWLQTITKLPILVKGVLTAEDAR 240 Query: 241 XXXXXXXXXXXXSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALA 300 SNHGARQLDYVP+TIMALEEVVKA QGRIPVFLDGGVRRGTDVFKALA Sbjct: 241 LSVQSGAAGIIVSNHGARQLDYVPSTIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALA 300 Query: 301 LGASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWD 360 LGASGIFIGRPVV+SLAAEGE GVR+VL+MLREEFEL MALSGCRSLKEITR+HIV +WD Sbjct: 301 LGASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITRNHIVADWD 360 Query: 361 ASLPRPVPRL 370 A PRPVPRL Sbjct: 361 A--PRPVPRL 368 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36721 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1094 124 8e-31 >Contig1094 Length = 249 Score = 124 bits (310), Expect = 8e-31, Method: Compositional matrix adjust. Identities = 59/142 (41%), Positives = 86/142 (60%), Gaps = 4/142 (2%) Query: 4 RPLVTGLAEDIENGVVSIDWSRKTLGDFFKTKYDWDLLAARSIWAFGPDKQGPNILLDDT 63 RPL GL E I++G + K ++ WD A+ IW FGP+ GPN+++D Sbjct: 112 RPLEEGLPEAIDDGRIGPRDDPKIRSKILAEEFGWDKDLAKKIWCFGPETTGPNMVVDMC 171 Query: 64 LPTEVDKSLLNAVKDSIVQGFQWGAREGPLCDEPIRNVKFKIVDARIAPEPLHRGSGQII 123 + LN +KDS+V GFQW ++EG L +E +R + F++ D + + +HRG GQ+I Sbjct: 172 KGVQ----YLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVI 227 Query: 124 PTARRVAYSAFLMATPRLMEPV 145 PTARRV Y++ L A PRL+EPV Sbjct: 228 PTARRVIYASQLTAKPRLLEPV 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4826 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4792 472 e-135 >Contig4792 Length = 259 Score = 472 bits (1214), Expect = e-135, Method: Compositional matrix adjust. Identities = 229/243 (94%), Positives = 235/243 (96%) Query: 26 RTTANALKDVVPMGNAKYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGL 85 R N+L+DVVPMG KYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGL Sbjct: 17 RPNTNSLRDVVPMGPGKYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGL 76 Query: 86 SADPEAFARNRALEVIHGRWAMLGALGCITPEVLEKWLRVDFKEPVWFKAGAQIFSEGGL 145 SADPEAFA+NRALEVIHGRWAMLGA GCITPEVLEKW+RVDFKEPVWFKAGAQIFSEGGL Sbjct: 77 SADPEAFAKNRALEVIHGRWAMLGAFGCITPEVLEKWVRVDFKEPVWFKAGAQIFSEGGL 136 Query: 146 DYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLPGVGEGNDLYPGGQYFDPLGLADD 205 DYLGNPNLVHAQSILAVLG QV+LMGLVEGFRINGL GVGEGNDLYPGGQYFDPLGLADD Sbjct: 137 DYLGNPNLVHAQSILAVLGSQVLLMGLVEGFRINGLDGVGEGNDLYPGGQYFDPLGLADD 196 Query: 206 PVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLENPVANNAWVYATKFV 265 PVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHL+NPVANNAWVYATKFV Sbjct: 197 PVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFV 256 Query: 266 PGS 268 PGS Sbjct: 257 PGS 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70492 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54530 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 189 1e-50 >158372667 Length = 230 Score = 189 bits (480), Expect = 1e-50, Method: Compositional matrix adjust. Identities = 103/216 (47%), Positives = 133/216 (61%), Gaps = 4/216 (1%) Query: 3 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICH 62 IAFG ++ ++A + EF++T LF+FAGVGSA+A +K+ AD + L IAI H Sbjct: 4 IAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKLGADTTV---ALFFIAITH 60 Query: 63 XXXXXXXXXXXXNISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVT 122 +ISGGH+NPAVT GL GG IT+ + YWI QLL + + +LLK +T Sbjct: 61 ALVVAVMISAG-HISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLKYLT 119 Query: 123 GGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA 182 GGL P H+ TF L++TVYAT DPKKGSL + P GF+VGA Sbjct: 120 GGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGFVVGA 179 Query: 183 NILAAGPFSGGSMNPARSFGPAVASGNFQDNWIYWV 218 NILA G FSG SMNPARSFGPA+ S ++ D+W+YWV Sbjct: 180 NILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWV 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100704 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78778 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4661 139 7e-36 >Contig4661 Length = 251 Score = 139 bits (351), Expect = 7e-36, Method: Compositional matrix adjust. Identities = 63/120 (52%), Positives = 82/120 (68%) Query: 51 SVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCR 110 S S S+ + + W PG P +L GSLPGD GFDPL L DPE L+W VQ+E+V+ R Sbjct: 41 SPSASSFKVEAKKGEWLPGLPSPGYLTGSLPGDNGFDPLALAEDPENLKWFVQAELVNGR 100 Query: 111 WAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADI 170 WAMLG AG+ +PE+LT +GI+N P WY AG+ EYF ++TLF++E I + E RRW DI Sbjct: 101 WAMLGVAGMLLPEVLTSIGIINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDI 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs539 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63107 (342 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3762 240 6e-66 >Contig3762 Length = 261 Score = 240 bits (613), Expect = 6e-66, Method: Compositional matrix adjust. Identities = 110/198 (55%), Positives = 143/198 (72%), Gaps = 3/198 (1%) Query: 30 FLEDFKVTWSDAHLRQIEGGRAIQLVLDQNSGCGFASKRQYLFGRVSMKIKLVPGDSAGT 89 F +DF +TW D + + + + L LD+ SG GF S+ QYLFG++ M+IKLVPG+SAGT Sbjct: 24 FNQDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKSRNQYLFGKIDMQIKLVPGNSAGT 83 Query: 90 VTAFYMNSNTENVRDELDFEFLGNRTGQPYTVQTNIYANGKGDREQRVNLWFDPAADYHL 149 VT++Y++S + DE+DFEFLGN +G PYT+ TN++ GKG+REQ+ LWFDP D+H Sbjct: 84 VTSYYLSS-LGSAHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQQFYLWFDPTKDFHT 142 Query: 150 YTILWNHHHIVFYVDDVPIRVYKN--SGRAPFPMNQPMGVYSTLWEADDWATRGGLEKID 207 Y+ILWN I+F VD PIR +KN S PFP NQ M +YS+LW ADDWATRGGL K D Sbjct: 143 YSILWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAMWIYSSLWNADDWATRGGLVKTD 202 Query: 208 WSKAPFYAYYRDFDIEGC 225 WSKAPF A YR+F+ + C Sbjct: 203 WSKAPFTASYRNFNAQAC 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1106182 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12983 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47367 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104106187 (354 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1245 96 2e-22 >Contig1245 Length = 358 Score = 96.3 bits (238), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 69/226 (30%), Positives = 95/226 (42%), Gaps = 32/226 (14%) Query: 108 WPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVNXXXXXXXXXXXXXXX 167 W ++ + DQGHCGSCW F AL + FG +SLS Sbjct: 147 WRDEGIVTPVKDQGHCGSCWTFSTTGALEAAYAQAFGKQISLSEQQLVDCAGAFNNFGCS 206 Query: 168 XXYPISAWRYFVHHGVV-TEECDPYFDSTGCSHPGCEPAYPTPKCVRKCVKKNQLWRNSK 226 P A+ Y ++G + TEE PY G E N Sbjct: 207 GGLPSQAFEYVKYNGGLDTEEGYPYTAKDGACKFSSE--------------------NVG 246 Query: 227 HYSISAYRIN-SDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGG----- 280 + + I D E + + PV ++F V DF YKSGVY T + G Sbjct: 247 VQVLDSVNITLGDEEGLKHAVAFVRPVSIAFQVVSDFRLYKSGVY---TSETCGNTPMDV 303 Query: 281 -HAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGI 325 HAV +G+G ++G YW++ N W +SWG +GYFK++ G N CGI Sbjct: 304 NHAVLAVGYGV-ENGVPYWLIKNSWGQSWGDNGYFKMEYGKNMCGI 348 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10433 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10036 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69649 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs314 (386 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91270 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48857 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29417 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5788 77 7e-17 >Contig5788 Length = 224 Score = 77.4 bits (189), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 49/138 (35%), Positives = 70/138 (50%), Gaps = 11/138 (7%) Query: 98 RTMRQMLDTMDRLLEDTMAFPGRSRAGGGGQVRTPWDIKEEENEIKMRFDMPGLXXXXXX 157 R++ Q+L+ MD+ +E+ + R G G R WD+KE E+ + +R DMPGL Sbjct: 94 RSLSQVLNLMDQFMEN--PYLAAYRGLGAGGSRRGWDVKETEDSLLLRMDMPGLNKEDVK 151 Query: 158 XXXXXXXLVIKGEHRAEEAGGDPSWSGASFSSYDTRLQLPDNC-EKDKVKAELKNGVLYI 216 L +KGE G DP + TRL LP E + +KAE+KNGVL + Sbjct: 152 ISVEQGTLTVKGE------GKDPEGEEDGGRRFSTRLDLPAKIYELNSIKAEMKNGVLKL 205 Query: 217 SIPKTNVERK--VIDVQI 232 +PK E K V +V+I Sbjct: 206 VVPKVKEEEKKNVFEVKI 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100001 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs119106187 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16821 (83 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85520 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84309 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27169 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43484 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99447 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40532 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92894 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26557 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56622 (79 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5901 (407 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22934 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41942 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96276 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64324 (310 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 129 2e-32 >Contig4694 Length = 351 Score = 129 bits (324), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 99/325 (30%), Positives = 152/325 (46%), Gaps = 54/325 (16%) Query: 5 IPVIDFNELEGENR----KKTMALLHQ---ACEKWGFFQVDNHGIDKKLMEKVKQLVNSH 57 +P+ID + L + K L+ + AC+ WGFFQV NHG+ ++ EKV+ Sbjct: 26 VPLIDLSPLTSADSISDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTARKF 85 Query: 58 YEEYLKG------------GFYDSELVKSLEKENKNNIRDVDWESTF-FIWHRPS----- 99 + + L+ G+YD+E K N+RD W+ + F+ P+ Sbjct: 86 FAQPLEEKRKIRRDEKCVVGYYDTEHTK--------NVRD--WKEVYDFLVEEPTLVPSS 135 Query: 100 ---------SNINEIRNLSEDFRNTMEDYIAQLIKLAEKLSELMCENLGLEKSYIKNAFS 150 N+ + R MEDY ++ KL+ KL L+ +LGL + K F Sbjct: 136 TEPDDKEETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYF- 194 Query: 151 GEKGPSVGTKVAKYPQCPYPELVRGLREHTDAGGIILLLQDDQVPGLEFFK--DGEWVKI 208 K + ++ YP CP PEL G+ H D G + +L QD +V GLE + DGEW+++ Sbjct: 195 --KDQTSFIRLNHYPPCPSPELALGVGRHKDGGALTVLAQD-EVGGLEVKRKTDGEWIRV 251 Query: 209 PPSRNNTIFVNTGDQVEVLSNGRYQSALHRVMPEKNGSRLSIATFYNPANDAIISPAIKL 268 P+ N I +N GD ++V SN Y+S HRVM R S+ F NPA+ + P +L Sbjct: 252 RPTPNAYI-INVGDVIQVWSNDEYESVEHRVMVNSEKERFSVLFFLNPAHYTEVKPLEEL 310 Query: 269 L---YPSYYSFQDYLKLYGTTKFSD 290 P+ Y+ + K K S+ Sbjct: 311 TNKQNPAKYTPYSWGKFLTLRKLSN 335 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76227 (409 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42987 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs132106182 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23947 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60695 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8368 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35513 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75740 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27289 (413 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5164 129 3e-32 >Contig5164 Length = 389 Score = 129 bits (324), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 91/293 (31%), Positives = 154/293 (52%), Gaps = 24/293 (8%) Query: 81 IRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVL 140 +R ++G++ + E L FA TG V + K+IR +++ YGF+ + R A + Sbjct: 18 LRLRYVGNIHTQVTEPLLQEVFASTGAVESCKLIRKEKSS----YGFVHYFDRRCAALAI 73 Query: 141 QTFNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDYMLQETFRARYPS 200 + NG + Q ++NWA + +G++ D + IFVGDL+ +VTD L F Y S Sbjct: 74 VSLNGRQLFG--QPIKVNWA-YASGQREDTSGHFNIFVGDLSPEVTDATLFACFSV-YSS 129 Query: 201 TKGAKVVIDRLTGRTKGYGFVRFGDESEQLRAMTEMNGVFCSTRPMRIGPAT-------N 253 A+V+ D+ TGR++G+GFV F ++ + A+ ++NG + ++R +R AT + Sbjct: 130 CSDARVMWDQKTGRSRGFGFVSFRNQQDAQSAINDLNGKWLASRQIRCNWATKGAGTNED 189 Query: 254 KKTVSGQQ--QYPKASYQNSQVAQSDDDPNN----TTVFVGNLDSIVTDEHLRELFSQYG 307 K++ G+ + S ++ + +++ P N TTV+VGNL VT L F G Sbjct: 190 KQSSDGKSVVELTNGSSEDGKEPTNNEAPENNPQYTTVYVGNLAPEVTQLDLHRHFYALG 249 Query: 308 QLV--HVKIPAGKRCGFVQFADRSCAEEALRMLNG-TQLGGQNIRLSWGRSPS 357 V V++ K GFV+F+ A A++M N + L G+ I+ SWG P+ Sbjct: 250 VGVIEEVRLQRDKGFGFVRFSTHGEAALAIQMGNTQSNLFGRQIKCSWGSKPT 302 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11086 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91001 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55446 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540286 67 1e-13 >89540286 Length = 247 Score = 66.6 bits (161), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 37/82 (45%), Positives = 49/82 (59%), Gaps = 2/82 (2%) Query: 129 YAANENQLHDDPNTALFFLEKDLH-PGMKMNLHFTQ-TSNGATFLSRQAAKSTPFSSDKL 186 Y +++ + +P+ FF +DL G + L + TSN AT LSRQ AKS PFSS KL Sbjct: 83 YGSSKEETPAEPDLTTFFQGQDLQQKGKTVTLRLLKPTSNKATLLSRQVAKSIPFSSSKL 142 Query: 187 PEIFNQFSVKPGSVEAEIMQNT 208 PEI F VKP S+ A +M+ T Sbjct: 143 PEILTYFGVKPNSLAAGLMKQT 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41128 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43783 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72898 (395 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67121 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51284 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68684 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55601 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4584 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95282 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2665 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6097 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs106124 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33029 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9219 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59938 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64410 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57459 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65961 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 152 2e-39 >Contig2950 Length = 216 Score = 152 bits (383), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 80/176 (45%), Positives = 113/176 (64%), Gaps = 3/176 (1%) Query: 7 SQQEFDYLFKLLMIGDSGVGKSSLLLSFTSDNFE-ELSPTIGVDFKVKYVDVGGKKLKLA 65 S ++DYLFK+++IGDSGVGKS+LL FT + F E TIGV+F + + V K +K Sbjct: 5 SDDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQ 64 Query: 66 IWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLL 125 IWDTAGQER+R +TS+YYRGA G ++VYDVTR TF N+ + W KE+ + T+ + + +L Sbjct: 65 IWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENV-ERWLKELRDH-TDSNIVIML 122 Query: 126 VGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPS 181 VGNK D R V+ ++ FA F+E SA +NV+ F E++ +I S Sbjct: 123 VGNKADLRHLRAVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVS 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67549 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64674 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89891 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25539 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26707 (280 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60257 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80488 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64873 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80386 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61049 (292 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40321 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2551 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63985 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73170 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102369 (56 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88495 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs90040 (59 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53206 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59910 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42822 (333 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1991 217 9e-59 >Contig1991 Length = 284 Score = 217 bits (552), Expect = 9e-59, Method: Compositional matrix adjust. Identities = 121/280 (43%), Positives = 157/280 (56%), Gaps = 49/280 (17%) Query: 7 QPQVITCKAAVAWGAGQXXXXXXXXXXXXXXXXIRIKVVCTSLCRSDITAW---ETQAIF 63 Q QVITCKAAVAW + +R++++ T+LC +D W + + +F Sbjct: 4 QGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVRILYTALCHTDAYTWGGKDPEGLF 63 Query: 64 PRIFGHEASGIVESVGPGVTEFNEGEHVLTVFIGECKTCRQCKSDKSNTC-EVLGLERRG 122 P I GHEA+GIVESVG GVT G+HV+ + EC C+ CKS K+N C +V G Sbjct: 64 PCILGHEAAGIVESVGEGVTTVQPGDHVIPCYQAECGECKFCKSGKTNLCGKVRAATGVG 123 Query: 123 VMHSDQQTRFSIKG---------------------------------------------L 137 VM SD+Q+RFSI G L Sbjct: 124 VMMSDRQSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCGVPTGL 183 Query: 138 GAAWNVADISKGSTVVIFGLGTVGLSVAQGAKARGASRIIGVDTNPEKCEKAKAFGVTEF 197 GA WN A + GS V IFGLGTVGL+VA+GAK GASRIIGVD + +K + AK FGVTEF Sbjct: 184 GAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKTAGASRIIGVDIDSKKFDIAKNFGVTEF 243 Query: 198 LNPNDNNEPVQQVIKRITDGGADYSFECIGDTGMITTALQ 237 +NP D+ +P+QQV+ +TDGG DYSFECIG+ ++ AL+ Sbjct: 244 VNPKDHEKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALE 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9226 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48454 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 90 1e-20 >89550571 Length = 226 Score = 89.7 bits (221), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 54/149 (36%), Positives = 89/149 (59%), Gaps = 9/149 (6%) Query: 5 RVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSCME 64 ++++++I+N RQVT+SKRR GLLKKA E+SVLCD E ++I+FS GKL E S+ S + Sbjct: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSSTKD 67 Query: 65 RILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQ--KHFMGEDLADLSL 122 ++ RYE E L + ++ L++ +K E+ +++ + GEDL L++ Sbjct: 68 -VITRYESQTGDEGNLDQSSLD------LQHDCIKLSNEIADKSRVLRQMNGEDLEGLNI 120 Query: 123 KELQSVEQQIDSGLKLIRSRKNQLMLQSI 151 ELQ +E +ID L + K + ++ I Sbjct: 121 DELQRLETKIDGSLNRVLQTKEENIIGEI 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6589 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105359 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74879 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83508 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79201 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67260 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60106184 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 142 9e-37 >89540794 Length = 177 Score = 142 bits (359), Expect = 9e-37, Method: Compositional matrix adjust. Identities = 67/85 (78%), Positives = 77/85 (90%) Query: 1 MASGDVEFRCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEK 60 MAS ++EFRCFVGGLAWAT + +L AF +G+I+ESKIINDRETGRSRGFGFVTF +EK Sbjct: 1 MASAEIEFRCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEK 60 Query: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 +MRDAIEGMNGQ+LDGRNITVNEAQ Sbjct: 61 AMRDAIEGMNGQDLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36042 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 89 1e-20 >Contig1666 Length = 421 Score = 89.4 bits (220), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 57/159 (35%), Positives = 82/159 (51%), Gaps = 25/159 (15%) Query: 2 EELPPGYRFFPTEEELVSFYL------------------INKLE--ELCGE-KCQGDTEQ 40 + L PG+RF PT+EELV +YL I K+E +L G+ K + + Sbjct: 7 QSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLKSRDTE 66 Query: 41 WFFFTPRQXXXXXXXXPSRTTASGYWKATGSPSYVYSSDNRVIGVKKTMVFYKGKAPTGR 100 W+FF+ +R T GYWK TG V S +R +G+KKT+VF+ G+AP G Sbjct: 67 WYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHS-SRAVGMKKTLVFHSGRAPKGA 125 Query: 101 KTKWKMHEYRAIEGASNPSRAVIPKLRHEFSLCRIYVKS 139 +T W MHEYR ++ ++ K + LCRI+ KS Sbjct: 126 RTNWVMHEYR-LDNQELEKAGIVEK--DAYVLCRIFQKS 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2411 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56910 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38492 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60524 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7608 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23153 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27421 (478 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22061 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12987 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3834 285 1e-79 >Contig3834 Length = 273 Score = 285 bits (729), Expect = 1e-79, Method: Compositional matrix adjust. Identities = 140/203 (68%), Positives = 157/203 (77%) Query: 2 PLTGVVFQPFEEVKKEXXXXXXXXXXXXARQKYEDECEAAINEQINVEYNVSYVYHALYA 61 PLTGV+F+PFEEVKKE ARQKY ++ EAA+NEQINVEYNVSYVYHA+YA Sbjct: 71 PLTGVLFEPFEEVKKELDLVPTLPQVSLARQKYSEDSEAAVNEQINVEYNVSYVYHAMYA 130 Query: 62 YFDRDNIALRGLXXXXXXXXXXXXXXXXXXMEYQNLRGGKVKLHSIMQPPSEFDHAEKGD 121 YFDRDN+ALRGL MEYQN RGG+VKL SI+ P SEFDHAEKGD Sbjct: 131 YFDRDNVALRGLAKFFKESSEEERGHAEKLMEYQNKRGGRVKLQSILMPVSEFDHAEKGD 190 Query: 122 ALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQVEAINKIAKYVSQL 181 ALYAMELALSLEKLTNEKLL+L VAD+N D Q+ +FVESEFL EQVEAI KI++YV+QL Sbjct: 191 ALYAMELALSLEKLTNEKLLNLQHVADKNKDVQLTDFVESEFLAEQVEAIKKISEYVAQL 250 Query: 182 RMVGKGHGVWHFDQMLLHEGDAA 204 R VGKGHGVWHFDQMLLH+ AA Sbjct: 251 RRVGKGHGVWHFDQMLLHDEVAA 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11106190 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs167106186 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9195 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45048 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33047 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61068 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105406 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44142 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34035 (460 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50758 (335 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71808 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2099 488 e-140 >Contig2099 Length = 263 Score = 488 bits (1256), Expect = e-140, Method: Compositional matrix adjust. Identities = 243/265 (91%), Positives = 250/265 (94%), Gaps = 3/265 (1%) Query: 1 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGP 59 MA STMALSS +F GKAV LAP+ E+ GRISMRKT K+VSSGSPWYGPDRVKYLGP Sbjct: 1 MAASTMALSSPTFAGKAVQLAPT--EVFGTGRISMRKTVGKAVSSGSPWYGPDRVKYLGP 58 Query: 60 LSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR 119 SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLAR Sbjct: 59 FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAR 118 Query: 120 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGP 179 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGP Sbjct: 119 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGP 178 Query: 180 LGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE 239 LGEV DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLE Sbjct: 179 LGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLE 238 Query: 240 NLADHLADPVNNNAWAYATNFVPGK 264 NLADHLADPVNNNAW+YATNFVPGK Sbjct: 239 NLADHLADPVNNNAWSYATNFVPGK 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74474 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6581 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98448 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1991 207 5e-56 >Contig1991 Length = 284 Score = 207 bits (527), Expect = 5e-56, Method: Compositional matrix adjust. Identities = 120/286 (41%), Positives = 153/286 (53%), Gaps = 11/286 (3%) Query: 11 GKVIRCKAAICRIPGKPLXXXXXXXXXXKAWEVRIKILCTSLCHSDVTFWKSSTDLPKLP 70 G+VI CKAA+ P KPL +A EVR++IL T+LCH+D W P+ Sbjct: 5 GQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVRILYTALCHTDAYTWGGKD--PEGL 62 Query: 71 LPVIFXXXXXXXXXXXXXXXXXXXXRDLVLPIFQRDCGECRDCKSSKSNTCSKF----GR 126 P I D V+P +Q +CGEC+ CKS K+N C K G Sbjct: 63 FPCILGHEAAGIVESVGEGVTTVQPGDHVIPCYQAECGECKFCKSGKTNLCGKVRAATGV 122 Query: 127 GYRPNMPRDGTSRFRELKGDVIHHFLNISSFTEYTVVDITHVVKITPHIPLGIACLLTCG 186 G M D SRF + G I+HF+ S+F++YTVV V KI P PL CLL CG Sbjct: 123 GV---MMSDRQSRF-SINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCG 178 Query: 187 VSTGVGAAWKVAGVEVGSTVAIFXXXXXXXXXXXXXRLNRASKIIGVDINPEKFEIGKKF 246 V TG+GA W A VE GS VAIF + AS+IIGVDI+ +KF+I K F Sbjct: 179 VPTGLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKTAGASRIIGVDIDSKKFDIAKNF 238 Query: 247 GITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLASVMNDAFN 292 G+T+F+NP +K + QV+ ++TDGG DY FECIG SVM A Sbjct: 239 GVTEFVNPKD-HEKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALE 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11855 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48198 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54151 (64 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59108 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33591 (50 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92485 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67731 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3077 219 1e-59 >Contig3077 Length = 183 Score = 219 bits (557), Expect = 1e-59, Method: Compositional matrix adjust. Identities = 101/127 (79%), Positives = 111/127 (87%) Query: 2 ASNPRWAQKTVTLPPLRRGCHLITPKIVKEIAQDLSEFKCGLAHLFLLHTSASLTINENY 61 AS P+WAQKT+TLPP RGCHLITP+I+ I QDLS F CGLAHLFL HTSASLTINENY Sbjct: 39 ASGPKWAQKTITLPPQTRGCHLITPQIMNGIRQDLSGFNCGLAHLFLQHTSASLTINENY 98 Query: 62 DSDVRDDTETFLNKIVPEGRSAPWKHTLEGPDDMPAHIKSSMFGCTLTIPITDGQLNMGT 121 D DVR DTETFLN+IVPEG SAPW+HTLEGPDDMPAHIKSSMFGC L+IPIT+G+LNMGT Sbjct: 99 DCDVRTDTETFLNRIVPEGNSAPWRHTLEGPDDMPAHIKSSMFGCQLSIPITNGKLNMGT 158 Query: 122 WQELHGC 128 WQ + C Sbjct: 159 WQGIWLC 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88106183 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88423 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102311 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103446 (343 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52432 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88680 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4390 162 9e-43 >Contig4390 Length = 667 Score = 162 bits (411), Expect = 9e-43, Method: Compositional matrix adjust. Identities = 83/160 (51%), Positives = 112/160 (70%), Gaps = 7/160 (4%) Query: 59 IIGIDLGTTNSCVALMEGKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAVTNPT 118 +IGIDLGTT SCV + + + ++I N +G+R TPS VAF E L+G AK QA N Sbjct: 38 VIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTD-SERLIGEAAKNQAAVNHE 96 Query: 119 NTLFGTKRLIGRKFDDPQTQKEMQMVSYKIVRAPNGDAWVEA---NGQQ--YSPSQIGAF 173 T+F KRLIGRKF D + Q++M++ +KIV +G +++ +G+ +SP +I A Sbjct: 97 RTVFDVKRLIGRKFADKEVQRDMKLFPFKIVN-QDGKPYIQVKIKDGETKVFSPEEISAM 155 Query: 174 VLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAG 213 +LTKMKETAE++LGK + AV+TVPAYFNDAQRQATKDAG Sbjct: 156 ILTKMKETAEAFLGKKIQNAVVTVPAYFNDAQRQATKDAG 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72584 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84053 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44556 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20787 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75266 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71525 (310 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52623 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig561 309 1e-86 >Contig561 Length = 371 Score = 309 bits (791), Expect = 1e-86, Method: Compositional matrix adjust. Identities = 157/275 (57%), Positives = 189/275 (68%), Gaps = 7/275 (2%) Query: 3 VRKTCGXXXXXXXXXXXXXXAETLSLNVRSVRYTRGSFIFPGNQLYPHRNFSEEVSVLDS 62 + KTCG AETLSL VRSVRY+RGSFIFPG Q PHR+FSEEV+VLD Sbjct: 81 IIKTCGTTKLLRSIPAILKLAETLSLAVRSVRYSRGSFIFPGAQPSPHRSFSEEVAVLDG 140 Query: 63 YFGKLVSGSNAYIIGGSGKPQKWHVYSASAEPLI------SSDPVFTIEMCLTGLDREMA 116 +F KL S AYI+G QKWHVYSASAE SS P +T+EMC+TGLDR+ A Sbjct: 141 HFSKLGLASRAYIMGSPDNSQKWHVYSASAELASLFWGTRSSGPTYTLEMCMTGLDRKKA 200 Query: 117 SVFYKTQSGSAGAMTVNSGIRKILPDSKICDFEFDPCGYSMNSVEGAAISTVHVTPEDGF 176 SVFYKT + SA MT +SGIRKILP S+ICDFEFDPCGYSMNS+EG A+ST+HVTPEDGF Sbjct: 201 SVFYKTNASSAAIMTEDSGIRKILPKSEICDFEFDPCGYSMNSIEGDAVSTIHVTPEDGF 260 Query: 177 SYASFETVGYDPNDVNLNQLVERVLACFQPRDFSIAVHAEVAGKMIEQKCLLNVKGYSXX 236 SYASFETVGY+ DVNL +L+ERVL CF+P +FS+++H+ +A E + L + GY Sbjct: 261 SYASFETVGYNFKDVNLTRLIERVLDCFKPAEFSVSLHSTIAASE-ELEFPLELSGYCCG 319 Query: 237 XXXXXXXXXXXSILYQKFVKTEGNGSPRSTLKCYW 271 +++Y F K G+ SPRS LKC W Sbjct: 320 STSYEELGLGGAVIYHSFNKDGGSQSPRSILKCCW 354 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25932 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41118 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66150 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5776 191 3e-51 >Contig5776 Length = 289 Score = 191 bits (486), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 107/249 (42%), Positives = 142/249 (57%), Gaps = 13/249 (5%) Query: 29 PSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLD 88 P LS SFY S+CP + + + LKK F DI A L+RLHFHDCFV GCD S+LLD Sbjct: 31 PVVKGLSWSFYDSSCPKLDSIVRKQLKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLD 90 Query: 89 STNTIDSEKFAAPN-NNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSGGP 147 + + SE+ A PN + A+ F++I++++ V C RVVSCAD+ +AA +V LSGGP Sbjct: 91 GSASGPSEQQAPPNLSLRAKAFQIINDLREIVHSKCGRVVSCADLTALAARDAVFLSGGP 150 Query: 148 SWAVPLGRRDS---RTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTF 204 + VPLGR+D T N LA NLP P +L + L D D+VALSG HT Sbjct: 151 EYEVPLGRKDGLNFATRNETLA--NLPAPTSNTTKLLTDLAKKNL-DATDVVALSGGHTI 207 Query: 205 GRAQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNK 264 G C F GRLY D ++D TF L+++CP D+ +PD FDNK Sbjct: 208 GLGHCTSFTGRLYPTQ-----DASMDKTFANDLKQVCPAADTNATTV-LDIRSPDTFDNK 261 Query: 265 YFSNLRGRK 273 Y+ +L R+ Sbjct: 262 YYVDLMNRQ 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94106186 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62778 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21926 (123 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63894 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1993 377 e-107 >Contig1993 Length = 585 Score = 377 bits (969), Expect = e-107, Method: Compositional matrix adjust. Identities = 187/251 (74%), Positives = 199/251 (79%), Gaps = 34/251 (13%) Query: 3 AMQISDRTCTGVLCSHPLSRDIRIESLSVTFHGHDLIVDSELEXXXXXXXXXXXXXXCGK 62 +M+ISDR CTGVLCSHPLSRDIRIESLSVTFHGHDLIVDSELE CGK Sbjct: 50 SMRISDRNCTGVLCSHPLSRDIRIESLSVTFHGHDLIVDSELELNYGRRYGLLGLNGCGK 109 Query: 63 STLLTAIGCRELPIPDHMDIYHLSREIEASDMSSLEAVISCDEERLKLEKE--------- 113 STLLTAIGCRELPIP+HMDI+HLSREIEASDMSSLEAVISCDEER++LEKE Sbjct: 110 STLLTAIGCRELPIPEHMDIFHLSREIEASDMSSLEAVISCDEERIRLEKEVEELAAQDD 169 Query: 114 -------------------------AEILYGLGFNKTMQAKKTRDFSGGWRMRIALARAL 148 AEILYGLGF+K MQAKKTRDFSGGWRMRIALARAL Sbjct: 170 GGGEQLERIYERLEALDAATAEKRAAEILYGLGFDKQMQAKKTRDFSGGWRMRIALARAL 229 Query: 149 FINPTILLLDEPTNHLDLEACVWLEETLKNFDRILVVISHSQDFLNGVCTNIIHMQNKKL 208 FINPTILLLDEPTNHLDLEACVWLEETLK F+RILVV+SHSQDFLNGVCTNIIHMQ+KKL Sbjct: 230 FINPTILLLDEPTNHLDLEACVWLEETLKKFERILVVVSHSQDFLNGVCTNIIHMQSKKL 289 Query: 209 KFYTGNFDQYV 219 K Y+GN+DQYV Sbjct: 290 KIYSGNYDQYV 300 Score = 66.2 bits (160), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 51/173 (29%), Positives = 83/173 (47%), Gaps = 20/173 (11%) Query: 60 CGKSTLLTAIGCRELPIP------DHMDI----YHLSREIEASDMSSLEAVI----SCDE 105 GKSTLL + P+ +H+ I HL+ +++ ++S+L+ +I +E Sbjct: 419 AGKSTLLKLMTGELTPLDGMVRRHNHLRIAQFHQHLTEKLDM-ELSALQFMIKEYPGNEE 477 Query: 106 ERLKLEKEAEILYGLGFNKTMQAKKTRDFSGGWRMRIALARALFINPTILLLDEPTNHLD 165 E+++ + G Q + S G R R+ A F P +LLLDEPTNHLD Sbjct: 478 EKMRAS-----IGKFGLTGKAQVMPMSNLSDGQRSRVIFAWLAFRQPQMLLLDEPTNHLD 532 Query: 166 LEACVWLEETLKNFDRILVVISHSQDFLNGVCTNIIHMQNKKLKFYTGNFDQY 218 +E L E L +D LV++SH +N V I +N+ + + G+ Q+ Sbjct: 533 IETIDSLAEALNEWDGGLVLVSHDFRLINQVAHEIWVCENQAVTRWEGDIMQF 585 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs90106184 (303 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36106190 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 113 1e-27 >158372667 Length = 230 Score = 113 bits (283), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 81/218 (37%), Positives = 116/218 (53%), Gaps = 18/218 (8%) Query: 40 YRALIAEFVATLLFLYVSVATVIGHKKQ-SDACGGVGLLGIAWAFGGMIFVLVYCTAG-I 97 +RALI EFV T LF++ V + + K +D + + I A + V V +AG I Sbjct: 18 WRALIVEFVTTFLFIFAGVGSAMATDKLGADTTVALFFIAITHA----LVVAVMISAGHI 73 Query: 98 SGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTV 157 SGGH+NPAVT GL ++L R+V Y + Q L A L +K+ L +++ Sbjct: 74 SGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYL----LKYLTGGLTTPIHSL 129 Query: 158 ASGYNKGSALGAEIIGTFVLVYTVFSA-TDPKRSARDSHVPVLAPLPIGFAVFMVHLATI 216 ASG + EII TF L++TV++ DPK+ + D L P GF V LA Sbjct: 130 ASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDG----LGPTLTGFVVGANILAGG 185 Query: 217 PITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVG 254 +G +NPARSFG A++ + W DHW++WVGP +G Sbjct: 186 AFSGASMNPARSFGPALVSWD---WTDHWVYWVGPLIG 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91615 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50247 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40516 (113 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34089 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25451 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32845 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50500 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93945 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55022 (368 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82297 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3643 206 6e-56 >Contig3643 Length = 279 Score = 206 bits (524), Expect = 6e-56, Method: Compositional matrix adjust. Identities = 104/165 (63%), Positives = 123/165 (74%), Gaps = 4/165 (2%) Query: 1 QKRIIREFINSISAVESKRPSVAGWWKTVQLYTDQTGANISRTVRLGQEKNDRFYSHGKS 60 QK +I++F+ SIS + PSVA WW+TV LYTDQTGAN+SR+V + E D YS GK+ Sbjct: 24 QKLLIKDFLLSISTTAAPSPSVAEWWRTVSLYTDQTGANVSRSVVVAGEHADVKYSQGKA 83 Query: 61 LTRLSVQSVIKSHVTARSKPLPINPKGGLYLLLTSTDVYVQDFCGQVCGFHYFTFPSIVG 120 LTRLSVQ VI + V RS P P + K G+YL+LTS DV +QDFC VCGFHYFTFPS+VG Sbjct: 84 LTRLSVQQVIGNAV--RSAPFPADHKHGIYLVLTSDDVTMQDFCRAVCGFHYFTFPSMVG 141 Query: 121 YTLPYAWVGNSAKLCPGVCAYPFAVPQYM--PGLKAVKSPNGDVG 163 YTLPYAW+GNSAK CP VCAYPFA+P YM G A+ PN DVG Sbjct: 142 YTLPYAWIGNSAKQCPEVCAYPFALPAYMGGGGPGALSPPNKDVG 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88814 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51862 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85106183 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1778 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51158 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55091 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15084 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42420 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98970 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19106181 (303 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13890 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7831 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41454 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33967 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83105 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10070 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44579 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65208 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4624 116 2e-29 >Contig4624 Length = 321 Score = 116 bits (291), Expect = 2e-29, Method: Composition-based stats. Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 3/96 (3%) Query: 1 MPRGTLEVLLVGCKGLEDSDFLGSVDPYVVLTCRTQEQKSSI--GSGSGPEWNETFVFTI 58 MPRGTLEV+L +GL+++DFL + PY VLT +TQE+KS++ G GS PEWN++F+FTI Sbjct: 1 MPRGTLEVVLADARGLDNNDFLAKISPYAVLTVKTQEKKSTVLTGKGSNPEWNQSFLFTI 60 Query: 59 TGD-VTELTLKIMDKDTFSNDDYLGEATSVVFSLFI 93 + D V EL L IMDKD FS DDY+GEAT + F+ Sbjct: 61 SDDEVKELHLTIMDKDNFSADDYVGEATIPLLPAFV 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21394 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38569 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7342 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96097 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36486 (413 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20766 (390 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42230 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15150 (57 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89951 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101256 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3406 338 2e-95 >Contig3406 Length = 450 Score = 338 bits (867), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 179/263 (68%), Positives = 204/263 (77%), Gaps = 8/263 (3%) Query: 11 SEFSGLRNSASLPF---GRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFG 67 +EFSGLR+S+ L + GR++S F +V A T +S S K AKLKVAINGFG Sbjct: 36 AEFSGLRSSSCLTYASNGREASL-FDAVAAQLTPQ--TSGSAPVKGETVAKLKVAINGFG 92 Query: 68 RIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVD 127 RIGRNFLRCWHGRKDSPLEV+ +ND+GGVK ASHLLKYDS LG F+AD+K V + ISVD Sbjct: 93 RIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKADIKIVDNETISVD 152 Query: 128 GKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DI 186 GK I+VVSNR+P+ LPW ++GID+VIEGTGVFVD GAGKHIQAGAKKV+ITAP KG DI Sbjct: 153 GKPIKVVSNRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADI 212 Query: 187 PTYVVGVNADAYKPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGNMTTTHSYTGDQRL 245 PTYVVGVN Y I+SNASCTTNCLAPFVKVLD++FGI+KG MTTTHSYTGDQRL Sbjct: 213 PTYVVGVNEKDYGHSVADIVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRL 272 Query: 246 LDASHXXXXXXXXXXXNIVPTST 268 LDASH NIVPTST Sbjct: 273 LDASHRDLRRARAAALNIVPTST 295 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33726 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1874 418 e-119 >Contig1874 Length = 302 Score = 418 bits (1075), Expect = e-119, Method: Compositional matrix adjust. Identities = 207/253 (81%), Positives = 219/253 (86%), Gaps = 4/253 (1%) Query: 1 MATGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWE 60 MAT TA PRQLS KEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWE Sbjct: 1 MATTTAAPPRQLSDKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWE 60 Query: 61 KLQMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSF 120 KLQ+AARVIVAIENP DIIVQSARPYGQRAVLKFA++T +AIAGRHTPGTFTNQ+QTSF Sbjct: 61 KLQLAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGVNAIAGRHTPGTFTNQLQTSF 120 Query: 121 NEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFW 180 NEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFW Sbjct: 121 NEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFW 180 Query: 181 LLARMVLQMRGTIRPGHKWDVMVDLFFYRXXXXXXXXXXXXXXXI-DYATAEYSMNLTSG 239 LLARMVLQMRG++RPGHKWDVMVDLFFYR +Y EYS L G Sbjct: 181 LLARMVLQMRGSLRPGHKWDVMVDLFFYREPEEAKEQEEEEAVQAPEY--LEYSGGL-GG 237 Query: 240 EQWPSQIADGGWA 252 +QWP+Q A+ W+ Sbjct: 238 DQWPTQGAEASWS 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104903 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3937 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48558 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60186 (54 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88787 (354 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4178 510 e-147 >Contig4178 Length = 303 Score = 510 bits (1313), Expect = e-147, Method: Compositional matrix adjust. Identities = 247/302 (81%), Positives = 269/302 (89%), Gaps = 1/302 (0%) Query: 1 MASEDVKTSESAVSKIVNLAEEAKLAGEGV-KAPSYAVLSICKSLVAGGVAGAVSRTAVA 59 MASEDVK SE AVS IVNLAEEAKLA EGV KAPS AVLS+CKSLVAGGVAG VSRTAVA Sbjct: 1 MASEDVKRSERAVSTIVNLAEEAKLAREGVVKAPSLAVLSVCKSLVAGGVAGGVSRTAVA 60 Query: 60 PLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSY 119 PLER+KILLQVQNPH+IKY+GT+QGLKYIWRTEGFRGLF GNGTNCARIVPNSAVKFFSY Sbjct: 61 PLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGFRGLFIGNGTNCARIVPNSAVKFFSY 120 Query: 120 EQASKGILYLYQHHTGNEDAELTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEKSP 179 EQASKGIL++Y+ TGNEDA+LTPLLRLGAGACAGIIAMSATYPMDMVRGR+TVQTE SP Sbjct: 121 EQASKGILWMYREKTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQTEASP 180 Query: 180 YRYRGIFHALSTVLREEGPRALYRGWFPSVIGVVPYVGLNFAVYESLKVWLIKTKPLGLA 239 Y+YRG+FHALSTVLREEGPRALY+GW PSVIGVVPYVGLNFAVYESLK WLIK++P GL Sbjct: 181 YQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSRPFGLV 240 Query: 240 EDSELSVTTRLXXXXXXXXXXXXXXYPLDVIRRRMQMVGWKEASSVVIGDGRNRAPLEYN 299 +D++LSVTTRL YPLDVIRRRMQMVGW A+SVV G+GR++APLEY Sbjct: 241 QDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSHAASVVAGEGRSKAPLEYT 300 Query: 300 GM 301 GM Sbjct: 301 GM 302 Score = 87.0 bits (214), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 63/203 (31%), Positives = 95/203 (46%), Gaps = 19/203 (9%) Query: 147 LGAGACAGIIAMSATYPMDMVRGRLTVQTEKSPYRYRGIFHALSTVLREEGPRALYRGWF 206 L AG AG ++ +A P++ ++ L VQ + +Y G L + R EG R L+ G Sbjct: 45 LVAGGVAGGVSRTAVAPLERMKILLQVQNPHN-IKYSGTVQGLKYIWRTEGFRGLFIGNG 103 Query: 207 PSVIGVVPYVGLNFAVYESLK---VWLIKTKPLGLAEDSELSVTTRLXXXXXXXXXXXXX 263 + +VP + F YE +W+ + K ED++L+ RL Sbjct: 104 TNCARIVPNSAVKFFSYEQASKGILWMYREKTGN--EDAQLTPLLRLGAGACAGIIAMSA 161 Query: 264 XYPLDVIRRRMQMVGWKEASSVVIGDGRNRAPLEYNGMIDAFRKTVRHEGFGALYKGLVP 323 YP+D++R R+ + EAS P +Y GM A +R EG ALYKG +P Sbjct: 162 TYPMDMVRGRITVQ--TEAS-----------PYQYRGMFHALSTVLREEGPRALYKGWLP 208 Query: 324 NSVKVVPSISLAFVTYEVVKDIL 346 + + VVP + L F YE +KD L Sbjct: 209 SVIGVVPYVGLNFAVYESLKDWL 231 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79931 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50927 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19327 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56792 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** Database: strawberry.as.orf Posted date: Mar 27, 2017 5:37 AM Number of letters in database: 104,044 Number of sequences in database: 444 Lambda K H 0.318 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 444 Number of Hits to DB: 43,832,576 Number of extensions: 1818052 Number of successful extensions: 5601 Number of sequences better than 1.0e-10: 296 Number of HSP's gapped: 5205 Number of HSP's successfully gapped: 358 Length of database: 104,044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 6.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.7 bits) S2: 130 (54.7 bits)