BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33129 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3176 166 3e-43 >Contig3176 Length = 234 Score = 166 bits (420), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 92/210 (43%), Positives = 128/210 (60%), Gaps = 6/210 (2%) Query: 4 EVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGKP 63 +VK+L SPF +RA L LK V ++F+ E +KS LLLQSNPV+KKVPVLIH KP Sbjct: 5 DVKVLGMAPSPFVMRARIALNLKSVDYEFLQETFGSKSELLLQSNPVHKKVPVLIHGDKP 64 Query: 64 ISESLVILEYVDETWKQNP-LLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKE-QE 121 + ESL+I+EY+DE W P +LP DPY+RA ARFWA + +K S+ + QG+E ++ Sbjct: 65 VCESLIIVEYIDEVWASGPSILPSDPYDRATARFWAAYISEKWYPSMKGIGLAQGEEAKK 124 Query: 122 EAIGLAIETLKFLEEEL----KGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEK 177 AI E L LEE KG FFGG++IG D+A G + V E++ G+KL+++ Sbjct: 125 AAIEQVTEGLALLEEAFEKSSKGNVFFGGDEIGYLDIAFGCFLGWLRVNEKLHGIKLLDQ 184 Query: 178 ERVPLLAAWMQEVAEAPVIKESWPPHEKLV 207 + P L W + +K+ P +KLV Sbjct: 185 TKTPGLVKWADKFCAHAAVKDVMPETDKLV 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65357 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6452 384 e-108 >Contig6452 Length = 283 Score = 384 bits (986), Expect = e-108, Method: Compositional matrix adjust. Identities = 192/282 (68%), Positives = 222/282 (78%), Gaps = 13/282 (4%) Query: 1 MASLVAALGLPSKLK--ASPYEQQNALFVSRRRSKKKNQSFAPVARLFGPAIFEASKLKV 58 M +L AA LP K S + +LF R KK+N++ PVARLFGPAIFEASKLKV Sbjct: 1 MGALTAASVLPWDFKPSVSLSRHRGSLFHYTRTPKKRNRAIVPVARLFGPAIFEASKLKV 60 Query: 59 LFLGVDEEKHPGKLPRTYTLTHSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKK 118 LFLGVDE+KHPGKLPRTYTLTHSDITSKLTLAISQTI+NSQLQGWY++LQRDEVVA+WKK Sbjct: 61 LFLGVDEKKHPGKLPRTYTLTHSDITSKLTLAISQTIDNSQLQGWYSKLQRDEVVAQWKK 120 Query: 119 VKGKMSLHVHCHISGGHFLLDICARLRFFIFSKELPVVLKAFVHGDGNLLNNHPELQEAL 178 VK KMSLHVHCHISGGHFLLD+ ARLR+FIF KELPVVLKAFVHGDGNL N++PELQ+A+ Sbjct: 121 VKDKMSLHVHCHISGGHFLLDLFARLRYFIFCKELPVVLKAFVHGDGNLFNSYPELQDAM 180 Query: 179 VWVYFHSNIPEFNKVECWGPLKEAVAGSSEAGGTRH--------EIRQETSISNWELPEP 230 VW+YFHS+IPEFNKVECWGPL +A A SS + G H E + TS SNW+LPE Sbjct: 181 VWIYFHSSIPEFNKVECWGPLVDAAAPSSGSSGGAHHQENNSGGEGEEATSPSNWDLPET 240 Query: 231 CQETCNCCFPPMSLIPWSEKLPLQTENR-GTQGQESLQQQTR 271 CQE CNCCFP ++ I WS++LP + R GT +S Q QT+ Sbjct: 241 CQEECNCCFPQLTSIAWSQELPRANQTRVGT--HQSFQGQTQ 280 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4294 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2984 143 3e-36 >Contig2984 Length = 86 Score = 143 bits (360), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 66/85 (77%), Positives = 74/85 (87%) Query: 151 MFSLKLSEGRHPFSLSNILSVMNVAGKLKSRHEFPPENFVEVMKLMEHRYGAKDFVTSKD 210 MFSL+L+ G+ PFSL NI +VMNV KLK+RHEFPPE FVEVMK+MEHRYG KDFVT++D Sbjct: 1 MFSLRLNAGQQPFSLENIAAVMNVGEKLKARHEFPPEKFVEVMKIMEHRYGGKDFVTNQD 60 Query: 211 SSLLAPGTYYLTEVDSMYRRFYAKK 235 SLL PGTYYLTEVDS YRRFYAKK Sbjct: 61 ISLLLPGTYYLTEVDSKYRRFYAKK 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61991 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88194 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28491 121 1e-29 >Contig28491 Length = 278 Score = 121 bits (303), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 55/81 (67%), Positives = 70/81 (86%) Query: 2 ASEKRLLTVDQGQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQL 61 + +KR L+ +Q + LE+SFEVENKLEPERK++LA++LGLQPRQVAIWFQNRRARWKTKQL Sbjct: 53 SGKKRRLSSEQVKALERSFEVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQL 112 Query: 62 EKDYDVLQNSYNSLKADYDNL 82 E+DY L+ Y+ LK +YD+L Sbjct: 113 ERDYSALKADYDGLKHNYDSL 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11970 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16217 239 2e-65 >Contig16217 Length = 330 Score = 239 bits (610), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 1/141 (0%) Query: 12 FRFPPADTNLVLREFEKCGVILKHVPGPRDANWMHILYQNRSDAQKALSKNGMQINGVLI 71 + F PADTNLVL EFEKCGVILKHVPGPRDANWMHILYQ+ SDAQKALSKNGMQING LI Sbjct: 190 YGFSPADTNLVLPEFEKCGVILKHVPGPRDANWMHILYQSYSDAQKALSKNGMQINGALI 249 Query: 72 VGVKPLDPMQRQALNERINSQGFMTLPP-PSSRTSELNSFRASSRPYYLQNGNTSTGQSG 130 +GVKPLDPMQR ALNER+N+QGFMT PP PS + +E+N+ RA PYYLQNGNTST +SG Sbjct: 250 IGVKPLDPMQRHALNERVNNQGFMTFPPQPSMKHAEVNASRAPPHPYYLQNGNTSTQKSG 309 Query: 131 GAIASPAKSMVSKIMDLMFGI 151 GAIASPAKS+VSK+MDLMFG+ Sbjct: 310 GAIASPAKSLVSKVMDLMFGM 330 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs173106186 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82708 (301 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3769 148 9e-38 >Contig3769 Length = 178 Score = 148 bits (374), Expect = 9e-38, Method: Compositional matrix adjust. Identities = 84/160 (52%), Positives = 95/160 (59%), Gaps = 24/160 (15%) Query: 3 GTGDSSAVNGGGGEIMLFGVRVVV-DSMRKSVSLNNLSQYEQPQDNSSHCXXXXXXXXXX 61 G G A NG IMLFGVRV ++ RKSVS+NNLSQYE+PQ ++ Sbjct: 25 GCGGPIAENG----IMLFGVRVTEGNAFRKSVSMNNLSQYERPQQADTN----------- 69 Query: 62 XKXXXXXXXXXXXXXXVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRN 121 VH + R RER+RGV WTEEEHKLFL+GLQ VG+GDWRGISRN Sbjct: 70 ------AEAGYASDEVVHASGHR--RERRRGVAWTEEEHKLFLVGLQMVGRGDWRGISRN 121 Query: 122 FVKTRTPTQVASHAQKYFXXXXXXXXXXXXXXXFDITTDS 161 FVKTRTPTQVASHAQKYF FDITTD+ Sbjct: 122 FVKTRTPTQVASHAQKYFLRRNNHNRRRRRSSLFDITTDT 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22106186 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57061 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36548 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82726 (394 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44440 (347 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96195 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7482 95 5e-22 >Contig7482 Length = 223 Score = 95.1 bits (235), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 56/160 (35%), Positives = 92/160 (57%), Gaps = 29/160 (18%) Query: 8 DLQRIFKQLDKNGDDQVSLEELNWLLERIGVRLSLEELESFV------GKSSLDLNEFLF 61 +L+R+F+ D+NGD +++ +ELN LE +G+ + +EL + + G +D++EF Sbjct: 78 ELKRVFQMFDRNGDGRITKQELNDSLENLGIYIPDKELFNMIEKIDVNGDGCVDIDEFGE 137 Query: 62 FWKSISKQNNNKVDDHEVKXXXXXXXXXXXXXXXXSDLLEAFNVFDLNGDGFISCEELQN 121 ++SI + + + D+ EAFNVFD NGDGFI+ +EL++ Sbjct: 138 LYQSIMDERDEE-----------------------EDMKEAFNVFDQNGDGFITVDELRS 174 Query: 122 VLSRLGLWDEKSGKDCTRMICMYDTNLDGVLDFEEFKNMM 161 VLS LGL ++ +DC RMI D + DG ++F+EF+ MM Sbjct: 175 VLSSLGLKQGRTIEDCKRMIMKVDVDGDGRVNFKEFRQMM 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35963 (102 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53026 (441 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81965 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16106183 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15697 281 4e-78 >Contig15697 Length = 165 Score = 281 bits (719), Expect = 4e-78, Method: Compositional matrix adjust. Identities = 134/165 (81%), Positives = 150/165 (90%) Query: 1 MIMDTLGALALATEPPNGDLMKRSPVGRKGNFISNVMWRNILGQSLYQFLIIWYLQTRGK 60 MIMDTLGALALATEPP DLMKR+PVGRKGNFI+NVMWRNILGQSLYQF+IIW+LQTRGK Sbjct: 1 MIMDTLGALALATEPPTDDLMKRAPVGRKGNFITNVMWRNILGQSLYQFVIIWFLQTRGK 60 Query: 61 AVFRLDGPDPDLILNTLIFNTFVFCQVFNEISSREMEKINVFKGILKNYVFVAVLTCTVL 120 F+L GPD DLILNTLIFN+FVFCQVFNEISSREMEK+NVFKGI++NYVFV VL+ TV+ Sbjct: 61 EAFQLVGPDSDLILNTLIFNSFVFCQVFNEISSREMEKVNVFKGIMQNYVFVTVLSATVI 120 Query: 121 FQIIIIELLGTFANTTPLNLQQWFVSILLGFLGMPIAAVLKLIQV 165 FQIIIIE LGTFANT PL+ +QWF S+ LGFLGMP++AVLK I V Sbjct: 121 FQIIIIEFLGTFANTHPLSWKQWFASVALGFLGMPVSAVLKFIPV 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86545 (400 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48275353 183 5e-48 >48275353 Length = 116 Score = 183 bits (464), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 84/116 (72%), Positives = 95/116 (81%) Query: 1 MSWWWAGAIGAARKKFEEDEPARSYQSXXXXXXXXXXXXNSLAEILPLPDTPGGPWKVYG 60 MSWWWAGA+GAA+KKF+E+EP RS QS NSLAEILPL DTPGGPWKVYG Sbjct: 1 MSWWWAGAVGAAKKKFDEEEPPRSPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYG 60 Query: 61 VARRPKPNWNADHLVEYVQCDVSDPEETQAMLSQLIDVTHIFYVTWTNRSTEAENC 116 VARRP+PNWNADH VEY+QCD+SDP++ + LS L DVTHIFYVTWTNRST+AENC Sbjct: 61 VARRPRPNWNADHPVEYIQCDISDPDDAKTKLSPLTDVTHIFYVTWTNRSTDAENC 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs204106188 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92759 (293 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105992 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4317 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29024 369 e-104 >Contig29024 Length = 282 Score = 369 bits (947), Expect = e-104, Method: Compositional matrix adjust. Identities = 170/253 (67%), Positives = 206/253 (81%), Gaps = 1/253 (0%) Query: 27 ATPSVSSTLGSSFKGALLPRSSPKQKKTVRITEKXXXXXXXXX-NPYEEIEEYTRPSWAM 85 A+P VS+TL SSF+G+ L R +KK V+ K P EE +E++ PSWAM Sbjct: 28 ASPPVSNTLASSFRGSSLARCPSIRKKVVKGNAKVSAAATTFAPTPVEEPKEFSLPSWAM 87 Query: 86 FELGKAPVYWKTMNGLPPMSGEKLKIFYNPYAKKLLPNEDFGIGFNGGFNQPFMCGGEPR 145 FELG+APVYWKTMNGLPP +GEKL+IFYNP A K++PNE++GI FNGGFNQP MCG EPR Sbjct: 88 FELGRAPVYWKTMNGLPPTAGEKLRIFYNPAANKIVPNEEYGIAFNGGFNQPIMCGAEPR 147 Query: 146 AMLRKNRGQNDSPFYTIQICVPKHAINLIFSFTNGVEWDGPYRIKFLVPRAWRNKPMDFF 205 AML +RG+ DSP Y+IQIC+P+HA+NLIFSFTNGV+WDGPYR++F VP +NKP++FF Sbjct: 148 AMLSISRGKADSPMYSIQICIPRHALNLIFSFTNGVDWDGPYRLQFQVPNGLKNKPIEFF 207 Query: 206 NKGLADQLSKDGACEKAIFPDTDVVVDRCVLIGNLAAEGGDRCDLNLVPGCMDPSSPLYD 265 N+GLA++LSKDGACE+AIFPDT VVV RC +IGNL EGGDRC+LNLVPGC DPSSP YD Sbjct: 208 NEGLAEELSKDGACERAIFPDTFVVVTRCNIIGNLTVEGGDRCNLNLVPGCTDPSSPSYD 267 Query: 266 PLANVDDGSCPLD 278 PLANVDDGSCP++ Sbjct: 268 PLANVDDGSCPIE 280 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26435 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4779 98 2e-22 >Contig4779 Length = 606 Score = 97.8 bits (242), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 73/258 (28%), Positives = 128/258 (49%), Gaps = 24/258 (9%) Query: 16 VDIIPDDP-KSAECIKQLEQEIKVLGHLK-HENIVQYYGSEVVDDHLYIYLEYVHPGSIN 73 V +IP +A I+ + +E+K+L L H+N+V++Y + +++YI +E G + Sbjct: 183 VKVIPKAKMTTAIAIEDVRREVKILRALSGHDNLVKFYDAYEDQENVYIVMELCEGGELL 242 Query: 74 RYVREHCRDITESIVRNFTRHILNGLAYLHSTNTIHRDIKGANLLV---DASGVVKLADF 130 + TE R ILN +A+ H +HRD+K N L D +K DF Sbjct: 243 DRILARGGKYTEDDARTVMTQILNVVAFCHLQGVVHRDLKPENFLFTSKDEDSQLKAIDF 302 Query: 131 GMAKHLTGLSYELSLKGSPNWMAPEVIKAVMQKDGNPKLALAVDIWSLGCTVIEMLTG-K 189 G++ + + GS ++APEV+ + A D+WS+G +L G + Sbjct: 303 GLSDFVKPDERLNDIVGSAYYVAPEVL--------HRSYATEADVWSVGVIAYILLCGSR 354 Query: 190 PPWSEFEGPQAMFKVLNRT------PPIPEMLSSEGKDFLLRCFLRNPVERPSAVELLEH 243 P W+ E +F+V+ + PP P LS+E +DF+ R ++P +R +A + L H Sbjct: 355 PFWARTE--SGIFRVVLKADPSFDEPPWPS-LSTEARDFVKRLLNKDPRKRMTAAQALCH 411 Query: 244 PFIRNA-IIKICPSLCVF 260 P+++N+ IK+ + +F Sbjct: 412 PWLKNSNDIKVPLDILIF 429 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60385 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75192 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48264387 71 2e-14 >48264387 Length = 126 Score = 71.2 bits (173), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 42/124 (33%), Positives = 69/124 (55%), Gaps = 11/124 (8%) Query: 11 SGWEELRKEARKIEGDLDVKLSSYAKLGARFTQGGYVDTGSPTVGSGRSWKSMEMEIQSL 70 S W+ LRK+ARK+E LD +++SY K + GS VG+ + +E I L Sbjct: 5 SSWDALRKQARKLEAQLDEQMNSYRKFVSA--------KGSTKVGTAEN--DLESGIDRL 54 Query: 71 LEKLLDINDAMSRCAASAAPTTSVTQKLARHRDILHEFTQEFRRIKGNINSMREHAELLS 130 L++L +N M + S+ + V+ L RH++I + TQEF R++ ++ + +EHA LL Sbjct: 55 LKQLQQVNSQM-QAWVSSGGSEMVSHTLTRHQEIFQDITQEFYRLRNSLRAKQEHASLLE 113 Query: 131 SVRD 134 R+ Sbjct: 114 DFRE 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs171106184 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11077 71 1e-14 >Contig11077 Length = 317 Score = 71.2 bits (173), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 37/81 (45%), Positives = 54/81 (66%), Gaps = 13/81 (16%) Query: 1 MAFQLYESGIFTG-RCGTS---LDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRME 56 +F+ Y+SG++T CG+S ++H V AVGYG E+G +W++KNSWG SWG+ GY +ME Sbjct: 240 QSFRFYKSGVYTSDTCGSSSMDVNHAVLAVGYGVEDGVPFWLIKNSWGQSWGDNGYFKME 299 Query: 57 --RNVAGTLTGKCGIAMEASY 75 +N+ CG+A ASY Sbjct: 300 YGKNM-------CGVATCASY 313 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59000 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38703 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15446 100 7e-24 >Contig15446 Length = 245 Score = 100 bits (248), Expect = 7e-24, Method: Compositional matrix adjust. Identities = 46/77 (59%), Positives = 59/77 (76%) Query: 4 ADVDGDGSLNYGEFVAVSVHLKKMANDEHLHKAFSFFDRNQSGFIETEELQNALNDEVDT 63 ADVDG+G L+YGEF AV++HL+K+ NDEHLHKAF FFD++ SG+IE EL+ L DE Sbjct: 112 ADVDGNGVLDYGEFAAVTIHLQKLENDEHLHKAFVFFDKDGSGYIELGELREGLRDESGE 171 Query: 64 SSENVINAIMHDVDTDK 80 + V+N IM +VDTDK Sbjct: 172 TDIEVLNDIMREVDTDK 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7708 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14063 90 3e-20 >Contig14063 Length = 580 Score = 90.1 bits (222), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 59/210 (28%), Positives = 103/210 (49%), Gaps = 32/210 (15%) Query: 28 GGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIK 87 G P SGKGTQC IV FG H+S GDLLRAE+ SG+E G + + G++VP EV Sbjct: 81 GAPASGKGTQCELIVNKFGLVHISTGDLLRAEVSSGTEIGNKAKEFMNAGRLVPDEVVTA 140 Query: 88 LLQKAM--EESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNR- 144 ++ + +++ +L+DG+PR+ + + + KI P+ + D +E + R + R Sbjct: 141 MVTARLSRDDAKEKGWLLDGYPRSFNQAQSLQKL-KIIPDVYIVLDVPDETLIDRCVGRR 199 Query: 145 -----------------NQ-------GREDDNVETIRKRFKVFLESSLPVVQYYEAKGKV 180 NQ R DD E ++ R +++ +++ + Y + Sbjct: 200 LDPVTGKIYHIKSFPPENQEIKARLITRPDDTEEKVKSRLEIYKKNADSISAAYS--NIM 257 Query: 181 RKIDAAKPVAEVFDAVKAVFT--PKDEKVK 208 +KID VF+ + ++ + KD+++K Sbjct: 258 KKIDGNHSKDVVFEVIDSILSQVQKDKEMK 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22280 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64592 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6614 295 3e-82 >Contig6614 Length = 248 Score = 295 bits (756), Expect = 3e-82, Method: Compositional matrix adjust. Identities = 141/173 (81%), Positives = 159/173 (91%) Query: 28 IKTELLQVVQGINRGIFGVPSAKKSEIEALVELLESQNPTPHPTANLDKVGGTWKLVYST 87 IKT+LL+ ++GINRGIFGVPSAKKS+IEALV LES+NPTP P NL KVGG WKLVYST Sbjct: 75 IKTQLLEAIKGINRGIFGVPSAKKSQIEALVNQLESRNPTPDPLLNLQKVGGCWKLVYST 134 Query: 88 ITILGSKRTKLGLRDFITLGDFFQSIDVAKGKAVNVIKFNVRGLNLLNGQLTIEASFKIA 147 ITILGSKRTKLGLRDFI+LGDFFQ+I++AKGKAVNVIKF+VRGLNL NG+LTIEASFK A Sbjct: 135 ITILGSKRTKLGLRDFISLGDFFQNINIAKGKAVNVIKFDVRGLNLFNGRLTIEASFKKA 194 Query: 148 SKSRVDIAYDNSTITPEQLMNMFRKNYDLLLGIFNPDGWLEISYVDDTMRIGR 200 S SRVDI YDNS ITP QLM++FRKNYD+LLGIFNP+GWLEI+YVDDT+RIGR Sbjct: 195 SNSRVDINYDNSMITPSQLMSVFRKNYDILLGIFNPEGWLEITYVDDTLRIGR 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30017 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226761629 118 2e-29 >226761629 Length = 101 Score = 118 bits (295), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 55/68 (80%), Positives = 61/68 (89%) Query: 22 EVIDTSGGCGAKFEIEIVSEQFEGKRLLARHRLVNAALEEEMKQIHALSIKKAMTPEQWK 81 EVIDTSGGCGA F IEIVS QFEGK+LL RHRL+N+ LEEEMK+IHALSIKKA+TPEQWK Sbjct: 30 EVIDTSGGCGASFAIEIVSVQFEGKKLLERHRLINSCLEEEMKEIHALSIKKALTPEQWK 89 Query: 82 QQQESNAA 89 QQQES + Sbjct: 90 QQQESQVS 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27272 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54852 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78136 (347 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32071 233 3e-63 >Contig32071 Length = 299 Score = 233 bits (595), Expect = 3e-63, Method: Compositional matrix adjust. Identities = 112/163 (68%), Positives = 125/163 (76%), Gaps = 7/163 (4%) Query: 12 LNLPPGFRFYPTDEELLVQYLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWY 71 L LPPGFRF+PTDEEL+ YLCRK A Q ++ II EIDLYKFDPW LP A++GEKEWY Sbjct: 14 LELPPGFRFHPTDEELVNHYLCRKCASQPLAVPIIREIDLYKFDPWQLPEMALYGEKEWY 73 Query: 72 FFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTN 131 FFSPRDRKYPNGSRPNR AG+GYWKATG DK I + + +GIKKALVFY GKAPKG KTN Sbjct: 74 FFSPRDRKYPNGSRPNRAAGTGYWKATGADKHI-GKPKALGIKKALVFYAGKAPKGIKTN 132 Query: 132 WIMHEYRLFEPSR------KNGSSKLDDWVLCRIYKKHSGSQK 168 WIMHEYRL R KN + +LDDWVLCRIY K +K Sbjct: 133 WIMHEYRLANVDRSAAAAKKNQNLRLDDWVLCRIYNKKGSIEK 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54271 (51 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36395 (380 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10658 151 2e-38 >Contig10658 Length = 189 Score = 151 bits (382), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 71/103 (68%), Positives = 86/103 (83%) Query: 25 KFNVGGKHGWVTNPGENYNKWSGRNRFLVNDTLFFKYKKGSDSVLLVNKDDYDSCNTKKP 84 KF VGGK GWV NP ++Y+ W+ +NRF +NDTL FKYKKGSDSVL+VNKDDY SCNT+ P Sbjct: 27 KFYVGGKDGWVVNPSQSYSLWAEKNRFNINDTLHFKYKKGSDSVLVVNKDDYFSCNTQNP 86 Query: 85 LLKLDSGDSEFKLDRSGPFYFISGNHDHCQKGQKLIVVVLHER 127 + KLD GDS+F +DRSGPFYFISG + +CQKGQKL+V+VL R Sbjct: 87 IQKLDGGDSDFTVDRSGPFYFISGQNGNCQKGQKLLVIVLAPR 129 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100466 (345 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74272 (299 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32239 194 1e-51 >Contig32239 Length = 289 Score = 194 bits (494), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 96/143 (67%), Positives = 114/143 (79%), Gaps = 2/143 (1%) Query: 105 EREPNGDELEMERACSRGISD-DEDGDTSRKKLRLSKDQSAILEESFKEHNTLNPXXXXX 163 ER+ + +E+E++ S +SD DEDG +RKKLRL+K+QSA+LEESFK+H+TLNP Sbjct: 115 ERDISSEEVEVDEKVSSRVSDEDEDGSNARKKLRLTKEQSALLEESFKQHSTLNPKQKQA 174 Query: 164 XXXXXGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELRALK 223 LRPRQVEVWFQNRRARTKLKQTEVDCEFLK+CCE LT+ENRRLQKE+QEL+ALK Sbjct: 175 LARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELKALK 234 Query: 224 LSPQFYMQMTPPTTLTMCPSCER 246 L+ YM M P TLTMCPSCER Sbjct: 235 LNQPLYMHM-PTATLTMCPSCER 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36641 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12321 214 2e-57 >Contig12321 Length = 226 Score = 214 bits (544), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 116/211 (54%), Positives = 145/211 (68%), Gaps = 7/211 (3%) Query: 9 AETAKRYAVVTGANKGIGYEVVRQLALNGIITVLTARDEKGGLEAVEKLKHSGF-DNVIF 67 A+T +RYAVVTGANKGIG+ V+QLA NGI+ VLTARDEK GLEA+EKLK G D V+F Sbjct: 2 ADTVRRYAVVTGANKGIGFGTVKQLASNGIVVVLTARDEKRGLEALEKLKDFGISDLVVF 61 Query: 68 HQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITG-ISSDADTLSG-----FIEEGVAR 121 HQLDV D + +ADF+++ FGKLDILVNNA + G I + D S E + Sbjct: 62 HQLDVTDSVSAARLADFVKTQFGKLDILVNNAAVVGSIVTPEDFKSASSGKRLEEINWSE 121 Query: 122 GKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMYVTHEWAKG 181 E AE+CL+TNY G K + EAL+PLLQLSDS RIVNVSS +GKLM + WAK Sbjct: 122 IPTIPNDEVAEQCLKTNYYGTKSVTEALLPLLQLSDSPRIVNVSSGVGKLMNFPNGWAKE 181 Query: 182 VFSDAENLTEERVDEVLSQYLNDYKEGSPET 212 V SDAE LTEE++D VL ++ K+ +P++ Sbjct: 182 VLSDAERLTEEKIDSVLIRFWKTSKKETPKS 212 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60159 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16690 98 2e-22 >Contig16690 Length = 243 Score = 97.8 bits (242), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 63/179 (35%), Positives = 85/179 (47%), Gaps = 23/179 (12%) Query: 46 WAISLLLNNRHALKRAHEELDQQVGKERAVDESDTQNLVYLQAIIKETLRLYPAGPLLAP 105 WA+ L N +K+A EE+D +G++ ES + L Y + I E+LRL+P PLL Sbjct: 32 WAVFFLAQNPSKMKKAQEEIDSVLGQDGPTYES-IKKLEYTRLIAVESLRLFPQPPLLIR 90 Query: 106 REAMEDCTVSGYH-------VPAGTRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAH- 157 R D GY+ VPAGT L I+ + + R P W+NP+ F+PERFL +H Sbjct: 91 RSLKPDKLPGGYNGAKDGYAVPAGTDLFISVYNLHRSPYFWDNPNEFEPERFLVEKKSHV 150 Query: 158 ---ADVDVRGQ-----------QFELIPFGSGRRSCPGASSALQVLHLTLARLLHAFEL 202 A D F +PFG G R C G AL + LA LL F + Sbjct: 151 EGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFTV 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66686 (338 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8647 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5247 394 e-111 >Contig5247 Length = 235 Score = 394 bits (1011), Expect = e-111, Method: Compositional matrix adjust. Identities = 190/234 (81%), Positives = 207/234 (88%) Query: 1 MSTLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQPGTAQNVDKSTSLARKVF 60 MSTLDATRAELAL VLYLNKAEARDKICRAIQYGSKFLS+G+PGTAQNVDKSTSLARKVF Sbjct: 1 MSTLDATRAELALAVLYLNKAEARDKICRAIQYGSKFLSNGEPGTAQNVDKSTSLARKVF 60 Query: 61 RLFKFVNDLHALISPVPQGTPLPLVLLGKSKNALLSTFLFLDQVVWLGRSGIYKNKERAE 120 RLFKF+NDLH LISP GTPLPLVLLGKSKNALLSTFLFLDQ+VWL R+GIYKNKERA+ Sbjct: 61 RLFKFINDLHGLISPTAPGTPLPLVLLGKSKNALLSTFLFLDQIVWLSRTGIYKNKERAD 120 Query: 121 LLGRISLFCWMGSSVCSTLVELGELGRLSTSMXXXXXXXXXXXXXXNEQYQAKLKKSNER 180 L+GRISLFCWMGSS+C+TLVE+GE+GR+S + NEQY+AKLKKSNER Sbjct: 121 LIGRISLFCWMGSSICTTLVEIGEIGRISGQLKKLEKDLKNSEKYHNEQYRAKLKKSNER 180 Query: 181 SLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPAPVKAKA 234 SLALVK+A+D VVAVGLLQLAPKKVT RVTGA GF TSLISCYQLLPAP K+KA Sbjct: 181 SLALVKAALDTVVAVGLLQLAPKKVTSRVTGALGFTTSLISCYQLLPAPAKSKA 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16055 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27028 (238 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11272 428 e-122 >Contig11272 Length = 412 Score = 428 bits (1100), Expect = e-122, Method: Compositional matrix adjust. Identities = 197/238 (82%), Positives = 218/238 (91%) Query: 1 MNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVNPHTHQLKICDFGSAKML 60 +NQ +P++YV+LYTYQI RAL+Y+H +GVCHRDIKPQNLLVNPHTHQ+K+CDFGSAK+L Sbjct: 167 LNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVL 226 Query: 61 VPGEPNISYICSRYYRAPELIFGATEYTTAIDMWSIGCVLAELLLGQPLFPGESGVDQLV 120 V GEPNISYICSRYYRAPELIFGATEYT+AID+WS+GCVLAELLLGQPLFPGESGVDQLV Sbjct: 227 VKGEPNISYICSRYYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQPLFPGESGVDQLV 286 Query: 121 EIIKILGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEALDLVSRLLQYSPSL 180 EIIK+LGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEA+DLVSRLLQYSP+L Sbjct: 287 EIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNL 346 Query: 181 RCTALEACAHPFFDDLRDPNTCLPNGRPLPTLFNFTAQELAGASNELRQRLIPEHARK 238 RCTAL+A H FFDDLRDPNT LPNGR LP LFNF + EL G E +L+PEHARK Sbjct: 347 RCTALDALVHSFFDDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAETLMKLVPEHARK 404 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103613 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64862 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19252 65 1e-12 >Contig19252 Length = 125 Score = 65.1 bits (157), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 33/65 (50%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Query: 186 VHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFIPLALPALIT-CGKTPP 244 V++ +G+P + CC +L+GL +LEAAICLCT I+ L LN+ +P+AL L++ C KT P Sbjct: 60 VNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALGLNMEVPVALSLLVSACQKTVP 119 Query: 245 PGFVC 249 PGF C Sbjct: 120 PGFKC 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9104 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104818 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25232 100 1e-23 >Contig25232 Length = 273 Score = 100 bits (248), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 57/142 (40%), Positives = 78/142 (54%), Gaps = 4/142 (2%) Query: 2 IWDXXGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVG 61 IWD GQER+ ++ YYRGA IIVYD+T+Q SF K+W+ E+ + N+ L G Sbjct: 136 IWDTAGQERYHSLAPMYYRGAAAAIIVYDLTNQASFERAKKWVLELKSQGNPNMVMALAG 195 Query: 62 NKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTNGEQAFMAMAASIKDRMASQPSMN 121 NK DL + V+ E A+++A E G+ F+ETSAK + N F +A + QP N Sbjct: 196 NKADLVEARKVAAEDAQSYAQENGLFFLETSAKTADNVNDIFYEIAKRLPR---VQPVQN 252 Query: 122 NARPPTVQIKGQPVAQKSGCCS 143 A V + VA S CCS Sbjct: 253 PAGMVLVDRPSERVA-SSSCCS 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96106185 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25519 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6904 89 1e-20 >Contig6904 Length = 421 Score = 89.4 bits (220), Expect = 1e-20, Method: Composition-based stats. Identities = 38/53 (71%), Positives = 42/53 (79%) Query: 1 MTNAPFMLNVDCDMYANNPELVLHAMCLFLGSNDERDWGFVQCPQYFYDRPTD 53 MTNAPFMLNVDCDMYANNP++VLHAMCL LG E++ FVQ PQ FYD D Sbjct: 1 MTNAPFMLNVDCDMYANNPKIVLHAMCLLLGFKHEKEGAFVQFPQMFYDTLED 53 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29709 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99245 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61199 (399 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43896 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14104 59 5e-11 >Contig14104 Length = 283 Score = 58.5 bits (140), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 3/115 (2%) Query: 21 IQNACGSLPSSVFEAERPGCRFSVKQRIATYFYKGVLYGSVGFVCGIIGQGIANLIMTAK 80 I+ GS+P + F+ G +S+ R+A+ F G+ SVGF+ I +N + + Sbjct: 135 IKGLLGSIPDNAFQKNLVGTDWSINYRLASVFLGGLKLASVGFISSIAAVAASNGLFAVR 194 Query: 81 RNIKK---SEYDIPVPPLVKSAALWGVFLAVSSNIRYQIVNGLERIVESSPLAKQ 132 + I S+ + P++K+A ++ FL S+N+RYQI+ G+ S A Q Sbjct: 195 KFINPTLISDQEKKRTPILKTAIIYSSFLGTSANLRYQIIAGVIEHRISDEFASQ 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73216 (81 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95113 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24736 63 5e-12 >Contig24736 Length = 340 Score = 62.8 bits (151), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 58/212 (27%), Positives = 98/212 (46%), Gaps = 26/212 (12%) Query: 39 VKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVY 98 +KLG L+V+ G+G G ++++ + D + A +++G+TF DT+++Y Sbjct: 1 MKLGSQGLEVSAQGLGCM--GMSAFYGAPKPDQDMISLIHHA----INSGVTFLDTSDIY 54 Query: 99 GSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQS--------VLAA 150 G +E LLG+ +K + E+ +F +G+ V AA Sbjct: 55 G------PFTNEILLGKALKGGVRDKVELATKFGLRFVENKMEVGKNMEVQGDPAYVRAA 108 Query: 151 LKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAY 209 L+ SL RLG+ S++LY H E + L VE+G VK +G+S S +R A+ Sbjct: 109 LESSLKRLGVDSIDLYYQHRIDTSVPVEVTVGELKKLVEEGKVKYIGLSEASASTIRRAH 168 Query: 210 EKLKKRGIPLASNQVNYSLIYRKPEREWCEGC 241 P+ + Q+ +SL R E+E C Sbjct: 169 AVH-----PITAVQLEWSLWSRDVEQEIIPTC 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69600 (228 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs159106185 (315 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27951 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7583 407 e-116 >Contig7583 Length = 376 Score = 407 bits (1047), Expect = e-116, Method: Compositional matrix adjust. Identities = 197/253 (77%), Positives = 217/253 (85%), Gaps = 18/253 (7%) Query: 1 FDRHLSPQNVRKVVSEADGYQPHLIAPEQGYRRLIDSALNYFRGPAEASVDAVHFVLKEL 60 FDRHLS QNVRKVVSEADGYQPHLIAPEQGYRRLI+ +L+YFRGPAEASVDAVHFVLKEL Sbjct: 124 FDRHLSLQNVRKVVSEADGYQPHLIAPEQGYRRLIEGSLSYFRGPAEASVDAVHFVLKEL 183 Query: 61 VRRSIGETQELKRFPTLQSEIAAAANKALERFRDDSKKTTMRLVEMESSYLTVDFFRKLP 120 VR+S+ ETQELKRFPTLQ+EIAAA N+ALERFR++SKKTT+RLV+MESSYLTVDFFR+LP Sbjct: 184 VRKSLAETQELKRFPTLQAEIAAACNEALERFRNESKKTTLRLVDMESSYLTVDFFRRLP 243 Query: 121 QDMERGGNPTAPS------------------AADRYTEGHFRRIGSNVSSYVGMVSETLK 162 Q+ME GNP P A DRY+EGHFRRIGSNVSSYVGMVSETL+ Sbjct: 244 QEMENTGNPGNPGKPGSTPAGRPGTTPAPAPAMDRYSEGHFRRIGSNVSSYVGMVSETLR 303 Query: 163 NTIPKAVVHCQVKEAKRSLLDHFYAQLGKKEGKQLAQLLDEDPMLMERRQQCAKRLELYK 222 NTIPKAVVHCQVKEA SLL+HFY Q+GK+E K L+QLLDEDP LMERR QCAKRLELYK Sbjct: 304 NTIPKAVVHCQVKEANTSLLNHFYIQIGKREAKHLSQLLDEDPALMERRHQCAKRLELYK 363 Query: 223 SARDEIDSVSWTR 235 SARDEIDSV+W R Sbjct: 364 SARDEIDSVAWVR 376 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42834 (50 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54723 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101682 (347 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs208106187 (302 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18608 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30681 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6102 165 5e-43 >Contig6102 Length = 212 Score = 165 bits (418), Expect = 5e-43, Method: Compositional matrix adjust. Identities = 83/178 (46%), Positives = 112/178 (62%) Query: 24 LKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVS 83 +KIA AA+GL YLH+ ++ R+ K SNILL E ++ KLS FGLA+LGP+ +HVS Sbjct: 1 MKIAAGAAKGLKYLHDKASPPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVS 60 Query: 84 TAVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRNRPKSEQKLLEWVRP 143 V+GT GY APEY TG+LT KSDI+SFGV L E+ITGR +D R EQ L+EW R Sbjct: 61 KWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWART 120 Query: 144 HLTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKGRPKMSEVVEVLNKIVD 201 D +K + + DP L+G+Y + + AVA C+ Q RP +++VV L + Sbjct: 121 LFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTYLAS 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35401 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4564 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65452 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62644 (272 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10510 62 1e-11 >Contig10510 Length = 330 Score = 62.0 bits (149), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Query: 136 DGHAWRKYGQKEILNTKHPRSYFRCTHKYVQGCRATKQVQRRDDDPQMYDTTYIGHH 192 D ++WRKYGQK I + HPR Y++C+ V+GC A K V+R DD M TY G H Sbjct: 259 DDYSWRKYGQKPIKGSPHPRGYYKCSS--VRGCPARKHVERALDDAAMLVVTYEGEH 313 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80643 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63673 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7976 309 2e-86 >Contig7976 Length = 241 Score = 309 bits (792), Expect = 2e-86, Method: Compositional matrix adjust. Identities = 155/206 (75%), Positives = 179/206 (86%), Gaps = 8/206 (3%) Query: 1 MGGAVGYGNLYSQGYGTNTAALSTALFNNGXSCGSCYEMKCENDPKWCLPGSIIVTATNF 60 MGGA GYGNLYSQGYGTNTAALSTALFNNG +CG+CY+++C NDP+WCLPGSIIVTATNF Sbjct: 42 MGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYQIRCVNDPQWCLPGSIIVTATNF 101 Query: 61 CPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVN 120 CPP GGWC+PP QHFD+++P FL+IAQY+AG+VP+S+RR+ C ++GGIRFTVN Sbjct: 102 CPP--------GGWCDPPQQHFDLSQPVFLRIAQYKAGVVPVSYRRVRCRRRGGIRFTVN 153 Query: 121 GHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTAS 180 GHSYFNLVL+TNVGGAGDV SV+IKGS+T WQAMSRNWGQNWQSNSYLNGQSLSF +T S Sbjct: 154 GHSYFNLVLVTNVGGAGDVQSVAIKGSRTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTS 213 Query: 181 DGRTVTSNNVVPGNWQFGQTFEGGQF 206 DGR + S NV P NW FGQT+ G QF Sbjct: 214 DGRRLVSYNVAPPNWSFGQTYTGRQF 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93621 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57144 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs145106181 (301 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91166 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6613 (344 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22624 299 6e-83 >Contig22624 Length = 280 Score = 299 bits (765), Expect = 6e-83, Method: Compositional matrix adjust. Identities = 146/244 (59%), Positives = 191/244 (78%), Gaps = 5/244 (2%) Query: 65 FRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTP 124 +K + D+GPGV ++EL+KDPQN SRNRGF+F+ YYN+ACA+YSRQKM FKLD N P Sbjct: 1 MKKAVTDIGPGVISVELLKDPQNSSRNRGFAFIEYYNHACAEYSRQKMSTPKFKLDTNAP 60 Query: 125 TISWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSG-- 182 T+SWADPK+T S+AASQVKA+YVKN+P + + +++K+LF+ HG++TKVV+PP K+G Sbjct: 61 TVSWADPKNT--ESSAASQVKAVYVKNLPKDITQDQLKDLFEHHGKITKVVLPPAKAGQE 118 Query: 183 KRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYS-PGLVPTH 241 K FGF+H+AER+ A+KA+K+TEKYEIDGQVLE LAKPQ+D+K+ G+ + L+PT+ Sbjct: 119 KSRFGFVHFAERACAMKALKNTEKYEIDGQVLECSLAKPQSDQKSSGSSNHQKSALLPTY 178 Query: 242 LPHAGYGGFAGTPYGSVGTGFGVAAGFQQPMIYGRGPMPSGMHMVPMVLPDGQIGYVLQQ 301 P GYG G+PYG GF QP+IYGRGP P+GM M+PM+LPDG+IGYVLQQ Sbjct: 179 PPRLGYGMIGGSPYGGGLGAGYSGPGFGQPLIYGRGPTPAGMAMMPMLLPDGRIGYVLQQ 238 Query: 302 PGVQ 305 PGVQ Sbjct: 239 PGVQ 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81812 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30148 144 1e-36 >Contig30148 Length = 305 Score = 144 bits (362), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 65/136 (47%), Positives = 94/136 (69%) Query: 26 GSQYTVESGFYMTTFAAVIFXXXXXXXXXXXXXXXXXXAVMLQSCQNRSSGVVELTKSSG 85 S Y +E+GFYM++FA IF VMLQSC+++S GVVE K S Sbjct: 25 ASSYAMETGFYMSSFATAIFIGALVAVGVLLITLLIALTVMLQSCESKSHGVVETQKPSF 84 Query: 86 DNNYCELFALHAELNSLEADNLPEICRGLAIRYIKEGHFARDLNLFIQIXESYFYTLTPS 145 D N+C++F+LH ELN++EAD P +CR +A++YIKEG +ARDLN + + ++YF ++TP+ Sbjct: 85 DYNHCQIFSLHMELNAVEADRFPSMCRVVALQYIKEGQYARDLNSTVSMIQNYFSSITPT 144 Query: 146 YNGLDVVLMDIDDIFA 161 ++GLDVVL+DIDDI + Sbjct: 145 HDGLDVVLIDIDDILS 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10163 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30148 167 1e-43 >Contig30148 Length = 305 Score = 167 bits (422), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 79/150 (52%), Positives = 108/150 (72%), Gaps = 5/150 (3%) Query: 1 MDIDDIFASSSKYSNLLIDRVNVHGYIECIEEAKHLKHMFTLKLFMKLQVRGWPVILLSR 60 +DIDDI +S N + R + +G + +EEAKHLK MF L+L+M+L GWP+ILLSR Sbjct: 153 IDIDDILSS-----NRRLHRYDQYGGSDFVEEAKHLKQMFILRLYMELHAGGWPLILLSR 207 Query: 61 KHEGQRNATTELLISAGYRGWSSLIMRLDNEMQMDSREYLSRRRAILQKEGFHITGLISN 120 K E +RN++ E LISAGYR WSSLIMR ++E+ M+S +Y S+RR +QKEGF +S+ Sbjct: 208 KPEAERNSSIEDLISAGYRAWSSLIMRSEDELHMESHDYFSKRRDAMQKEGFRAIASVSS 267 Query: 121 QMDALIGQSLGKRVFKIPNPLYYSFDHQIE 150 MDAL G+R+FK+PNP++Y+F HQIE Sbjct: 268 HMDALRSPFSGERIFKLPNPIFYNFSHQIE 297 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46488 (88 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37779 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12748 252 5e-69 >Contig12748 Length = 138 Score = 252 bits (643), Expect = 5e-69, Method: Compositional matrix adjust. Identities = 119/136 (87%), Positives = 125/136 (91%) Query: 115 RLRKHSKTLGSFGAWNRCLNHLLTLAESHIESVILAKFIEAVQNCPDPSSRAALKLVCDL 174 R +HSKTLGSFGAWNRCLNHLLTLAESHIESVILAKF+EAVQ CPDPSSRAALKLVCDL Sbjct: 3 RCCRHSKTLGSFGAWNRCLNHLLTLAESHIESVILAKFVEAVQKCPDPSSRAALKLVCDL 62 Query: 175 YALNRIWNDIGTYRNVDYVAPNKAKAIHKLTEYLSFQVRNIAGELIDAFDLPDYVTRAPI 234 YAL RIW DIGTYRNVDYVAPNKAKAIHKL EYLSFQVRNIA EL+DAFD+PDYVTRAPI Sbjct: 63 YALERIWKDIGTYRNVDYVAPNKAKAIHKLMEYLSFQVRNIAKELVDAFDIPDYVTRAPI 122 Query: 235 ARQSDAYAYYTQIVGF 250 A QS AY++YT VGF Sbjct: 123 AMQSGAYSHYTHYVGF 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25409 (359 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9034 72 2e-14 >Contig9034 Length = 386 Score = 71.6 bits (174), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 28/58 (48%), Positives = 37/58 (63%) Query: 166 YRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTXXXXXXXXXXXXXKLRGEFARLNFPH 223 YRG+RQR WGKW AEIR P+ R+WLGTF+T ++RG+ A++NFP Sbjct: 114 YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11732 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67400 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36796 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68699 (299 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4980 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24434 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2330 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4097 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97786 (72 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100716 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18453 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40125 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8517 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104138 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64315 (311 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70486 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69533 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8381 121 6e-30 >Contig8381 Length = 352 Score = 121 bits (304), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 66/147 (44%), Positives = 95/147 (64%), Gaps = 2/147 (1%) Query: 16 LEPGHFLRPDSSSMLMIPMASAA-TSWT-NNVQTVSLSPASKGPEVANNRSNSTDSTPKA 73 LE G+ +PDSS +L P+ SA +SW+ N++ V++S ++ + Sbjct: 177 LEHGYVYQPDSSFVLGTPVNSATLSSWSCNSMPPVNMSQTKDEGRLSGQTVTHNSCYSSS 236 Query: 74 QVSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVE 133 S + + E D + P RVLPDFAQVY FIGSVFDP+ S+H+++L+++DPI++E Sbjct: 237 NESNPINWKMREKVDGVDPGQPQRVLPDFAQVYKFIGSVFDPSTSNHMERLRQLDPINLE 296 Query: 134 TVLLLMRNLSINLTSPDFEDHRRLLSS 160 T LLLMRNLSINLT P+FEDHR+L+ S Sbjct: 297 TALLLMRNLSINLTRPEFEDHRKLIES 323 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58599 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105279 (292 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60403 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21889 148 2e-38 >Contig21889 Length = 267 Score = 148 bits (374), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 71/87 (81%), Positives = 76/87 (87%) Query: 7 LLKVIFILQVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPE 66 L+ + + VFSAFGFVHKITTFEKTAGFQALVQFSD ETA+SAK ALD R IPRYLLPE Sbjct: 124 LVSIDILHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKTALDSRIIPRYLLPE 183 Query: 67 NMGPCTLRITYSAHTDLSVKFQSHRSR 93 +GPCTLRITYS HTDLSVKFQSHRSR Sbjct: 184 YVGPCTLRITYSGHTDLSVKFQSHRSR 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21917 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42535 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67272 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84538 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23352 387 e-109 >Contig23352 Length = 437 Score = 387 bits (993), Expect = e-109, Method: Compositional matrix adjust. Identities = 184/216 (85%), Positives = 194/216 (89%) Query: 1 MCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPII 60 MC L INDLDAGAGR+GGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPII Sbjct: 222 MCALFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII 281 Query: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQS 120 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIFR+DNVA +DIVKLVDTFPGQS Sbjct: 282 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQS 341 Query: 121 IDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIV 180 IDFFGALRARVYDDEVR W LVNSKE PTFEQP+MT+EKLLEYGNM+V Sbjct: 342 IDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 401 Query: 181 QEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 216 QEQENVKRVQLADKYLSEAALG+AN+DA+ +G FYG Sbjct: 402 QEQENVKRVQLADKYLSEAALGDANSDAMNTGTFYG 437 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86125 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30943 (66 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105558 (358 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21658 315 8e-88 >Contig21658 Length = 352 Score = 315 bits (807), Expect = 8e-88, Method: Compositional matrix adjust. Identities = 168/348 (48%), Positives = 230/348 (66%), Gaps = 19/348 (5%) Query: 6 FLLACLLAFTLQFFFXXXXXXXXXXX--XXXXXXXXMKDLIKLGEGCVSHPEDVSVVVRK 63 FLLACL+AF+LQ +F ++ +IKLG+G + PEDV V ++ Sbjct: 13 FLLACLVAFSLQIYFSPISPDPLHLPPPSHLPQNNILQKVIKLGDGVLLEPEDVDVD-KE 71 Query: 64 GALYTATNDGWVKYFILH-NETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKGLFKVTEE 122 G LYTAT DGW+K LH N + NWK +++ ++LG+T TK+GD+V CD+ +GL K+TE Sbjct: 72 GTLYTATRDGWIKR--LHKNGSWENWKKVNTDTVLGITFTKDGDLVACDTDQGLLKITEA 129 Query: 123 GVKVLDPDV-----RFANDVIDASDGTLYFTVSSTKYTPADFYKDMAEGNPYGQLLKYDP 177 GV VL V RFA+DVI+ DG+LYF+V+STK+ P D Y DM E P+GQLLKYDP Sbjct: 130 GVTVLTSHVNGSKIRFADDVIEGPDGSLYFSVASTKFGPHDGYLDMLEAKPHGQLLKYDP 189 Query: 178 KSNQTTVLQEGFYFANGVALSKDEDFVVVCESWKFRCRRYWLKGDRNGTLDTFAENLPGG 237 S +T++L + FANGVA+SKD+D++VVCE+WK YWL+G G + F ENLPGG Sbjct: 190 SSGETSILLDHLGFANGVAVSKDQDYLVVCETWK-----YWLEGKNKGKTEIFVENLPGG 244 Query: 238 PDNINLAPDGSFWIALIKMNQTGVKAIQNCREKWELLEAYPGLISLLLPMGSDAGARVVK 297 PDNINLAPDGSFWIAL+++ + G + + + L+ A L L+ M ++A A V Sbjct: 245 PDNINLAPDGSFWIALLQLTREGFEFVHTSKAAKHLVAASRKLTELVSGMRTEAMAVNVA 304 Query: 298 VDGIDGKIIRDFNDPNATYLSFVTSAVEYNDNLFLASLQSNFIGVLPL 345 DGKII+ DP+ + +SFVT+A+E+ D+L+L SL +NFIG LPL Sbjct: 305 A---DGKIIKKLMDPDGSVISFVTNALEFEDHLYLGSLNTNFIGKLPL 349 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94948 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60752 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69364 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58905 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101605 (113 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80727 (341 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27584 77 4e-16 >Contig27584 Length = 348 Score = 77.0 bits (188), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 78/302 (25%), Positives = 128/302 (42%), Gaps = 33/302 (10%) Query: 41 DKHLPMYDELASKETVEYIAGGATQNSIKVAQWMLQIPGATSYIGCIGKDKFGEEMKKNS 100 D LPM + IAGG+ N+I+ + + IG G D+ G+ N Sbjct: 74 DDSLPM----------KTIAGGSVANTIRGLSAGFGV--SCGIIGACGDDEQGQLFVSNM 121 Query: 101 TAAGVNVKYYEDESAPTGTCAVCVVG--GERSLVANLSAANCYKSE--HLKRPEIWSIVE 156 ++ VN+ + PT C VC+V G R++ LS+A +S+ L R + + Sbjct: 122 SSHAVNLSRLRMKKGPTAQC-VCLVDALGNRTMRPCLSSAVKLQSQADDLTRADF----K 176 Query: 157 KAKYYYIAGFFLTVSPESIQMVAEHAAAKNKVFMMNLSAPFICEFFREPQEKALPY--MD 214 +K+ + + ++ E IQ A + ++L++ + FR P + L +D Sbjct: 177 GSKWLLLR--YGIINLEVIQAAISIAKQEGLFVSLDLASFEMVRNFRSPLLQLLESGDID 234 Query: 215 YVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGK 274 F NE EA + E ++AL+ H R V+T G++ + + Sbjct: 235 LCFANEDEATELLRGSEGEQKADPDVALEFL------AKHCRWAVVTLGSNGCIAKHGKE 288 Query: 275 VKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTY 334 + P I K VD GAGD F GFL LV+ +E+C + G + VI+ G Sbjct: 289 IVRVPAI--GKANAVDATGAGDLFASGFLYGLVKGLSLEECCKVGSCSGGSVIRSLGGEV 346 Query: 335 PP 336 P Sbjct: 347 TP 348 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19180 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47702 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24372 113 2e-27 >Contig24372 Length = 148 Score = 113 bits (282), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 56/119 (47%), Positives = 74/119 (62%), Gaps = 1/119 (0%) Query: 35 VTQRLQKELMSLMMSGGDLGVSAFPEGESIFTWIGTIEGGKGTMYEGLSYKLSLHFPLDY 94 ++R+ KEL L SA P E +F W TI G + Y G + +S+HFP DY Sbjct: 2 ASKRILKELKDLQ-KDPPTSCSAGPVAEDMFHWQATIMGPGDSPYTGGVFLVSIHFPPDY 60 Query: 95 PFKPPQVKFETMCFHPNVDQYGNICLDILQDKWSSAYDCRTILLSIQSLLGEPNPESPL 153 PFKPP+V F T FHPN++ G+ICLDIL+++WS A +LLSI SLL +PNP+ PL Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPL 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93496 (196 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83766 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23937 (65 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39715 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8751 107 9e-26 >Contig8751 Length = 325 Score = 107 bits (267), Expect = 9e-26, Method: Compositional matrix adjust. Identities = 60/155 (38%), Positives = 87/155 (56%), Gaps = 7/155 (4%) Query: 8 NQLTSRFNALGLSNKDLVALAGGHTIGQARCTSFRAHIYN---ETNIDASFARTRQGNCP 64 NQL S F + GLS D+VAL+G HT+G + C F IY+ + ++ ++A Q CP Sbjct: 174 NQLNSLFASHGLSQADMVALSGAHTLGFSHCNQFSNRIYSNPVDPTLNKTYATQLQQMCP 233 Query: 65 RANGTGDNNLA-PLDLQTPTSFDNNYFKNLVNRKGLLHSDQQLFNGGSTDSQVRTYSNNP 123 + D ++A +D TP FDN YF+NLV KGL SDQ L+ + VRT++ N Sbjct: 234 K---NVDPDIAIDMDPTTPRKFDNVYFQNLVEGKGLFTSDQVLYTDSRSQPTVRTWAKNN 290 Query: 124 STFSSDFVAGMIKMGDISPLTGSRGEIRKNCRRIN 158 + F+ F+ M K+G + TG G IR++C N Sbjct: 291 AAFNQAFITAMTKLGRVGMKTGKNGNIRRDCSVFN 325 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86870 (272 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25511 175 8e-46 >Contig25511 Length = 242 Score = 175 bits (443), Expect = 8e-46, Method: Compositional matrix adjust. Identities = 86/232 (37%), Positives = 138/232 (59%), Gaps = 9/232 (3%) Query: 6 RPQFVLFGSSIVQLGFSNGGWGAILSDIYARKADILLRGYYGWNSRRALQVLDQVFPKDA 65 RP+ VLFG SI + F +GGWGA L+D Y+RKAD+ +RGY G+N+R AL +L +FP D+ Sbjct: 2 RPEIVLFGDSITEQSFQSGGWGAALADSYSRKADVKVRGYGGYNTRWALFLLQNLFPLDS 61 Query: 66 PIQPSLVIVYFGGNDSMGPHPSGLGPHVPLPEYVENMRRIATHLKSLSCATRIIFLSTPP 125 P+ ++FG ND+ + HVPL EY EN+R+ HLK S I+ ++ PP Sbjct: 62 DKPPAAATIFFGANDAAILGRTSERQHVPLEEYKENLRKFVLHLKECSPTILIVLITPPP 121 Query: 126 VDEARINQGTSEIFSELV-----RTNELCQKYSDACINLCHDLGVKAVDLFTAIQKRDDW 180 VDE N+ ++ + RTNE+ Y+ CI L ++G+++++L++ +Q+ + W Sbjct: 122 VDEDGRNEYARSLYGKDARELPERTNEVTGVYAKKCIELAEEMGLRSINLWSTLQETEGW 181 Query: 181 KNACFTDGIHLSEEGSKIVVAEILKVLKQAEWKPSLHWKSMPTEFSEDSLYD 232 + +DG+HL+ EG+ +V E++KV +A + + MP +F S D Sbjct: 182 QKKFLSDGLHLTPEGNAVVHQEVVKVFTEAWFSAT----EMPHDFPHHSEID 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99356 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78954 (207 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25592 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20341 146 2e-37 >Contig20341 Length = 186 Score = 146 bits (368), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 96/191 (50%), Positives = 113/191 (59%), Gaps = 13/191 (6%) Query: 1 MKGRVRWDEDNLGEIEANKPVRQKITEPKTPYHPMIDDDDYTS---PRQGSFDQCVDAIA 57 MKGRVRWDE N+GEIEANKPVRQKITEPKTPYHPM+ DD+Y S R G+FD CV Sbjct: 1 MKGRVRWDEANIGEIEANKPVRQKITEPKTPYHPMMTDDEYGSLSPMRGGTFDDCV---G 57 Query: 58 DGMNAEELRTALNDVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGSVSFREHRKA 117 D +AE +RTAL+DVA S SFREHR+A Sbjct: 58 DADHAEAIRTALSDVASSSRKSTQRSTGWTSSEDEADTMEQDDEDSEK--SKSFREHRRA 115 Query: 118 HYDEFLRVKELLREGSVLEEEDEDNGNGKAND--GICDSSSSLSAGVKCIDIERDTATP- 174 HYDEF +VKEL R+ S+L++E+ED D SSSL+AGVK IDI+ D + Sbjct: 116 HYDEFQKVKELRRKASLLDDEEEDEDENVDMDKKEKKSGSSSLTAGVKEIDIDEDGTSST 175 Query: 175 --QSEPPANGA 183 S PPANGA Sbjct: 176 KNSSVPPANGA 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16351 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14063 85 6e-19 >Contig14063 Length = 580 Score = 84.7 bits (208), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 2/105 (1%) Query: 43 KGPFICFVLGGPGSGKGTQCAKIVKNYGLTHLSAGELLRREIASNSEYGTTILNTIKEGK 102 K P + G P SGKGTQC IV +GL H+S G+LLR E++S +E G + G+ Sbjct: 72 KEPLKVMISGAPASGKGTQCELIVNKFGLVHISTGDLLRAEVSSGTEIGNKAKEFMNAGR 131 Query: 103 IVPSEVTVSLIQKEMESSDSKK--FLIDGFPRSEENRAAFERIVI 145 +VP EV +++ + D+K+ +L+DG+PRS + +++ I Sbjct: 132 LVPDEVVTAMVTARLSRDDAKEKGWLLDGYPRSFNQAQSLQKLKI 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs648 (238 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35726 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63760 (63 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85452 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94336 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9502 116 3e-28 >Contig9502 Length = 271 Score = 116 bits (291), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 76/175 (43%), Positives = 96/175 (54%), Gaps = 23/175 (13%) Query: 22 LGARSAQSPTGSSRKGSFVVRAASTPPVKQGADRPLWFASKQSLSYLDGSLPGDYGFDPL 81 L RS +PTGSS SF VRAA+ P DRPLWF +LDGSLPGD+GFDPL Sbjct: 40 LRVRSFTAPTGSSS--SFTVRAAAADP-----DRPLWFPGSTPPPWLDGSLPGDFGFDPL 92 Query: 82 GL-SDPEGTGGFIEPKWLAYGEVINGRYAMLGAVGAIAPEILGKAGLIPQETALAWFQTG 140 GL SDP+ KW E+++ R+AMLGA G PE L K G++ +W+ Sbjct: 93 GLSSDPDSL------KWNQQAELVHCRWAMLGAAGIFIPEFLTKIGIL---NTPSWYT-- 141 Query: 141 VIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLG 195 AG Y+ D TLFV+E+ L+G+AE RR+ D PGS+ K G Sbjct: 142 ----AGEQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDPIFPNNKLTG 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97567 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22021 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48275353 130 2e-32 >48275353 Length = 116 Score = 130 bits (327), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 59/77 (76%), Positives = 66/77 (85%) Query: 39 NSLAEILLRSDTPVGPWKVYGVARHPRPNWNDDYPVEYIQCDVSDQEDTQAKLSKLTDIT 98 NSLAEIL SDTP GPWKVYGVAR PRPNWN D+PVEYIQCD+SD +D + KLS LTD+T Sbjct: 40 NSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEYIQCDISDPDDAKTKLSPLTDVT 99 Query: 99 HIFYVTWASRRTEAENC 115 HIFYVTW +R T+AENC Sbjct: 100 HIFYVTWTNRSTDAENC 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42309 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22824 163 1e-42 >Contig22824 Length = 399 Score = 163 bits (412), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 84/164 (51%), Positives = 104/164 (63%), Gaps = 18/164 (10%) Query: 1 MNMNTHIFPEFVVSFKFSSNVEGHLIRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVS 60 MNMNTHI+PEFVVSFK +SN EGHLI +E++ S + TS QG QG S+ D G + Sbjct: 233 MNMNTHIYPEFVVSFKITSNTEGHLIGTENKLGASGVGTSCQGPQG----SSAVDTGSET 288 Query: 61 HPVSDSGGS--------------QGXXXXXXXXXXXXXXXXWMPFPMLFASISNKVSPKV 106 P+SDSG S QG WMPFPMLF++I NKV P+ Sbjct: 289 QPLSDSGKSHGNNSQMISKPGRFQGETTNTGSAPQRTPKSPWMPFPMLFSAIENKVPPED 348 Query: 107 MEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTITALQCK 150 M+Q++ Y+LFR +K+ RD+FVKKLRL+VGD LLRSTIT LQCK Sbjct: 349 MKQVNVHYDLFRERKITRDEFVKKLRLVVGDTLLRSTITELQCK 392 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43713 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18148 69 2e-14 >Contig18148 Length = 365 Score = 68.6 bits (166), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 28/62 (45%), Positives = 44/62 (70%) Query: 4 QITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNCSPTQLQTMQKFQDTILK 63 + TPLF++NAAYD+WQI+ LAP ADP+G WH+C + NC+ ++ +Q F++ +LK Sbjct: 230 SVKTPLFLVNAAYDTWQIQASLAPRTADPNGLWHACTNNNANCAAWLIKFLQGFRNQMLK 289 Query: 64 CI 65 + Sbjct: 290 AV 291 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17126 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54924 (140 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48265854 202 3e-54 >48265854 Length = 138 Score = 202 bits (513), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 103/126 (81%), Positives = 106/126 (84%) Query: 15 PKASKSVSRSHKAGLQFPVGRIARFLKAGKYAERVGAGAPXXXXXXXXXXXXXXXXXXGN 74 PKASKSVSRS KAGLQFPVGRIARFLKAGKYAERVGAGAP GN Sbjct: 13 PKASKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVLELAGN 72 Query: 75 AARDNKKNRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLLPKKVGKGKGDIG 134 AARDNKKNRIVPRHIQLAVRNDEELSKLLG+VTIANGGV+PNIHQ LLPKKVGKGKG+IG Sbjct: 73 AARDNKKNRIVPRHIQLAVRNDEELSKLLGAVTIANGGVMPNIHQNLLPKKVGKGKGEIG 132 Query: 135 SASQEF 140 SASQEF Sbjct: 133 SASQEF 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48309 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18494 (63 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21219 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52434 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25776 (104 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31573 131 3e-33 >Contig31573 Length = 165 Score = 131 bits (330), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 61/93 (65%), Positives = 69/93 (74%) Query: 1 MAPEFLRGEPSNEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQNTS 60 MAPE LR EPS+EK DVYS+GVILWEL TMQQPW G++P QVVGAV FQ+RRL IP N Sbjct: 65 MAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRLDIPDNID 124 Query: 61 PVLASLMESCWADDPAQRPSFANIVESLKKLLK 93 P +A L+ CW DP RPSFA I+ LK L K Sbjct: 125 PAIADLIRKCWQTDPKLRPSFAEIMAILKPLQK 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84445 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15104 165 4e-43 >Contig15104 Length = 324 Score = 165 bits (417), Expect = 4e-43, Method: Compositional matrix adjust. Identities = 75/98 (76%), Positives = 87/98 (88%) Query: 1 MKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNC 60 MKQRYVGHCNVGTDIKQASFLGQRG+Y+ASGSDDGRWF+WEK+TGRLIKML GDEAVVNC Sbjct: 191 MKQRYVGHCNVGTDIKQASFLGQRGEYVASGSDDGRWFVWEKRTGRLIKMLQGDEAVVNC 250 Query: 61 VQCHPFDCVVATSGIDSTIKIWTPSASVPSIVSGGAAG 98 VQCHP DCVVATSGID+TIK+ +++ ++ G +G Sbjct: 251 VQCHPVDCVVATSGIDNTIKVGIMKSTLFFLLGGLWSG 288 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs167106188 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25685 113 2e-27 >Contig25685 Length = 227 Score = 113 bits (283), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 3/79 (3%) Query: 1 MTTNKEANSNIIAATSAKDSQSQASCPAECCMCGDYGVSNELFRCKVCQFRSQHRYCSNL 60 MTT+ + N+N A+S Q QA+ ECCMCGD+G S ELF CKVCQFRSQHRYCSNL Sbjct: 1 MTTSSKGNNN---ASSVVQVQEQAAGSHECCMCGDFGFSYELFVCKVCQFRSQHRYCSNL 57 Query: 61 YPKAESYQVCNWCLSQRDE 79 YP AESY++CNWCL+Q+++ Sbjct: 58 YPNAESYRICNWCLTQKED 76 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68010 (146 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4544 119 2e-29 >Contig4544 Length = 232 Score = 119 bits (299), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 61/144 (42%), Positives = 93/144 (64%), Gaps = 8/144 (5%) Query: 1 MNAHSCGFNSALLEKGKSVWVMNVVP-TIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTY 59 MNA+ GF +AL + VWVM+ VP + L +I +RGF+G DWCEAF TYPRTY Sbjct: 86 MNAYLGGFAAALSKY--PVWVMSTVPANSNQDTLGVIYERGFIGTYQDWCEAFSTYPRTY 143 Query: 60 DLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIESARALTTRLKWD 119 DL+HA G+ S+ ++ RC I E+DRILRPEG V+ RDT ++ +A+T ++W Sbjct: 144 DLIHAGGVFSI---YQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAITDGMRWK 200 Query: 120 ARVIEIESN--SDERLLICQKPFF 141 +++++ ES + E++L+ K ++ Sbjct: 201 SQIMDHESGPFNPEKILLAVKTYW 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2138 (77 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22808 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82041 (309 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22543 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32325 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6102 103 2e-24 >Contig6102 Length = 212 Score = 103 bits (256), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 53/147 (36%), Positives = 84/147 (57%), Gaps = 3/147 (2%) Query: 1 MRPSNILLTHDFVPMLGDFGLARWKTTDDP--VQTKILGTLGYLAPEYAENGIVSIRTDV 58 ++ SNILL + P L FGLA+ D V ++GT GY APEYA G +++++D+ Sbjct: 27 LKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDI 86 Query: 59 YAFGIILLQLMSGRKVVDMNGEEPQQSLRQWAEPLI-EKLALHELIDPRIENSYDTYELY 117 Y+FG++LL++++GR +D +Q L +WA L ++ L ++ DP ++ Y LY Sbjct: 87 YSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLY 146 Query: 118 LMAKTAYLCVQRNPEGRPSMGEVVRLL 144 A +CVQ P RP + +VV L Sbjct: 147 QALAVAGMCVQEQPNMRPVIADVVTAL 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44620 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73702 (143 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226814092 258 3e-71 >226814092 Length = 140 Score = 258 bits (659), Expect = 3e-71, Method: Compositional matrix adjust. Identities = 123/140 (87%), Positives = 129/140 (92%) Query: 1 MWEDDNEGFVACFLIKKDGSKTAQGRRRHLEEGAWDAIHVIEVAPEEEGIARYCLTSTVM 60 MWEDDNEGFV CFLIKKDGSKT QGRR +L+EGAWDAIHVIEV PEEEG A Y LTSTVM Sbjct: 1 MWEDDNEGFVGCFLIKKDGSKTGQGRRGYLQEGAWDAIHVIEVGPEEEGTAHYRLTSTVM 60 Query: 61 LSLTTDHESSGTFSLSGSIRRQMNMDLSVSEGHLCNMGKMIEEMEGKLRNSLDQVYFGKT 120 LSLTTD+ESSGTFSLSGSIRRQMNM LS EGHLCNMG+MIEEME KLRNSLDQVYFGKT Sbjct: 61 LSLTTDNESSGTFSLSGSIRRQMNMHLSTEEGHLCNMGRMIEEMESKLRNSLDQVYFGKT 120 Query: 121 KEMVCTLRPPSEVIMRLPDS 140 KEMVCTLRPPS+V+MRLPDS Sbjct: 121 KEMVCTLRPPSDVVMRLPDS 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33185 (141 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20450 85 5e-19 >Contig20450 Length = 148 Score = 84.7 bits (208), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 5/123 (4%) Query: 5 GIARGRLTEERKAWRKN---HPHTDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVY 61 + G + E+ W+ P + + GG F +T++F DYP KPPK F FHPN+ Sbjct: 20 SCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNIN 79 Query: 62 PSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRR 121 +G++CL IL E W PA+T+ ++L+ I LL PNP DP + ++ D +Y+ Sbjct: 80 SNGSICLDILKEQ--WSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETT 137 Query: 122 VRQ 124 R Sbjct: 138 ARS 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103953 (171 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13466 91 1e-20 >Contig13466 Length = 361 Score = 90.5 bits (223), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 42/110 (38%), Positives = 67/110 (60%), Gaps = 1/110 (0%) Query: 1 MGTFGYVAPEYASTGMLNERSDVYSFGILIMEVISGRNPVDYSRPPGEVNLVEWLKTMVT 60 +GTFGY APEYA TG L ++SDVYSFG++++E+++GR PVD++ P G+ +LV W ++ Sbjct: 241 LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS 300 Query: 61 NRNAEGVLDPRLQEKPCSXXXXXXXXXXXXCVDPNAHKRPKMGHVIHMLE 110 + +DP+L++ P + CV + RP M V+ L+ Sbjct: 301 EDKVKQCVDPKLKDYP-AKGVAKLAAVAALCVQYESEFRPNMSIVVKALQ 349 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51332 (318 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18960 127 3e-31 >Contig18960 Length = 140 Score = 127 bits (318), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 64/144 (44%), Positives = 97/144 (67%), Gaps = 6/144 (4%) Query: 175 FSGVATDMITVNSTVKMIYRNTGTFFGVHVTSNPLDLSYSEITIASGAIRKFYQSRKSQK 234 +GV T M+T+N +V+M N TFFG+HV+S P+ L YSEI +A+G ++K+YQ RKS + Sbjct: 1 MTGVPTKMLTMNCSVRMTVYNPATFFGIHVSSTPIKLMYSEIAVATGQLKKYYQPRKSYR 60 Query: 235 TVTVAVMGNKIPLYGSGAGLSINSTTGSTSHPVPLNLNFVVRSRAYVLGKLVKPKFYKNI 294 VTV + G K+PLYG+GA L+++ G VP+ L F VRSR V+G+LV+ K +++ Sbjct: 61 NVTVNLQGIKVPLYGAGASLAVSDNNGG----VPMMLVFEVRSRGNVVGRLVRSKHRRHV 116 Query: 295 ACSITFDPKKLNVPVSLK-NSCTY 317 +C++ + P+ LK +SCTY Sbjct: 117 SCTMEVGSHS-STPIKLKTSSCTY 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78801 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10052 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11581 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43283 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39205 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8738 322 3e-90 >Contig8738 Length = 259 Score = 322 bits (825), Expect = 3e-90, Method: Compositional matrix adjust. Identities = 146/199 (73%), Positives = 169/199 (84%) Query: 1 MGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRRCGHPTQRWYHVPRSWLKP 60 MGKGQVWINGQSIGRYWMAYAKGDC +CSY GTFRP CQ CG PTQRWYHVPRSWLKP Sbjct: 50 MGKGQVWINGQSIGRYWMAYAKGDCSSCSYIGTFRPTKCQLHCGRPTQRWYHVPRSWLKP 109 Query: 61 TKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNYDIENKGNSNSTGNAKVLL 120 T+NL+VVFEELGGD S+I+LV+RSV VC D HE+HP +N+D+E +S + A+V L Sbjct: 110 TQNLVVVFEELGGDPSKITLVRRSVTGVCGDLHENHPNAENFDVEGNEDSKTLHQAQVHL 169 Query: 121 QCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAMLEKECIGQESCSIFISSGVFG 180 CAPGQSI+SI+FASFGTPSGTCGSFQ+GTCHA NSHA++EK CIG+ESCS+ +S+ F Sbjct: 170 HCAPGQSISSIKFASFGTPSGTCGSFQQGTCHATNSHAVVEKNCIGRESCSVAVSNSAFE 229 Query: 181 KDPCPNVLKRLSVQAVCST 199 DPCPNVLKRLSV+AVCST Sbjct: 230 TDPCPNVLKRLSVEAVCST 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42863 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19328 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 86 3e-19 >Contig2543 Length = 199 Score = 86.3 bits (212), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 53/165 (32%), Positives = 88/165 (53%), Gaps = 14/165 (8%) Query: 8 KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQED 66 K V +GD GKT +++ + + F T+ F V+ ++ +T+ +WDTAGQE Sbjct: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 Query: 67 YNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYA-PGVPIILVGTKLDLRDD 125 Y+ L P+ YRGA ++ + + S S+ AKKW+ E++ A P + + L G K DL D Sbjct: 72 YHSLAPMYYRGAAAAVVVYDITSMDSFLR-AKKWVLEVQRQANPTLIMFLAGNKADLEDK 130 Query: 126 KQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVF 170 ++ + + +GE+ K G ++E S+KT QNV +F Sbjct: 131 RK----------VGSEEGEQYAKENG-LVFLETSAKTAQNVNELF 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97586 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9025 177 1e-46 >Contig9025 Length = 213 Score = 177 bits (449), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 86/197 (43%), Positives = 125/197 (63%), Gaps = 2/197 (1%) Query: 4 PVKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEK 63 PVKV+G LS RV+A L EKD++F+L+ +++ G+HKK F+ + PFG+VPAF+D Sbjct: 3 PVKVHGNVLSVCTRRVIAALYEKDIKFELVPIDLGTGEHKKEPFISLNPFGEVPAFEDGD 62 Query: 64 ISLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLAL 123 + L ESRAI +Y+ Y +KG +F + A I E EGQ F+P +S L F+ + Sbjct: 63 LKLFESRAITQYIVHEYADKGTPLVFQDSK-KMAMIAVGCEVEGQKFDPAASKLTFEQVI 121 Query: 124 APRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNAT 183 P + + D V+++ E KLA VLDVYE RL +S++LAG+ F+LADL H+P HYL+ T Sbjct: 122 KPMLKMPTDAAVVEEYEAKLAVVLDVYEIRLAQSKYLAGERFTLADLHHIPTIHYLMG-T 180 Query: 184 DRGEILTSRDNVGRWVG 200 ++ SR +V WV Sbjct: 181 QSKKLFVSRPHVSAWVA 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28459 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28707 146 2e-37 >Contig28707 Length = 375 Score = 146 bits (369), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 75/120 (62%), Positives = 89/120 (74%), Gaps = 3/120 (2%) Query: 1 MIRGKNILHLMDSHLEGNFSSEEATVVFDLASRCLQYEPRERPNTKDLVSTLAPLQNRPD 60 +IRGKN L LMDS LEG+FS+++ T + LASRCLQYEPRERPN K LV+ L PLQ + Sbjct: 258 LIRGKNFLMLMDSCLEGHFSNDDGTELVKLASRCLQYEPRERPNAKSLVTALIPLQKETE 317 Query: 61 VPSYVMLGIPRHEEAPPTPQHPLSPMGDACSRMDLTAIHQILVMTHYKDDEG-TNELSFQ 119 VPSYV+LGI Q LSP+G+ACSR+DLTAIH+IL YKDDEG TN+LSFQ Sbjct: 318 VPSYVLLGIAHGNTL--LNQTSLSPLGEACSRLDLTAIHEILEKLGYKDDEGVTNDLSFQ 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs126106184 (292 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22657 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61780 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18083 120 1e-29 >Contig18083 Length = 316 Score = 120 bits (301), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 55/140 (39%), Positives = 87/140 (62%), Gaps = 3/140 (2%) Query: 15 FFENGLQGMRMNYYPPCPQPEKVMGLSPHSDAAALTILLQLNEVEGLQV--KKDGKWIPV 72 +FEN R+NYY PCP+P+ V+G H D +ALT+L Q +VEGL V K DG W+ V Sbjct: 157 YFENQASFARLNYYAPCPKPDLVLGTGGHRDPSALTVLAQ-EDVEGLDVLRKSDGAWVRV 215 Query: 73 TPLPDAFIVNIGDTLEIITNGTYRSIEHRAVVNSVQERLSVATVYSVRYDGEVYPASSLI 132 P+PD+F++N+GD L++ +N Y S+EHRA+V++ ER S+ + +D + P L+ Sbjct: 216 KPVPDSFVINVGDVLQVWSNDLYESVEHRAMVHAETERYSIPIFFHPSHDITMKPLDELV 275 Query: 133 SEKTPPLFRRVRIEEYFRSR 152 E++P + + ++ R Sbjct: 276 DERSPAKYPEYKAGKWLNLR 295 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47542 (355 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18083 162 6e-42 >Contig18083 Length = 316 Score = 162 bits (411), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 91/274 (33%), Positives = 140/274 (51%), Gaps = 22/274 (8%) Query: 66 AKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEGFGQAF 125 AK+ AC+ WGFF ++NHGV S ++ + + FF L +EEKKK + + GF Sbjct: 15 AKIGEACRTWGFFTVINHGVPSDIRRRIMEASRKFFALPLEEKKKVSREAHNTAGFHN-- 72 Query: 126 VVSEEQK--LDWADIFSMITL-------------PVXXXXXXXXXXXXXXXXDTLEVYSM 170 E K DW +++ P +T E Y Sbjct: 73 --DEHSKDFKDWKEVYDFYVNDGMLMPASHEPDDPEIVPWYTPWPENLSKFRETCEEYGR 130 Query: 171 ELKSLAMNLISKMGKVLNIKDEELREFFENGFQSMRMNYYPPCPQPEKVMGLTPHSDGSA 230 + L NL+ + L + L +FEN R+NYY PCP+P+ V+G H D SA Sbjct: 131 ACEKLFFNLLELVSLSLGLPPTRLHGYFENQASFARLNYYAPCPKPDLVLGTGGHRDPSA 190 Query: 231 LTILLQINEVEGLQI--KNDGKWIPITPLPNAFIVNIGDTLEIITNGTYRSIEHRAIVNS 288 LT+L Q +VEGL + K+DG W+ + P+P++F++N+GD L++ +N Y S+EHRA+V++ Sbjct: 191 LTVLAQ-EDVEGLDVLRKSDGAWVRVKPVPDSFVINVGDVLQVWSNDLYESVEHRAMVHA 249 Query: 289 LQERLSIATFYTKRLDGEIYPASSLISEKTPALF 322 ER SI F+ D + P L+ E++PA + Sbjct: 250 ETERYSIPIFFHPSHDITMKPLDELVDERSPAKY 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41683 (117 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42594 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2264 134 1e-33 >Contig2264 Length = 143 Score = 134 bits (336), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 63/80 (78%), Positives = 71/80 (88%) Query: 34 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKTGGEKWKSMSEADKAPYVAKAE 93 DPNKPKRPASAFFVFME+FR ++KKDHP NKSVAAVGK GG+KWKS+SEA+KAPY+AKAE Sbjct: 30 DPNKPKRPASAFFVFMEDFRVKFKKDHPNNKSVAAVGKAGGDKWKSLSEAEKAPYIAKAE 89 Query: 94 KRKVEYEKDMKNYNRRQAEG 113 KRK EY K M YN+R AEG Sbjct: 90 KRKAEYTKTMNAYNKRIAEG 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52127 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49233 (326 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6662 112 1e-26 >Contig6662 Length = 368 Score = 112 bits (279), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 74/245 (30%), Positives = 110/245 (44%), Gaps = 6/245 (2%) Query: 85 IVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGEL 144 + G P +T L +L LDL NK++G IP IG LK LR+LNL N++ IPA + L Sbjct: 120 VTGEIPQCLTTLSNLRVLDLVGNKISGKIPADIGNLKMLRVLNLADNQISGKIPASLVGL 179 Query: 145 KRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNH 204 L H+ LS N GE+P + L L L N+LTG IP +G + LD+ N Sbjct: 180 SGLMHMDLSNNQITGELPADFGKLKMLSRALLNRNQLTGSIPDSIGNMNRLADLDLSRNQ 239 Query: 205 LVGTIRELIRFEGSFPVXXXXXXXXXXXTGGVPAQLANLTNLEILYLSHNKMSGTIPLAL 264 + G++ + + G V +G +PA + + + IL LS N G IP Sbjct: 240 MWGSVPDCL---GKMQVLSTLNLDGNKFSGQLPASVLSNRGMGILNLSRNGFEGNIPDVF 296 Query: 265 AHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGV---NPIGIHKVLELTD 321 L L +N G IP + ++ + + N + NP +V T+ Sbjct: 297 HGNSYFMALDLSYNNLKGPIPGSLSAAKYIGHLDLSHNHLCGAIPVGNPFDHLEVSSFTN 356 Query: 322 TEFLV 326 + L Sbjct: 357 NDCLC 361 Score = 105 bits (261), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 65/198 (32%), Positives = 97/198 (48%), Gaps = 4/198 (2%) Query: 109 LTGPIPPQIGRLKRLRILNL-RWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIAN 167 ++G I P+I L RL L L W + IP + L L L L N G+IP +I N Sbjct: 95 MSGSISPKICSLDRLTTLVLADWKGVTGEIPQCLTTLSNLRVLDLVGNKISGKIPADIGN 154 Query: 168 LPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVXXXXXX 227 L LR L L +N+++G+IP L L H+D+ NN + G EL G + Sbjct: 155 LKMLRVLNLADNQISGKIPASLVGLSGLMHMDLSNNQITG---ELPADFGKLKMLSRALL 211 Query: 228 XXXXXTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDA 287 TG +P + N+ L L LS N+M G++P L + L+ L LD N+FSG++P + Sbjct: 212 NRNQLTGSIPDSIGNMNRLADLDLSRNQMWGSVPDCLGKMQVLSTLNLDGNKFSGQLPAS 271 Query: 288 FYKHPFLKEMYIEGNAFR 305 + + + + N F Sbjct: 272 VLSNRGMGILNLSRNGFE 289 Score = 84.3 bits (207), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 61/224 (27%), Positives = 94/224 (41%), Gaps = 30/224 (13%) Query: 70 GDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLR 129 G+ +++ L + I G P ++ L L +DL NN++TG +P G+LK L L Sbjct: 153 GNLKMLRVLNLADNQISGKIPASLVGLSGLMHMDLSNNQITGELPADFGKLKMLSRALLN 212 Query: 130 WNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPEL 189 N+L IP IG + RL L LS N G +P + + L L L N+ +G++P + Sbjct: 213 RNQLTGSIPDSIGNMNRLADLDLSRNQMWGSVPDCLGKMQVLSTLNLDGNKFSGQLPASV 272 Query: 190 GILPNFRHLDVGNNHLVGTIRELIRFEGSFPVXXXXXXXXXXXTGGVPAQLANLTNLEIL 249 L++ N G I ++ F L Sbjct: 273 LSNRGMGILNLSRNGFEGNIPDVFHGNSYFMA---------------------------L 305 Query: 250 YLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPF 293 LS+N + G IP +L+ + +L L HN G IP +PF Sbjct: 306 DLSYNNLKGPIPGSLSAAKYIGHLDLSHNHLCGAIP---VGNPF 346 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74261 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8555 164 8e-43 >Contig8555 Length = 367 Score = 164 bits (416), Expect = 8e-43, Method: Compositional matrix adjust. Identities = 74/131 (56%), Positives = 104/131 (79%) Query: 63 ELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQPG 122 ELL E++ R+E +E +WP R++VVACA VC+ WR +TK+IVK+P LSGK+TFP +KQPG Sbjct: 46 ELLREVLVRIEASEAAWPPRKSVVACAGVCRSWRHLTKEIVKAPELSGKLTFPISVKQPG 105 Query: 123 PREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISLDAGDLS 182 PR+ QC I+RN+ T+YL+L LTP+ ++GKFLLAAR+++R ++Y+ISL A D+S Sbjct: 106 PRDDLVQCFIKRNRSDQTYYLFLGLTPALIDEGKFLLAARKFKRPTCTDYVISLYADDMS 165 Query: 183 QGSNAYVGKLR 193 +GS+ YVGKLR Sbjct: 166 KGSSYYVGKLR 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38375 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6102 129 3e-32 >Contig6102 Length = 212 Score = 129 bits (324), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 67/163 (41%), Positives = 100/163 (61%), Gaps = 9/163 (5%) Query: 1 MRPNNILLTHDFEPLVGDFGLARWQXDGD-MGVETRVMGTFGYLAPEYAQSGQITEKADV 59 ++ +NILL + P + FGLA+ GD V VMGT+GY APEYA +GQ+T K+D+ Sbjct: 27 LKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVSKWVMGTYGYCAPEYAMTGQLTLKSDI 86 Query: 60 YSFGVVLVELVTGRKAVDLNRPKGQQCLTEWARPLLEE-YAIDELVDPRLGNHYSEHEVY 118 YSFGVVL+E++TGR A+D R G+Q L EWAR L ++ + ++ DP L Y + +Y Sbjct: 87 YSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFKDRRKLSQMADPTLQGQYPKRGLY 146 Query: 119 CMLHAASLCIRRDPHSRPRMSQVLRILEGDTVIDTYMSTPGYD 161 L A +C++ P+ RP ++ V+ L TY+++ YD Sbjct: 147 QALAVAGMCVQEQPNMRPVIADVVTAL-------TYLASQKYD 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77012 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12574 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82250 (371 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67211 (534 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32119 62 2e-11 >Contig32119 Length = 141 Score = 62.4 bits (150), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 27/56 (48%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Query: 474 CYICLAEYEEGDRIRLLPCHHEYHMSCVDKWLKEIHGVCPLCRRDVRQGATESSNS 529 C ICLA+Y + D +R LPC H +H+ CVDKWLK I+ CPLC+ + + + E+ +S Sbjct: 84 CCICLAKYADDDELRELPCLHVFHVECVDKWLK-INASCPLCKSEAGESSGEARDS 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs14331 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59112 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7270 131 1e-32 >Contig7270 Length = 365 Score = 131 bits (329), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 77/247 (31%), Positives = 129/247 (52%), Gaps = 13/247 (5%) Query: 8 AIASLSHSNGTIPAEFVRPEKEQPASATYHGPAPEIPTIDLD--DPVQDR---LVRSIAE 62 + S++H T+ +FVR E E+P A Y+ + EIP I L D V+ R + + I Sbjct: 7 TLTSIAHEK-TLQQKFVRDEDERPKVA-YNDFSNEIPIISLAGIDEVEGRRGEICKKIVA 64 Query: 63 ASREWGIFQVTNHGIPSDLIGKLQAVGKEFFELPQEEKEVYSRPADAKDVQGYGTKLQKE 122 A +WGIFQ+ +HG+ ++LI ++ + +EFF LP EEK + K G+ + Sbjct: 65 ACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLRFDMSGGKKG--GFIVSSHLQ 122 Query: 123 VEGKKSWVDHLFHRVWPPSSINYRFWPNNPPSYRAVNEEYAKYMREVVDKLFTYXXXXXX 182 E + W + + + +P +Y WP+ P ++R V ++Y+ + + KL Sbjct: 123 GEAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMG 182 Query: 183 XXXXXXKEAAGGDDIEYMLKINYYPPCPRPDLALGVVAHTDLSALTVLVPNEVPGLQVFK 242 +A D++ + +N+YP CP+PDL LG+ HTD +T+L+ ++V GLQ + Sbjct: 183 LDTEALTKACV--DMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATR 240 Query: 243 DD--RWI 247 DD WI Sbjct: 241 DDGKTWI 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38000 (392 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56536 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85578 (430 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95552 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27904 105 8e-25 >Contig27904 Length = 191 Score = 105 bits (262), Expect = 8e-25, Method: Compositional matrix adjust. Identities = 76/198 (38%), Positives = 93/198 (46%), Gaps = 12/198 (6%) Query: 4 KKMKGVAASVEIAPAPACSVYDDPRVRLRHQSLKQDYXXXXXXXXXXXXXXXXXXXXXXX 63 KKMKGV + +D R R +HQSL QDY Sbjct: 2 KKMKGVVSDA----------VEDQRTRFKHQSLMQDYEELQKDADAMKKKLQMMKQKKST 51 Query: 64 XXSEVRFLRRRHQYLTANKPSTSTMGQNSVKAQQKPIPSRKMAKERNYGRKAAALCRPPL 123 +EVRFLRRR+ YL N+ + + Q+ VK R + K + R PL Sbjct: 52 LVAEVRFLRRRYNYLMGNQSTHTRPKQDVVKTHNLDT-QRVTYLKGKSSSKKESASRCPL 110 Query: 124 -GFDLNKKGKAYNEKEATLRNPIPVFDLNQKLKAYNGKESTSLHSLPVLDLNQKERVYSR 182 DLNKK K + E +R P P FDLN +A GKE+T P DLN+KERV S Sbjct: 111 PALDLNKKEKVKHGMEDIVRKPPPKFDLNLNARALGGKEATLRTPTPNFDLNKKERVQSG 170 Query: 183 KDAAIQNMTPVFDLNQIS 200 KD A + TPVFDLNQIS Sbjct: 171 KDTAKRKSTPVFDLNQIS 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91435 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5331 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79000 (88 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105603 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39278 (181 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44750 (282 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100106185 (135 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs662 (104 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26023 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25616 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78642 (63 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1445 (284 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12237 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89842 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs137106189 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11638 71 5e-15 >Contig11638 Length = 66 Score = 70.9 bits (172), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 39/66 (59%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Query: 33 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCAC 92 MS C NCDCAD +QCVKKG+SY VET+ + TV V D AAE +G CKCG C+C Sbjct: 1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSC 59 Query: 93 VNCTCG 98 V+CTCG Sbjct: 60 VSCTCG 65 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2618 (306 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44282 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5463 139 2e-35 >Contig5463 Length = 112 Score = 139 bits (350), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 74/112 (66%), Positives = 77/112 (68%), Gaps = 1/112 (0%) Query: 15 VEDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKAIVDAESGNAVAFATXXXXXXXX 74 +EDYVHRIGRTGR GSMGQ+TSFYTDRDM LVA IKKAI DA SGNAVAFAT Sbjct: 1 MEDYVHRIGRTGRAGSMGQSTSFYTDRDMFLVANIKKAISDAGSGNAVAFATGKTARRKE 60 Query: 75 XXXXXXXXXXXXXTSKLSMMGP-SVNIEDKYRFMIAASNMKREGAADSAWDD 125 S S GP SVNIEDKYRFM A SN K+EGAADSAWDD Sbjct: 61 KEAAAAQKQARVALSNSSTAGPASVNIEDKYRFMFADSNNKKEGAADSAWDD 112 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9399 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82816 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27337 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32211 (293 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92457 (274 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29929 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18655 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55982 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88949 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9420 130 1e-32 >Contig9420 Length = 377 Score = 130 bits (327), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 63/134 (47%), Positives = 89/134 (66%) Query: 1 MGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQS 60 +G+ ++A+LFLG S+VQ +V+VERTVFYRE+AAGMY+ +P+A AQV IE Y+ +Q+ Sbjct: 156 LGATYSAILFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQVAIETIYVAIQT 215 Query: 61 VVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYG 120 VY +++ MIG+ + KF ++ M VALTP H IAAIV + F Sbjct: 216 FVYSCLLFFMIGYNFKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPGHQIAAIVMSFFLS 275 Query: 121 LWNVFSGFIIPRPV 134 WN+FSGF+IPRP+ Sbjct: 276 FWNLFSGFLIPRPL 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47688 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10102 (280 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40482 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25132 180 5e-48 >Contig25132 Length = 319 Score = 180 bits (457), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 1/102 (0%) Query: 1 MDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSHGLPGQDGLSESRLMDLLHGS 60 MDGAPYLRKVDLK Y +Y++LS ALEKMFSCFTIGQC SHG +DGLSESRLMDLLHG+ Sbjct: 207 MDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGSHGA-SRDGLSESRLMDLLHGA 265 Query: 61 EYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAIGL 102 EYVLTYEDKDGDWMLVGDVPW+MFT++C+R+RIMK SEAIGL Sbjct: 266 EYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGL 307 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77124 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88183 (323 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14204 135 6e-34 >Contig14204 Length = 221 Score = 135 bits (341), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 69/160 (43%), Positives = 100/160 (62%), Gaps = 17/160 (10%) Query: 68 HTYDTVFHGFSAKLTPSEALRLKTLPHVLAVFSEQVRHLHTTRSPQFLGLKSSSDSAGLL 127 H+Y F+GF+AKLT EA +L + V++VF + + L TTRS F+G + Sbjct: 76 HSYKRTFNGFAAKLTEEEAQKLAGMDGVVSVFPSETKKLQTTRSWDFIGFPE-------M 128 Query: 128 LKESDFGSDLVIGVIDTGVWPERQSFNDRDLGPVPRKWKGQCVTTNDFPATSCNRKLIGA 187 +K S +D+++GVID+G+WPE SF+D GP P++WKG C +F +CN K+IGA Sbjct: 129 VKRSAIETDIIVGVIDSGIWPESASFSDAGFGPPPKRWKGACKGEGNF---TCNNKIIGA 185 Query: 188 RFF-SQGYESTNGKMNETTEFRSPRDSDGHGTHTASIAAG 226 R++ SQ Y +++ SPRD++GHGTHTAS AAG Sbjct: 186 RYYRSQPYP------QNSSDIMSPRDTEGHGTHTASTAAG 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17782 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27515 93 3e-21 >Contig27515 Length = 163 Score = 93.2 bits (230), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 46/121 (38%), Positives = 72/121 (59%), Gaps = 3/121 (2%) Query: 10 NFYAVLGLNKECTATELRNAYKKLALRWHPDRCSASGNAKFVDEAKKKFQTIQHAYSVLS 69 ++Y+VLG+ + + E+R AY+KLA++WHPDR + + + + EAK+KFQ IQ AYSVLS Sbjct: 11 SYYSVLGVGSDSSVEEIRRAYRKLAMKWHPDRWTRTPS--LLGEAKRKFQQIQEAYSVLS 68 Query: 70 DANKRLLXXXXXXXXXXXXXXXXXXXFLNEMAAMMSQTQTNENGEETFEELQNLFEEMFQ 129 D KR + F+ EM ++M++++ E T E+LQ +F EM + Sbjct: 69 DQRKRSMYDVGLYDPDDDEEDEGFCDFVQEMVSLMAESR-REAKSYTMEDLQAMFREMVK 127 Query: 130 G 130 G Sbjct: 128 G 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56537 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56128 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103996 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21511 136 3e-34 >Contig21511 Length = 225 Score = 136 bits (343), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 77/197 (39%), Positives = 107/197 (54%), Gaps = 7/197 (3%) Query: 8 QELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVP 67 ++L++L F+++AAI +VC SSLY+YAK NSGPL+ V TVE V V+GPVY+K G+P Sbjct: 18 KKLKYLEFVQVAAIYVVVCFSSLYEYAKENSGPLKPGVQTVEGTVRTVIGPVYEKLHGLP 77 Query: 68 XXXXXXXXXXXXEASRKFDEHAPPLAKRVASQVHSLIETASQKAQNLVSEAQTGGPRAAV 127 E+ + D H P L K+ +SQ S+ Q LVS A+ Sbjct: 78 FQFLKFVDRKVDESLSEVDRHVPVLVKQASSQALSVAREVEQGG--LVSTAKNITVSVYY 135 Query: 128 HYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTV 187 Y ++ +V AW LN LF +A + VPT + WS KYN V +GY+V Sbjct: 136 KYEPVAEQY-----AVSAWRALNRLPLFPLVAQIIVPTVSYWSGKYNRAVGYTANRGYSV 190 Query: 188 FGYLPLVPIDDIAKAFK 204 YLPL+P + IAK F+ Sbjct: 191 AAYLPLIPTERIAKVFE 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64687 (287 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8789 107 3e-25 >Contig8789 Length = 246 Score = 107 bits (266), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 47/72 (65%), Positives = 60/72 (83%), Gaps = 1/72 (1%) Query: 85 GHSTALYCLCKQGLSQSVLQKAIDYACGAGADCTPILQNGVCWNPNTVQDHCNYAVNSYF 144 G S+A +C+CK G + LQ+A+DYACGAGADC PI NGVC+NPNT++ HC+YAVNSYF Sbjct: 16 GQSSANWCVCKDG-DPTALQRALDYACGAGADCNPIKPNGVCYNPNTIKAHCSYAVNSYF 74 Query: 145 QRKGQTPGSCDF 156 Q+KGQ+ G+CDF Sbjct: 75 QKKGQSTGTCDF 86 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs31178 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25217 179 1e-47 >Contig25217 Length = 225 Score = 179 bits (453), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 81/98 (82%), Positives = 93/98 (94%) Query: 1 MVKDASQGISFVCNNISEYGGDPDRIYLMGQSAGAHIAACTLLEQAIKETGEGESTTWSV 60 MVKDASQGIS+VCNNI++YGGDP+RIYLMGQSAGAHI+AC LL+QAIKE + ES +WSV Sbjct: 1 MVKDASQGISYVCNNIADYGGDPNRIYLMGQSAGAHISACALLDQAIKEAKKEESISWSV 60 Query: 61 SQIRAYFGLSGGYNLFDLVDHFHSRGLYRSIFLSIMDG 98 SQI+AYFGLSGGYNLF+LVDHFH+RGLYRSIFLSIM+G Sbjct: 61 SQIKAYFGLSGGYNLFNLVDHFHNRGLYRSIFLSIMEG 98 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102106185 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76075 (343 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43787 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4754 63 4e-12 >Contig4754 Length = 82 Score = 63.2 bits (152), Expect = 4e-12, Method: Composition-based stats. Identities = 30/55 (54%), Positives = 45/55 (81%) Query: 216 IVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCS 270 ++EE++ AA+ IAEAE +S+LAAE KEAER++ MAE+T++M+QL EI E+C+ Sbjct: 1 MLEESARAAAHSIAEAEYRSYLAAEQMKEAERINFMAENTESMMQLANEILEQCN 55 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99914 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26030 169 2e-44 >Contig26030 Length = 246 Score = 169 bits (428), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 84/144 (58%), Positives = 107/144 (74%), Gaps = 2/144 (1%) Query: 12 SSSLQIGSKLCSAFSPFIGFVEDLIFSLTGCFDHHC--PPKLRYTFNDLVRLANNSPFTI 69 SSSL IG K+C+AF PF+ VE L+F+++GC H P + + LA+ + FT+ Sbjct: 6 SSSLSIGEKICAAFIPFVAMVEALVFAVSGCCSHRSRRPINRGFACGYMSHLADETRFTV 65 Query: 70 NEVEALYELFKELSSSLIDDGLIHKEELRLALLKTTSGENLFPDRVFDLFDEKKNGVIEI 129 NE+EALYELFK+LSSS+IDDG IHKEEL+LAL +T GENLF DRVFDLFDEKKNGVIE Sbjct: 66 NELEALYELFKKLSSSIIDDGSIHKEELQLALFQTPQGENLFLDRVFDLFDEKKNGVIEF 125 Query: 130 EEFVRALSIFHPSTPLEGQMTLHF 153 +EFV AL+IFHP P++ ++ F Sbjct: 126 DEFVHALNIFHPYAPIDDKIDFAF 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93563 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4405 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs876 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61313 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21596 124 4e-31 >Contig21596 Length = 332 Score = 124 bits (310), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 57/62 (91%), Positives = 59/62 (95%) Query: 9 HSRKPWSKFINADNQHLVSPEAIDFLDKLLRYDHQDRLTAREAMAHPYFAQVRAAESSRT 68 HSRKPWSKFINADNQHLVSPEAIDFLDKLLRYDHQDRLTA+EAM HPYF+QVRAAESSR Sbjct: 271 HSRKPWSKFINADNQHLVSPEAIDFLDKLLRYDHQDRLTAKEAMGHPYFSQVRAAESSRM 330 Query: 69 RA 70 R Sbjct: 331 RT 332 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34817 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37806 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27941 181 1e-47 >Contig27941 Length = 305 Score = 181 bits (458), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 79/128 (61%), Positives = 102/128 (79%) Query: 1 MSCNGCRVLRKGCSESCILRPCLQWIESPESQGHATVFVAKFFGRAGLMSFISAVPESQR 60 +SCNGCR+LRKGCSE+C +RPCLQWI+SPESQ +ATVF+AKF+GRAGLM+ I+A PE R Sbjct: 3 ISCNGCRILRKGCSENCSIRPCLQWIKSPESQANATVFLAKFYGRAGLMNLINAGPEHLR 62 Query: 61 PALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPVPELLNSCGGS 120 PA+F+SLLYEACGR VNP+ G+VGLLW+G+W +CQ AVE VL+G + P+ + G Sbjct: 63 PAIFRSLLYEACGRIVNPIYGSVGLLWSGSWQLCQVAVEAVLKGQPITPITSEAAANGHG 122 Query: 121 PTPTSDDV 128 P + D+ Sbjct: 123 PPLKAYDI 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65146 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13617 195 3e-52 >Contig13617 Length = 359 Score = 195 bits (496), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 98/148 (66%), Positives = 111/148 (75%), Gaps = 1/148 (0%) Query: 26 SSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSGSH 85 SSKLEGRSP C+LSDKASD LRTWF DDDALERA++GEW+L+P G +N SQ I L+ Sbjct: 193 SSKLEGRSPRCRLSDKASDQLRTWFEDDDALERAIDGEWYLIPCGQDNDASQLICLN-RD 251 Query: 86 ENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGR 145 E +IGS H D S TSI I S QVS+MHARISYKDGAFY+ DLQSEHGT++ D E + Sbjct: 252 EKTSCIIGSIPHGDASGTSITIRSPQVSEMHARISYKDGAFYVTDLQSEHGTWIADIEEK 311 Query: 146 RYRVSSNFPARFRPSDTIEFGSDKKQFR 173 RYRV NFPAR PSD IE GS K FR Sbjct: 312 RYRVPPNFPARIHPSDAIEIGSQKVAFR 339 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33157 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69044 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99071 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5899 226 1e-61 >Contig5899 Length = 524 Score = 226 bits (576), Expect = 1e-61, Method: Compositional matrix adjust. Identities = 107/122 (87%), Positives = 115/122 (94%) Query: 1 MAPSDEAELMHMVATAAVIDDRPSCFRFPRGNGIGAVLPPNNKGTPLEIGKGRILMEGDR 60 MAPSDEAELM+MVATAA IDDRPSCFRFPRGNGIGA+LP NNKGT LE+GKGRILMEG R Sbjct: 334 MAPSDEAELMNMVATAAAIDDRPSCFRFPRGNGIGALLPANNKGTALEVGKGRILMEGSR 393 Query: 61 VAILGYGSIVQQCVLAANMLKSQDISVTVADARFCKPLDTDLIRQLANEHEILITVEEGS 120 VAILGYGSIVQQCV AAN LK++DISVTVADARFCKPLDT+LI+QLA EHEILITVEEGS Sbjct: 394 VAILGYGSIVQQCVKAANNLKTRDISVTVADARFCKPLDTELIKQLAKEHEILITVEEGS 453 Query: 121 VG 122 +G Sbjct: 454 IG 455 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54021 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10738 348 5e-98 >Contig10738 Length = 362 Score = 348 bits (893), Expect = 5e-98, Method: Compositional matrix adjust. Identities = 167/254 (65%), Positives = 202/254 (79%) Query: 1 MGQAPEQEHPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNE 60 M +APEQEHP AFGWAA+DTSG LSPF+FSRR+TG++DV FKV +CGICH+DLH IKNE Sbjct: 1 MAKAPEQEHPVKAFGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNE 60 Query: 61 WGNTIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCHSCDSCAIDLENYCPKV 120 WG ++YP+VPGHEIVG VTEVGSKVSK K GDKVGVGCMVG+CH+C+SC +LENYCPK+ Sbjct: 61 WGISLYPMVPGHEIVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKM 120 Query: 121 IMTYANKYHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGL 180 I+TY + Y D T+TYGGYSD MVA+E ++VR PE PLDA APLLCAGITVYSPL+++GL Sbjct: 121 ILTYGSIYADRTVTYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGL 180 Query: 181 DKPGMHVGCXRLGRSRPCRPSIRKGYGGSGDCDQYPPSKKSEAIERLGAEFFLVSRDQNE 240 +PG HVG LG K +G PSKK EA+++LGA+ F+VSRD + Sbjct: 181 AEPGKHVGIVGLGGLGHVGVKFAKAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQQ 240 Query: 241 MQAALGTMDGIIDT 254 MQAA+GT+DGIIDT Sbjct: 241 MQAAIGTLDGIIDT 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63669 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50155 (284 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84306 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38831 (59 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs106138 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12515 81 8e-18 >Contig12515 Length = 163 Score = 80.9 bits (198), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 38/105 (36%), Positives = 56/105 (53%) Query: 25 PQXXXXXXXXXXXXXXXXXXXQYYLLDRFPVPYXXXXXXXXXXXXXXGQHVVRKIIAVLG 84 PQ ++YLL RFP+PY GQ +VR+++++L Sbjct: 57 PQVASATATFVMTFSASLSVVEFYLLKRFPIPYAIYLTSVSILAGFWGQFLVRRVVSILK 116 Query: 85 RASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEYMGFENLCQ 129 RASIIVFIL+ IF SAI++G GI+ ++ + N E+MGF + C Sbjct: 117 RASIIVFILSSVIFASAITMGVIGIKMSLQMISNHEFMGFLDFCN 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98185 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16714 (290 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88177 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42878 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35873 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103814 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62191 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50906 (60 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69360 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78137 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18778 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5998 113 1e-27 >Contig5998 Length = 107 Score = 113 bits (282), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 58/92 (63%), Positives = 66/92 (71%), Gaps = 1/92 (1%) Query: 27 IVEAPTPQPAESSGRNGNHSTYGTTQGSLQPQECGPRCTTRCSKTQYRKPCLFFCQKCCA 86 I A T A+ RN S G GSL+ +C +CT RCS+TQY KPC+FFCQKCCA Sbjct: 17 ISMAATQVMAKEQARNQLDSG-GYGPGSLKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCA 75 Query: 87 KCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP 118 KCLCVP GFYGNK CPCYNNWKT++GGPKCP Sbjct: 76 KCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85954 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27524 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9266 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12295 471 e-135 >Contig12295 Length = 403 Score = 471 bits (1213), Expect = e-135, Method: Compositional matrix adjust. Identities = 219/263 (83%), Positives = 240/263 (91%) Query: 4 GDPVAVGNVVGGVTFDVVLDNNGKNLDAVRPVADWAKSSGVKQFLFISSAGIYKPADEPP 63 G+P A+G + G FDVVLDNNGK+LD VRPVADWAKSSG KQFLFISSAGIYKP +EPP Sbjct: 141 GEPAAIGTIFEGAAFDVVLDNNGKDLDTVRPVADWAKSSGAKQFLFISSAGIYKPTEEPP 200 Query: 64 HVEGDVVKPDAGHVQVEKYISENFSNWASFRPQYMIGSGNNKDCEEWFFDRIVRKRPVPI 123 HVEGD VK DAGHV VEKYI+E F +WA FRPQYM+GSGNNKDCEEWFFDRIVR RPVPI Sbjct: 201 HVEGDAVKADAGHVAVEKYIAEIFGSWAIFRPQYMLGSGNNKDCEEWFFDRIVRDRPVPI 260 Query: 124 PGSGMQFTNIAHVRDLSSMLTLAVENPEAASSNIFNLVSDRAVTLDGMAKLCAQAAGLPV 183 PGSGMQ TNI+HVRDLSSMLTLAVENP+AAS NIFN+VS+RAVTLDG+AKLCAQAAG P Sbjct: 261 PGSGMQLTNISHVRDLSSMLTLAVENPDAASGNIFNIVSERAVTLDGLAKLCAQAAGRPA 320 Query: 184 EIVHYDPKAAGIDAKKAFPFRNMHFYAEPRAAKDILGWRSTTNLPEDLKERFEEYVKIGR 243 IVHYDPKAAG+DAKKAFPFRNMHFYAEPRAAK+ILGW+STTNL EDLKERFEEY+KIGR Sbjct: 321 NIVHYDPKAAGVDAKKAFPFRNMHFYAEPRAAKEILGWKSTTNLAEDLKERFEEYLKIGR 380 Query: 244 DKKAMQFEIDDKILESLKVPIPV 266 DKKA++FE+DDKILESLKVP+ V Sbjct: 381 DKKAIKFELDDKILESLKVPVAV 403 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81499 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100262 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83869 (132 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12861 (334 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4259 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8974 77 2e-16 >Contig8974 Length = 206 Score = 76.6 bits (187), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 37/63 (58%), Positives = 42/63 (66%) Query: 1 DARQIXXXXXXXXXXXXXXXXXDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKH 60 D RQI DLFGARITDSG YLR+FK+L+SLEICGGGLTD G+K+ Sbjct: 127 DTRQITDSGLAALTSLTGLTHLDLFGARITDSGTTYLRSFKDLKSLEICGGGLTDVGIKN 186 Query: 61 IKD 63 IKD Sbjct: 187 IKD 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78990 (74 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57118 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30601 418 e-119 >Contig30601 Length = 274 Score = 418 bits (1075), Expect = e-119, Method: Compositional matrix adjust. Identities = 198/242 (81%), Positives = 218/242 (90%) Query: 1 MHKLKIKPNVVTFSAILNACSRCNSFEDASMLLEELRLFDNQVYGVAHGLLMGYRDNIWV 60 MH+L IKPNVVTFSAILNACSRCNSF+DASMLLEELRLFDNQVYGVAHGLLMGYRDN+WV Sbjct: 33 MHELDIKPNVVTFSAILNACSRCNSFDDASMLLEELRLFDNQVYGVAHGLLMGYRDNVWV 92 Query: 61 QALSLFDEVKLMDSSTASAFYNALTDMLWHFGQKRGAQLVVLEGKRRQVWENVWSESCLD 120 +A SLFDEVK MDSSTASAFYNALTDMLWHFGQK+GAQLVVLEGKRR VWE+VWS+SCLD Sbjct: 93 KAQSLFDEVKQMDSSTASAFYNALTDMLWHFGQKQGAQLVVLEGKRRNVWESVWSDSCLD 152 Query: 121 LHLMSSGAARAMVHAWLLNIHSIVFEGHELPKLLSILTGWGKHSKVVGDGALRRAVEVLL 180 LHLMS GAARAMVHAWLLNI +IVF+G +LP LLSILTGWGKHSKVVGD LRRA+E LL Sbjct: 153 LHLMSPGAARAMVHAWLLNIRTIVFKGQQLPNLLSILTGWGKHSKVVGDSTLRRAIEALL 212 Query: 181 TGMGAPFWVANCNLGRFISTGPMVASWLRESGTLKVLVLHDDRTHSENAGFDEMLNMQTL 240 T MGAPF +A CNLGRFISTG + A+WL+ESGTL+VLVLHDDRT+ + A D++ N Q L Sbjct: 213 TSMGAPFHIAKCNLGRFISTGSVAAAWLKESGTLEVLVLHDDRTYPKGAHLDQISNFQAL 272 Query: 241 TL 242 L Sbjct: 273 AL 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19853 (72 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs90001 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29362 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64554 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59221 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3951 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22262 289 2e-80 >Contig22262 Length = 299 Score = 289 bits (740), Expect = 2e-80, Method: Compositional matrix adjust. Identities = 141/175 (80%), Positives = 153/175 (87%) Query: 2 LEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFXXXXXXXXXXXXI 61 LEMDDEYEGNVEATGEDYSVEPA++RRPFRALLDVGLI+TTTGNRVF I Sbjct: 113 LEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDI 172 Query: 62 PHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDA 121 PHS+KRFAGFSKD KQLDAEVHRKYIYGGHVAAYM+TL EDEPEKYQ+HF+EYIKKGI+A Sbjct: 173 PHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEA 232 Query: 122 DGLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNAL 176 D +E LYKKVHAAIRADPT KK+EK PKEHKRYNLKKLT++ERK KLVERL A Sbjct: 233 DNIEELYKKVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73473 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24051 (316 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13382 514 e-148 >Contig13382 Length = 530 Score = 514 bits (1324), Expect = e-148, Method: Compositional matrix adjust. Identities = 250/314 (79%), Positives = 282/314 (89%), Gaps = 1/314 (0%) Query: 1 MDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAK 60 +DDVVMEKL+EFDLLKHA KPSF+LSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAK Sbjct: 218 LDDVVMEKLMEFDLLKHANKPSFSLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAK 277 Query: 61 RFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNF 120 RFMWEVISRLSTR+GKTAVILTTHSMNEAQALCTR+GIMVGG+LRCIGSPQHLKTRFGN Sbjct: 278 RFMWEVISRLSTRRGKTAVILTTHSMNEAQALCTRMGIMVGGRLRCIGSPQHLKTRFGNH 337 Query: 121 LELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEI 180 LELEVKP EVSSVDL++LC++IQE + +PS RSLLD LE+CIG DSI +ENAT AEI Sbjct: 338 LELEVKPFEVSSVDLQNLCRVIQEWLSSVPSHPRSLLDGLEICIGA-DSILAENATVAEI 396 Query: 181 SLSQEMLLIVGCWLGNEERIKTLISSSSSPDRIFGEQLSEQLVRDGGIQLPIFSEWWLAK 240 SLS+EM++++G WLGNEERIKTLIS D + GEQL EQLVRDGGI LPIFSEWWL+ Sbjct: 397 SLSREMIIMIGRWLGNEERIKTLISPLPISDGVIGEQLIEQLVRDGGIPLPIFSEWWLSN 456 Query: 241 EKFAVIDSFILSSFPGSTFQGCNGLSVKYQLPFSEGLSVADVFGLLEQNRNRLGIAEYSI 300 EKF+ IDSF+L+SFPG+ FQG NGLS KYQLP+ +GLS+ADVFG LE++R++LGIAEYSI Sbjct: 457 EKFSAIDSFVLTSFPGAIFQGFNGLSAKYQLPYGQGLSLADVFGHLERSRHQLGIAEYSI 516 Query: 301 SQSTLETIFNHFAA 314 SQSTLETIFNHF Sbjct: 517 SQSTLETIFNHFCG 530 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78782 (62 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7027 (345 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13441 65 1e-12 >Contig13441 Length = 361 Score = 65.5 bits (158), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Query: 63 IVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRVQRKSHR 122 + K +HCEGCA+K++R +K FEGVE V TD +K+ V G K DP + +++++K + Sbjct: 30 FIFKTDIHCEGCAKKIKRAVKNFEGVEQVKTDSAANKLTVTG-KVDPAGLKEKLEQKIKK 88 Query: 123 QVELLSP 129 +V+L+SP Sbjct: 89 KVDLVSP 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36197 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6923 (155 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78980 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46990835 181 9e-48 >46990835 Length = 192 Score = 181 bits (460), Expect = 9e-48, Method: Compositional matrix adjust. Identities = 89/154 (57%), Positives = 115/154 (74%) Query: 18 MTALVTGGTRGIGHATVEELARFGAIVHTCSRNQIELDARLHEWKNKGFKVTGSVCDLSS 77 MTALVTGGT+GIG+A VEELA GAIVHTC+R + +L+ L +W+ KGF+VTGSVCD+ S Sbjct: 1 MTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVS 60 Query: 78 REQREKLIETVTSIFQGKLNILINNAAIAFVKPTVDITAEDMSTVSSTNFESVFHLSQLA 137 + QRE+LI V+S+F GKLNILINN K T++ TAED S + STN ES +HL QL+ Sbjct: 61 KTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAYHLCQLS 120 Query: 138 HPLFKASGNGSIVFISSVGGVRGIPSVSLYGAYK 171 HPL KASG+ +IV +SS+ GV + ++Y A K Sbjct: 121 HPLLKASGSANIVLLSSIAGVVSLNIGTIYSATK 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15336 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46990835 196 4e-52 >46990835 Length = 192 Score = 196 bits (497), Expect = 4e-52, Method: Compositional matrix adjust. Identities = 87/154 (56%), Positives = 121/154 (78%) Query: 14 MTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKI 73 MTALVTGGT+GIG+AIVEEL GAIVHTC+R E +LN+ + +W+ KG +V+GS CD+ Sbjct: 1 MTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVS 60 Query: 74 RAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLA 133 + +R++L+ V S FDGKLNIL+NN G PK E+T ED+S +M+TN ESAYHL QL+ Sbjct: 61 KTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAYHLCQLS 120 Query: 134 YPLLKASGNGNIIFISSVTGVIAVPLSSIYASTK 167 +PLLKASG+ NI+ +SS+ GV+++ + +IY++TK Sbjct: 121 HPLLKASGSANIVLLSSIAGVVSLNIGTIYSATK 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43015 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3057 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66689 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4719 186 2e-49 >Contig4719 Length = 423 Score = 186 bits (471), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 90/147 (61%), Positives = 107/147 (72%), Gaps = 4/147 (2%) Query: 1 MQKFDDKIPAREFDNFQFVNFTAIMSKNATPSEKETAFALAALMEIPIQYKAAVELGIMG 60 M+KFDDK+P+REFDNFQFVNFT IMSK+ T SEKE AFALAALMEIPIQYKAAVE GI+G Sbjct: 276 MRKFDDKLPSREFDNFQFVNFTEIMSKHTTSSEKEAAFALAALMEIPIQYKAAVEFGILG 335 Query: 61 RTTGXXXXXXXXXXXXXXXXXXXXERQPSRGSTPVAETQA---CPICLTNAKDLAFGCGH 117 RTTG R+PS S P + ++ CP+CLTN KD+AFGCGH Sbjct: 336 RTTGKKKRIVPRPPPVPYTHRAPT-REPSGLSAPAGDERSEMLCPVCLTNVKDIAFGCGH 394 Query: 118 MTCRECGSRVSNCPICRQRITNRLRLF 144 M+CR+C R+S+CPICRQ I +RLR+F Sbjct: 395 MSCRDCAPRLSDCPICRQPIRSRLRVF 421 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15036 (36 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104777 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5547 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63670 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96669 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9746 75 2e-16 >Contig9746 Length = 169 Score = 75.5 bits (184), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 40/86 (46%), Positives = 55/86 (63%) Query: 5 LTNEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDSDRNGTI 64 LT ++ E KEAF LFD DG G I +EL +R+L TEE++ MI +VD D +G I Sbjct: 21 LTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAI 80 Query: 65 EFGEFLNLMAKKMKETDAEEELKEAF 90 +F EF ++M K+ E D +EEL +AF Sbjct: 81 DFDEFAHMMTAKIGERDTKEELMKAF 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63097 (103 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64004 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2671 271 4e-75 >Contig2671 Length = 187 Score = 271 bits (694), Expect = 4e-75, Method: Compositional matrix adjust. Identities = 137/176 (77%), Positives = 151/176 (85%), Gaps = 2/176 (1%) Query: 5 KVSRLPYIFQHLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLIKRA 64 +V+RLP IF+ LGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLI+RA Sbjct: 13 EVARLPQIFKTLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLIRRA 72 Query: 65 RDFNIVLDDVAITHLSYGAEFSRXXXXXXXXXXXXXRSKFVVMKADQERRAAIIRAEGES 124 +DFNIVLDDVAITHLSYG EFSR RSKFVV K +QERRAAIIRA+GES Sbjct: 73 KDFNIVLDDVAITHLSYGLEFSRAVEAKQVAQQEAERSKFVVAKTEQERRAAIIRAQGES 132 Query: 125 EAAQLISEATSKFGLGLIELRRIEASREIAATLARSPHVAYLPGGKNSNMLLALNP 180 EAA+LIS+AT+ G+GLIELRRIEASRE+A TLARSP+V+YLPGGK NML LNP Sbjct: 133 EAAKLISDATASAGMGLIELRRIEASREVANTLARSPNVSYLPGGK--NMLFGLNP 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100216 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47196 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6233 151 6e-39 >Contig6233 Length = 164 Score = 151 bits (382), Expect = 6e-39, Method: Compositional matrix adjust. Identities = 70/143 (48%), Positives = 92/143 (64%) Query: 53 WWALTGLIHVFQEGYYVFTPDLFNDNSPNFMAEIWKEYSKGDSRYATRHTSVLGIESVAS 112 WWA TGL + EGY+ P+ + D + + AE+WKEYSKGDSRYA R V+ +E + + Sbjct: 3 WWAFTGLTDLILEGYFAIAPEFYKDKTAWYPAEVWKEYSKGDSRYAARDAGVVAVEGLTA 62 Query: 113 IVLGPLSLLAAYAVAKQKSYSYIFPFAISIAQLYGTIQYFLTAFLEGDNFAXXXXXXXXX 172 ++ GP SLLA YA++K KSYSYI FAIS+ QLYGT YF+TA+L+GD FA Sbjct: 63 VIEGPASLLAVYAISKGKSYSYILQFAISLGQLYGTAVYFITAYLDGDQFATSSFYYYAY 122 Query: 173 XXXXXXIWVIVPMLIATRDWIKI 195 WV++P LI+ R W KI Sbjct: 123 YIAANASWVVIPTLISIRCWKKI 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45790 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40026 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100314 (451 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26743 362 e-102 >Contig26743 Length = 696 Score = 362 bits (930), Expect = e-102, Method: Compositional matrix adjust. Identities = 225/451 (49%), Positives = 277/451 (61%), Gaps = 6/451 (1%) Query: 2 SFEKDQTDLCTRRNTTASNCGPVAEHVVTSEKFPNKGYKQKNPLRGQRKLEENSEGKLLQ 61 + EK+Q+D+ T R +T +N AE+ + + +K +QK +R ++KLEE SE K LQ Sbjct: 249 TMEKEQSDMDTGR-STLTNSSLNAENSSSPNETADKVSRQKKLMRYRKKLEEKSEEKSLQ 307 Query: 62 DLYGTWPLTRSPSVKFENQLAXXXXXXXXXXXXXXXRQLPKSETLQYQQISNSFVTPSAY 121 D YGTWP +R+P FENQL R L + YQ I N S Y Sbjct: 308 DFYGTWPSSRTPCGHFENQLEGFMVESSPSTAPKQKRLLQGPDPSPYQHIPNQCAAQSMY 367 Query: 122 GNLTNPYPAMPVLSHMQSGEFKHQSLSSCYNVSPGKAKHVNKSAAAPAKSLTMTPQEKIE 181 GNLTNP + V SH+Q G+FKHQ+L S VS G A +NKS AK LTM+PQEKIE Sbjct: 368 GNLTNP--STHVSSHIQPGKFKHQNLFSGCEVSSGNANAINKSVDTSAKPLTMSPQEKIE 425 Query: 182 KLRRRXXXXXXXXXXXXXXXFSHQVSKEH--SNPQNFQENKIQLVDGADLEVGDLSALPS 239 KLRRR FSHQ+S H S + QEN+IQ + ADLEV LS LPS Sbjct: 426 KLRRRQQLQAMLAIQKQQQQFSHQISSTHQSSTQKGPQENQIQYFERADLEVEGLSTLPS 485 Query: 240 FDPNSPVEQDDSNTSCLAVDNNPVADTILYRLQVVIAQLDLRIRLCIRDSLFRLAQSTMQ 299 DPNS VEQDDS+ A+D++ DTILYRLQ +I++LD++IRLCIRDSL+RLAQS M+ Sbjct: 486 LDPNSTVEQDDSSIVSAAIDDHSAEDTILYRLQYIISKLDIKIRLCIRDSLYRLAQSAMR 545 Query: 300 RHYASDTGSTNKRSRDEPEVVTEADSKPSSRYPRMPDAETETNPIDRAVAHLLFHRPLDL 359 RHYASDT S+NK S+ E EV E + +R+ ++PD ETETNPIDR VAHLLFHRPL+ Sbjct: 546 RHYASDTSSSNKSSKVEGEVFAE-EINNHNRFGKIPDLETETNPIDRTVAHLLFHRPLNS 604 Query: 360 PGKYLETPESPVSAKFSCEHATMSLASLPNSCIPKSSKITQNISQLGPNDPCSVPEPQLL 419 GK + ESP+S K SCEH T L +L N C P S K Q + G PEP + Sbjct: 605 SGKKSDASESPISTKLSCEHKTAGLVNLSNECFPDSLKNKQCFPRQGSESCRPFPEPSSV 664 Query: 420 DQFKTSPCMDTSENASYYGPTDSGAAEVEAS 450 D FKTSP + SENAS GP D G EVEAS Sbjct: 665 DPFKTSPLVGNSENASSTGPDDGGTMEVEAS 695 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68006 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62122 (52 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39937 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20899 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32833 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70351 (142 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13112 259 1e-71 >Contig13112 Length = 300 Score = 259 bits (662), Expect = 1e-71, Method: Compositional matrix adjust. Identities = 128/141 (90%), Positives = 131/141 (92%), Gaps = 1/141 (0%) Query: 1 MAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPN 60 MAPGALVG GLLDPV KLAS GCDNTVKVWK+YNGIWKMDCFPALQMHSDWVR VAWAPN Sbjct: 160 MAPGALVGSGLLDPVHKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHSDWVRDVAWAPN 219 Query: 61 LGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADA-N 119 LGLPKSTIASASQDGTVVIW AKEGEQWEG+VLKDFKTPVW VSWSLTGNLLAVAD N Sbjct: 220 LGLPKSTIASASQDGTVVIWIVAKEGEQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGDN 279 Query: 120 NVTLWKEAVDGEWQQVSVVEP 140 NVTLWKE+VDGEWQQVS VEP Sbjct: 280 NVTLWKESVDGEWQQVSTVEP 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86885 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10247 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226812304 118 1e-28 >226812304 Length = 86 Score = 118 bits (295), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 55/70 (78%), Positives = 63/70 (90%) Query: 129 AIQKSGFKIIFLLRLVPLLPFNILNYLLSVTPVHTGKYMLASWLGMMPSTFSLVYVGTTL 188 AI++SGFKI+ RLVPLLPFN+LNYLLSVTPV G+YMLASW+GMMP T +LVYVGTTL Sbjct: 2 AIRRSGFKIVLCFRLVPLLPFNMLNYLLSVTPVPIGQYMLASWIGMMPITLALVYVGTTL 61 Query: 189 KDLSDVTHGW 198 KD+SDVTHGW Sbjct: 62 KDISDVTHGW 71 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33374 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72575 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64538 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70098 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs162106182 (107 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 51237933 142 1e-36 >51237933 Length = 120 Score = 142 bits (358), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 67/103 (65%), Positives = 80/103 (77%) Query: 1 MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAE 60 MAL K + V+SN VVVFSKT C +C VK+L QLG TFK IELD+ DG ++Q+ALA+ Sbjct: 16 MALTKVKNIVNSNPVVVFSKTYCGYCKRVKQLLTQLGATFKVIELDEGIDGGEMQAALAQ 75 Query: 61 WTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVA 103 WTGQ TVP+VFIGGKH+GGCDS H G+LVPLLTEAGA+A Sbjct: 76 WTGQTTVPSVFIGGKHVGGCDSVLEKHNAGQLVPLLTEAGALA 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96823 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94206 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55503 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48074 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10241 196 3e-52 >Contig10241 Length = 311 Score = 196 bits (498), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 96/199 (48%), Positives = 125/199 (62%), Gaps = 2/199 (1%) Query: 51 ERIKDGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVR 110 E +K F+ FK KY +N Y LAKGQ+PK+MV +C+DSRVCPS +L FQPGEAF+VR Sbjct: 94 EDMKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCPSTILGFQPGEAFIVR 153 Query: 111 NVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFPFDGNNSTDF 170 N+AN+VP + LKV NI+V+GHS CGGI+ LMS D + F Sbjct: 154 NIANLVPSLESGPSETNAALEFSVN-SLKVENILVVGHSCCGGIRALMSMD-DEIEKSSF 211 Query: 171 IEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLAL 230 I++WV +G A+S F QC +CEKE++N SL NLLTYP++ E + LA+ Sbjct: 212 IQNWVVVGKDARSWTKAAASTLSFDQQCKHCEKESINRSLLNLLTYPWIEEKVKQGVLAV 271 Query: 231 KGGYYDFVNGSFELWGLDF 249 GGYYDFV +FE W LD+ Sbjct: 272 HGGYYDFVECTFEKWTLDY 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87925 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs31373 (293 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12065 80 3e-17 >Contig12065 Length = 328 Score = 80.5 bits (197), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 36/60 (60%), Positives = 47/60 (78%) Query: 84 RKMKVDWTPELHRRFVQAVEQLGVDKAVPSRILELMGIDCLTRHNIASHLQKYRSHRKHL 143 +K +V W+ ELH++FV AV QLG+DKAVP RILE+M + LTR N+ASHLQK+R + K L Sbjct: 5 KKPRVVWSVELHQQFVTAVNQLGLDKAVPKRILEMMNVPGLTRENVASHLQKFRLYLKRL 64 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86931 (92 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92287 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89042 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29916 (274 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87522 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46499 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17185 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4145 (74 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26447 (102 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104090 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6029 273 2e-75 >Contig6029 Length = 375 Score = 273 bits (697), Expect = 2e-75, Method: Compositional matrix adjust. Identities = 119/144 (82%), Positives = 132/144 (91%) Query: 76 RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY 135 RFKTLP E+LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPPRYRDSVRAITPGLPLFLY Sbjct: 226 RFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY 285 Query: 136 NYTTHQLHGIFEATGFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV 195 NY+THQLHGIFEA FGG+N DP+AWEDKKC GESRFPAQVR+ RK+C+ LEED+FRP+ Sbjct: 286 NYSTHQLHGIFEAASFGGTNFDPSAWEDKKCPGESRFPAQVRVFTRKVCEPLEEDSFRPI 345 Query: 196 LHHYDGPKFRLELSVPETLDLMDL 219 LHHYDGPKFRLELSVPE L L+D+ Sbjct: 346 LHHYDGPKFRLELSVPEALSLLDI 369 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22681 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18919 77 9e-17 >Contig18919 Length = 282 Score = 77.4 bits (189), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 45/132 (34%), Positives = 74/132 (56%), Gaps = 4/132 (3%) Query: 18 FDAEYAYTLRVNEKSDIYSFGVVLLELITGRPPIDPE-FGE--KDLVKWVCTTLDQKGLD 74 D EY + ++ +KSD+YSFGV+LLELI+G+ I E FG +++V+W ++ + Sbjct: 151 LDPEYYISQQLTDKSDVYSFGVILLELISGQEAISNENFGVNCRNIVQWAKLHIESGDIQ 210 Query: 75 NIIDSNLDSSYKDQ-ICRVLEISLLCTNALPLNRPSMRKVGKLLAEAPQRTSLRPSRKTA 133 IID +LD Y Q + ++ E +L+C A RPSM +V K + +A + + Sbjct: 211 GIIDPSLDGEYDIQSMWKIAEKALMCVQAHGFMRPSMSEVLKEIQDAISMERDAGAVREG 270 Query: 134 SSRLTTMKIHPI 145 +S ++ IH I Sbjct: 271 NSDISRNSIHSI 282 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72977 (297 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55088 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25814 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12246 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50257 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100144 (274 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49496 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58194 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10998 208 5e-56 >Contig10998 Length = 258 Score = 208 bits (529), Expect = 5e-56, Method: Compositional matrix adjust. Identities = 105/173 (60%), Positives = 120/173 (69%), Gaps = 7/173 (4%) Query: 1 MQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKKLFQMINDLPTIFEVVTGNAK-Q 59 MQEKDWLSLVAVHSD+WLLAVAFYFGARFGF K +RK+LF MIN+LPTIFEVVTG AK Q Sbjct: 85 MQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADRKRLFNMINELPTIFEVVTGTAKKQ 144 Query: 60 PKDQSANHNXXXXXXXXXXR------PAESQTKAVKMSPPPKXXXXXXXXXXXXXXQGAT 113 K++S+N N + P S+ K + + Sbjct: 145 VKEKSSNSNHGSNRSKSNSKRGSEPQPRHSKALQSKDAEEDEEEGVEDEEEDEDEHGETL 204 Query: 114 CGACGDNYGTDEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSCSSKRAR 166 CGACG+NY DEFWICCDICEKWFHGKCVKITPA+AEHIKQYKCPSCS+KRA+ Sbjct: 205 CGACGENYAADEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAK 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97309 (65 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12954 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15351 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68189 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93486 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29412 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4147 196 2e-52 >Contig4147 Length = 157 Score = 196 bits (499), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 1/123 (0%) Query: 15 LISGATSVKGSLHFVQGPNG-VTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNP 73 L++G ++V+GSLHF+Q NG TH++G+I+GL PGLHGFHIHALGDT+NGCNSTGPHFNP Sbjct: 9 LMTGDSNVRGSLHFLQASNGGPTHIQGRISGLSPGLHGFHIHALGDTSNGCNSTGPHFNP 68 Query: 74 LKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDL 133 LKK+HGAPSD ERH GDLGNIVAG DGVAEVS+ D +IPLSG +SILGRAVVVHADP+DL Sbjct: 69 LKKEHGAPSDKERHAGDLGNIVAGQDGVAEVSLQDWLIPLSGPNSILGRAVVVHADPNDL 128 Query: 134 GKG 136 GKG Sbjct: 129 GKG 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34148 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47788 (104 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41406 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95655 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55317 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6926 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21597 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80110 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91021444 275 4e-76 >91021444 Length = 184 Score = 275 bits (704), Expect = 4e-76, Method: Compositional matrix adjust. Identities = 136/211 (64%), Positives = 155/211 (73%), Gaps = 27/211 (12%) Query: 10 KNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIE 69 K V+ F +EE++AV LAKYTADLSAKF K D++E Sbjct: 1 KKVEKFQTEEEVAVRLAKYTADLSAKFVK---------------------------DTVE 33 Query: 70 WAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETC 129 W KWHVFW+DERVV KDH DSNYKLA+DG L +VPI G VYAINDALSAE AAEDYETC Sbjct: 34 WGKWHVFWLDERVVKKDHPDSNYKLAFDGLLCKVPIPPGQVYAINDALSAEAAAEDYETC 93 Query: 130 LKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKP 189 LKHL + N++ATS ATGFPKFDL+LLGMGPDGH+ASLFPGH L E +KWVT I DSPKP Sbjct: 94 LKHLVQRNVIATSKATGFPKFDLILLGMGPDGHLASLFPGHALCNEKKKWVTHIMDSPKP 153 Query: 190 PPERITFTFPVINSSAYIAMVVCGAGKSSAV 220 PP+RITFTFPVI+S+AY AMVV G + AV Sbjct: 154 PPQRITFTFPVISSAAYNAMVVTGHDTADAV 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57993 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72948 (143 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66175 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13504 365 e-103 >Contig13504 Length = 334 Score = 365 bits (938), Expect = e-103, Method: Compositional matrix adjust. Identities = 173/223 (77%), Positives = 191/223 (85%), Gaps = 16/223 (7%) Query: 29 MQGWRATMEDAHAAYPDLDSSTSFFGVYDGHGGKAVAKFCAKYLHQQVLKHEAYSAGDLV 88 MQGWRATMEDAHAAYPDLD+STSFFGVYDGHGGK VAKFCAKYLHQQVLK+EAY+AGD+ Sbjct: 1 MQGWRATMEDAHAAYPDLDASTSFFGVYDGHGGKVVAKFCAKYLHQQVLKNEAYAAGDIG 60 Query: 89 TSAQKAFLRMDEMMRGQRGWRELAILGDKMDKFSGMIEGFIWSPKGGEANDHFDDWTSEE 148 TS QKAF RMDEMMRGQRGWRELA+LGDK++KF+GMIEG IWSP+ ++ND DDW EE Sbjct: 61 TSVQKAFFRMDEMMRGQRGWRELAVLGDKINKFTGMIEGLIWSPRSSDSNDQADDWAFEE 120 Query: 149 YKQHGFLRYLINRLLIGPHSDFHGPTSGSTACVAIIRDKQLVVANAGDSRCVLSRKGQAL 208 GPHSDF GPTSG TACVAI+R+KQLVVANAGDSRCV+SRKGQA Sbjct: 121 ----------------GPHSDFTGPTSGCTACVAILRNKQLVVANAGDSRCVISRKGQAY 164 Query: 209 NLSKDHKPDLEVEKDRILKAGGFIQVGRVNGSLNLARAIGDVE 251 NLS+DHKPDLE+EK+RILKAGGFI GRVNGSLNLARAIGD+E Sbjct: 165 NLSRDHKPDLELEKERILKAGGFIHAGRVNGSLNLARAIGDME 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99788 (347 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10194 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10799 393 e-111 >Contig10799 Length = 252 Score = 393 bits (1009), Expect = e-111, Method: Compositional matrix adjust. Identities = 198/252 (78%), Positives = 212/252 (84%), Gaps = 1/252 (0%) Query: 1 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXX 60 MPIRNIAVG P E HPDALRAALAEFISTLIFVFAGEGSGMAF KLT + A TPS Sbjct: 1 MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA 60 Query: 61 XXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL 120 NISGGHVNPAVTFGAF+GGNISLLRG+LYWIAQLLG+TVAC L Sbjct: 61 AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL 120 Query: 121 LKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIG 180 LK VTNGQTT+AF+LS GVG WNA VFEIVMTFGLVYTVYATA+DPKKGS+GTIAPIAIG Sbjct: 121 LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIG 180 Query: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI- 239 FIVGANILAGGAFDGASMNPAVSFGPALVSWSW+NHWVYW GPLIG G+AG++YEF FI Sbjct: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYEFVFIG 240 Query: 240 NQSHEQLPTTEY 251 N HEQLP+T+Y Sbjct: 241 NSGHEQLPSTDY 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29551 (50 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84643 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8874 (386 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8633 547 e-158 >Contig8633 Length = 372 Score = 547 bits (1410), Expect = e-158, Method: Compositional matrix adjust. Identities = 262/335 (78%), Positives = 292/335 (87%) Query: 11 PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRXXXXXXXXXXXXXXXXXAGVKIK 70 PLGLLFF+SGLVVNLIQA+CF+ IRPLSKNTYR+INR AGVKI+ Sbjct: 11 PLGLLFFVSGLVVNLIQAICFILIRPLSKNTYRKINRVVAELLWLELVWLIDWWAGVKIQ 70 Query: 71 LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLSQRSGCLGSTLAVMKKSSKFLPVIGW 130 ++ D ET+RLMGKEHALV+ NH+SDIDWLVGWVL+QRSGCLGSTLAVMKKSSKFLPVIGW Sbjct: 71 VYTDPETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW 130 Query: 131 SMWFSEYLFLERNWVKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAAS 190 SMWFSEYLFLER+W KDE+TLK GLQRL+DYPQPFWLALFVEGTRFTQAKLLAAQEYAAS Sbjct: 131 SMWFSEYLFLERSWAKDENTLKLGLQRLKDYPQPFWLALFVEGTRFTQAKLLAAQEYAAS 190 Query: 191 TGLPIPRNVLIPRTKGFVSAVSHMRSFVPAIYDVTVAIPKSSPAPTMIRLFKGQSSVMHV 250 TGLP+PRNVLIPRTKGFVSAVSHMRSFVPAIYDVTVAIPK+SP+PTM+RLF+G+ SV+HV Sbjct: 191 TGLPVPRNVLIPRTKGFVSAVSHMRSFVPAIYDVTVAIPKASPSPTMLRLFQGRPSVVHV 250 Query: 251 HLKRHLMKELPETDDAVAQWCRDMFVAKDALLDKHNAEDTFSDQELQEIPRPKKSLLVVI 310 +KRHLMKELPETD+AVAQWC+D+FVAKDA LDKH A+ TF DQ LQ +P+KSLLVV Sbjct: 251 QIKRHLMKELPETDEAVAQWCKDIFVAKDAFLDKHTAKQTFGDQILQPTGQPRKSLLVVA 310 Query: 311 SWASLVIFGVLKFLQWSSLLSSWKGIAFSAFGLGI 345 SW+ L+I G LKFL SSLLSSWKGI FS GL I Sbjct: 311 SWSCLLILGALKFLYRSSLLSSWKGIGFSTLGLSI 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16666 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20776 415 e-118 >Contig20776 Length = 259 Score = 415 bits (1067), Expect = e-118, Method: Compositional matrix adjust. Identities = 208/258 (80%), Positives = 226/258 (87%), Gaps = 7/258 (2%) Query: 3 AATSGAVLNGLGSS-FINGGKKSQALLAGTNR------VTXXXXXXXXXXLPPKKSWIPA 55 AAT+GAVLNGL S+ F+ GGK+SQALL+ + KKSWIPA Sbjct: 2 AATTGAVLNGLNSAAFLCGGKRSQALLSAATVGSKVGGASPTPKRFIVVAAAAKKSWIPA 61 Query: 56 VKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQ 115 VKGGGN I+PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQ Sbjct: 62 VKGGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQ 121 Query: 116 TWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSR 175 WSGIPWFEAGADP AI+PFSFGSLLGTQLLLMGWVESKRWVDF+NPESQSVEWATPWS+ Sbjct: 122 AWSGIPWFEAGADPSAISPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSK 181 Query: 176 TAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAML 235 T+ENFAN+TGEQGYPGGKFFDPL AG+I+DGVY+PD+EKL+RLK+AEIKHARLAMVAML Sbjct: 182 TSENFANSTGEQGYPGGKFFDPLGFAGSIQDGVYVPDSEKLERLKLAEIKHARLAMVAML 241 Query: 236 IFYFEAGQGKTPLGALGL 253 IFYFEAGQGKTPLGALGL Sbjct: 242 IFYFEAGQGKTPLGALGL 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104321 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9846 (120 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74106183 (155 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20884 200 1e-53 >Contig20884 Length = 490 Score = 200 bits (508), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 96/140 (68%), Positives = 119/140 (85%), Gaps = 2/140 (1%) Query: 1 MENCMGNARALREGLEKTGRFEILSKDVGVPLVAFSLKDSSAHTVFEISEGLRKFGWIVP 60 MENCM N R L++GLEKTGRF+ILSKD+GVPLVAFSLKDSS HTVFE+++ LRKFGW VP Sbjct: 345 MENCMENTRMLKQGLEKTGRFKILSKDIGVPLVAFSLKDSSKHTVFEVADSLRKFGWTVP 404 Query: 61 AYTMPANAENVAVLRVVVREDFSRSLVERLISHIEEVLKEIDSLPSRVSTKTAHVTPMVN 120 AYTMPANAE+VAVLRVV+REDFSR L ERLIS I++V++E+D+LPS+VS+KTAHVT V+ Sbjct: 405 AYTMPANAEHVAVLRVVIREDFSRGLAERLISDIDKVMREVDTLPSQVSSKTAHVTATVD 464 Query: 121 ETQGDK--PLKKSVRETQEE 138 E D +K +V +++ E Sbjct: 465 EVVRDSEVAVKSTVHKSETE 484 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93799 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12672 100 1e-23 >Contig12672 Length = 318 Score = 100 bits (249), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 60/161 (37%), Positives = 93/161 (57%), Gaps = 7/161 (4%) Query: 1 MSKTLAEKAAWEFAEKNGTDVVAIHPATSLGPFPQPYVNASGAVLQRLLQGSKDTQEHYW 60 +SKT AE A E+A NG D+V + P +GP Q VNAS VL +LL+ ++ E+ Sbjct: 163 LSKTEAEYEALEYARINGLDLVTVCPTLIMGPILQSTVNASTLVLIKLLKEGYESLENKP 222 Query: 61 LGAVHVKDVAKAQVLLFETSAASGRYLCTNGIYQFAEFAEKVSKLFPE--YPIHRFKGET 118 V V+DVA+A ++++E A GRY+CT + + E++ ++P YP + + E Sbjct: 223 RMIVDVRDVAEAVIMVYEKPEAEGRYICTAHNIKTTDLVEELKSIYPNYSYPKNFVEVEE 282 Query: 119 QPGLVACENAAKRLISLGLDFTPVEETIREAVESLKAQGHL 159 QP L ++++L LGL F P++ET+ +VES K G L Sbjct: 283 QPRL-----SSEKLQRLGLSFRPLKETLTGSVESYKEAGLL 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96440 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30239 329 2e-92 >Contig30239 Length = 227 Score = 329 bits (844), Expect = 2e-92, Method: Compositional matrix adjust. Identities = 160/211 (75%), Positives = 184/211 (87%), Gaps = 2/211 (0%) Query: 2 LKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDF 61 LKLYSYW SSCS RVRI LNLKGL+YEYKA L KGEQFSP+F K+NP+GYVP LVDGD Sbjct: 19 LKLYSYWMSSCSFRVRIALNLKGLKYEYKA--LAKGEQFSPEFRKLNPMGYVPVLVDGDT 76 Query: 62 VVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAG 121 VV+DSFAI++YLEEKYPQ PLLP DL++KAINYQAANIVSSSIQPLQN+ V+KYIEEK Sbjct: 77 VVADSFAIILYLEEKYPQHPLLPPDLQKKAINYQAANIVSSSIQPLQNMTVLKYIEEKVR 136 Query: 122 ADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDMTQ 181 E+ W + HIGKGF ALE+LL ++AGKYATGDEV++ADL+LAPQLYAA+ RF LDMTQ Sbjct: 137 PVEKLEWVQFHIGKGFLALEELLNNHAGKYATGDEVYMADLFLAPQLYAAITRFQLDMTQ 196 Query: 182 FPLLLKLHEAYSKLPAFQNAAPEKQPDAPSS 212 FPLL +LHEAY+K+PAF +A PEKQPDAPSS Sbjct: 197 FPLLARLHEAYNKIPAFLDALPEKQPDAPSS 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91836 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23442 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53955 (290 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83716 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12428 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71303 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58152 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82150 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17769 264 9e-73 >Contig17769 Length = 297 Score = 264 bits (674), Expect = 9e-73, Method: Compositional matrix adjust. Identities = 128/167 (76%), Positives = 138/167 (82%), Gaps = 1/167 (0%) Query: 32 MEYEGRYRMAA-AKYDCLLFDLDDTLYPYSSGIAAACGQNIKDYMVEKLGIERSKIEDLG 90 ME++ R+ A K+DCLLFDLDDTLYPY SGIA AC NI+DYMVEKLGI+RS I +LG Sbjct: 1 MEFDDRFMQAQRTKFDCLLFDLDDTLYPYCSGIATACRINIEDYMVEKLGIDRSIIPELG 60 Query: 91 NLLYKNYGTTMAGLRAIGYDFDYDDYHSFVHGRLPYENLKPDPVXXXXXXXXXXXKIIFT 150 NLLYKNYGTTMAGLRAIGYDFDYD+YHSFVHGRLPYEN+KPDPV KIIFT Sbjct: 61 NLLYKNYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFT 120 Query: 151 NADKVHAVKVLSRLGLEDCFEGIICFETLNPTHKNNVSDDEDDIAFV 197 NADK+HA K LSRLGLED FEGIICFETLNP HKN VSDDEDDI FV Sbjct: 121 NADKIHAAKALSRLGLEDIFEGIICFETLNPIHKNTVSDDEDDIEFV 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48463 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91467 (63 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6386 77 4e-17 >Contig6386 Length = 57 Score = 77.4 bits (189), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 37/57 (64%), Positives = 39/57 (68%) Query: 6 MADEGTATCXXXXXXXXXXXXGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 62 MA EGT C GVFLKFGC EFWICLLLTIFGY+PGIIYA+Y ITK Sbjct: 1 MASEGTLNCVDILIAILLPPLGVFLKFGCHAEFWICLLLTIFGYLPGIIYAIYVITK 57 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49404 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69188 (430 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51345 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49303 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32065 (274 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61082 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99047 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37079 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59665 (426 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33406 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25963 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21624 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78727 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4299 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50930 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11667 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9457 462 e-132 >Contig9457 Length = 253 Score = 462 bits (1189), Expect = e-132, Method: Compositional matrix adjust. Identities = 223/253 (88%), Positives = 238/253 (94%), Gaps = 3/253 (1%) Query: 1 MATVTTQASAAVFRPCA-SKSRFLTGSSGKLNREVALKPVSS--SASFKVEAKKGEWLPG 57 MATVTTQASAA+FRPC SKSRFL+GSS KLNREVA +P++S ++SFKVEAKKGEWLPG Sbjct: 1 MATVTTQASAAIFRPCVNSKSRFLSGSSSKLNREVAFRPMASPPASSFKVEAKKGEWLPG 60 Query: 58 LASPTYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIG 117 L SP YL GSLPGDNGFDPL LAEDPENL+WY+QAELVN RWAMLGVVGMLLPEVFT IG Sbjct: 61 LPSPDYLTGSLPGDNGFDPLALAEDPENLRWYIQAELVNGRWAMLGVVGMLLPEVFTSIG 120 Query: 118 IINVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 177 I+NVP+WYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP Sbjct: 121 ILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 180 Query: 178 NEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISD 237 EVGYPGGIFNPLNF PT EAKEKELANGRLAMLAFLGF+VQHNVTGKGPF+NLLQH+SD Sbjct: 181 GEVGYPGGIFNPLNFEPTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSD 240 Query: 238 PWHNTIVQTLSGN 250 PWHNTIVQTLSG+ Sbjct: 241 PWHNTIVQTLSGS 253 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41729 (181 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8789 140 1e-35 >Contig8789 Length = 246 Score = 140 bits (354), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 67/90 (74%), Positives = 77/90 (85%), Gaps = 3/90 (3%) Query: 16 HSTANWCVCKDGVGDPV-LQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYF 74 S+ANWCVCKDG DP LQ+ALDYACGAGADCNPI NG CYNPNT+KAHCSYAVNSYF Sbjct: 17 QSSANWCVCKDG--DPTALQRALDYACGAGADCNPIKPNGVCYNPNTIKAHCSYAVNSYF 74 Query: 75 QRKGQAQGSCDFSGSATVATTDPSTAGCSY 104 Q+KGQ+ G+CDFSG+AT +DPS+ GC+Y Sbjct: 75 QKKGQSTGTCDFSGTATATASDPSSNGCTY 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1 (309 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59106187 (303 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16126 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87691 (293 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23118 454 e-130 >Contig23118 Length = 290 Score = 454 bits (1169), Expect = e-130, Method: Compositional matrix adjust. Identities = 227/276 (82%), Positives = 240/276 (86%), Gaps = 2/276 (0%) Query: 18 EMLGNPLNVSSAVRTSAPGASNPSTFKPVALFXXXXXXXXXXXXXXXXXXXNEELAKWYG 77 E+LGN L S SAP A+ P+TFK VALF +EELAKWYG Sbjct: 17 EVLGNSLGNFSRTARSAPSATTPATFKTVALFSKKKAAPPPKAKAVAPA--DEELAKWYG 74 Query: 78 PDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLG 137 PDRRIFLP GLLDRSEIPEYLTGEVPGDYGYDPFGL KKP+DFSKYQAYELIHARWAMLG Sbjct: 75 PDRRIFLPSGLLDRSEIPEYLTGEVPGDYGYDPFGLGKKPEDFSKYQAYELIHARWAMLG 134 Query: 138 AAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVGG 197 AAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL+FAV+AE+VL+GG Sbjct: 135 AAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIFAVVAEVVLLGG 194 Query: 198 AEYYRITNGLDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAY 257 AEYYRITNGL+LEDKLHPGGPFDPLGLAKDPDQ ALLKVKEIKNGRLAMF+MLGFFLQAY Sbjct: 195 AEYYRITNGLELEDKLHPGGPFDPLGLAKDPDQAALLKVKEIKNGRLAMFSMLGFFLQAY 254 Query: 258 VTGEGPVENLAKHLSDPFANNLLTVISGNAERAPTL 293 VTGEGPVENL+KHLSDPF NNLLTVI G+ ERAPTL Sbjct: 255 VTGEGPVENLSKHLSDPFGNNLLTVIGGSIERAPTL 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88578 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23118 86 1e-19 >Contig23118 Length = 290 Score = 86.3 bits (212), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 48/83 (57%), Positives = 52/83 (62%), Gaps = 2/83 (2%) Query: 18 EMLGNPLNVSSAVRTSAPGASNPSTFKPVALFXXXXXXXXXXXXXXXXXXXNEELAKWYG 77 E+LGN L S SAP A+ P+TFK VALF +EELAKWYG Sbjct: 17 EVLGNSLGNFSRTARSAPSATTPATFKTVALFSKKKAAPPPKAKAVAPA--DEELAKWYG 74 Query: 78 PDRRIFLPEGLLDRSEIPEYLTG 100 PDRRIFLP GLLDRSEIPEYLTG Sbjct: 75 PDRRIFLPSGLLDRSEIPEYLTG 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98572 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs106118 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54569 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13761 (473 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32826 127 3e-31 >Contig32826 Length = 455 Score = 127 bits (320), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 96/325 (29%), Positives = 158/325 (48%), Gaps = 33/325 (10%) Query: 155 LYTDIIRDKIGTQSQNQDQQLIHFIPGMNKIRVADLPEGVVSGDLDS---VFSVMVHQMG 211 ++ II + GT ++Q+ +L P K++ A+L LD+ +F ++V Sbjct: 152 IHEGIIDNDDGTPLKSQEIELAKNQP---KMKTANLLWTCFH-TLDTQKIIFQLLVR--N 205 Query: 212 RQLPKAAAVFI-NSFEELDPELTNHLKTKFNKKFLSVGPFKLLLASDQQPSSATDLDDKY 270 + KAA + NS +L+P + L +GP LL +S + S Sbjct: 206 NKYAKAADWLVCNSAYDLEPA-----AFTLAPEILPIGP--LLASSRLENSQGNFWPQDS 258 Query: 271 GCLAWLDKQKKKPASVAYVGFGTVATPSPNEIAAIAEDQPGPSLEASKVPFIWSLRHRSQ 330 CL WLD+QK P SV YV FG++ + +A +LE S PF+W +R + Sbjct: 259 TCLDWLDQQK--PRSVIYVAFGSLTVFDQTQFQELA-----LALELSGRPFLWVVRPDTT 311 Query: 331 AN----LPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIG 386 P G+ ER S G++V WA Q VL+H ++ F++HCGW S LE +++G+P + Sbjct: 312 DGASDPYPEGYQERVGSRGLMVGWAPQQKVLSHPSIACFISHCGWNSTLEGLSSGLPFLC 371 Query: 387 RPFFGDQRINGRMMEQIWGVGIAVDGG--GICTKEGLLSSLDLILCQEKGIKIREKVTKL 444 P+F DQ +N + IW VG+ D GI T+ + + ++ +L E + +KL Sbjct: 372 WPYFADQLLNESYICDIWKVGLRFDKNESGIITEGEIKTKVEQLLSDE---NFTARASKL 428 Query: 445 KQLCQNAIGPGGSSMQNLDALVDMI 469 K++ N I GG S + ++ + Sbjct: 429 KEVAMNNIKEGGQSYETFKNFIEWM 453 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95618 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56347 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16121 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48016 (254 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10854 301 7e-84 >Contig10854 Length = 286 Score = 301 bits (771), Expect = 7e-84, Method: Compositional matrix adjust. Identities = 152/224 (67%), Positives = 165/224 (73%), Gaps = 8/224 (3%) Query: 1 MKLRSQALRLSSPLTSDFHGHGVVFQENKAIPKRGSSSKFSISA----QTGLRIGKAQRW 56 KL LS SDFHG + FQ A RG+S + SA Q+G RIGKA +W Sbjct: 44 FKLNPDISSLSLSTKSDFHGKRIAFQ---ATGIRGNSQSHASSAVYSQQSGFRIGKAAKW 100 Query: 57 WEKGLQPNMREVASAQDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQ 116 WEKG QPNM+EV+SA+DLVESL +AGDKLV+VDFFSPGCGGCKALHPKICQLAEMNPDVQ Sbjct: 101 WEKGNQPNMKEVSSAEDLVESLSNAGDKLVIVDFFSPGCGGCKALHPKICQLAEMNPDVQ 160 Query: 117 FLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFKDALAKHTPDRCG 176 FLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKF+DALAKH P+RC Sbjct: 161 FLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFRDALAKHKPERCS 220 Query: 177 LGPTXXXXXXXXXXXXXXXXXSFNYTPKPQPMPAPAVEEVGLAE 220 LGPT SF YTPKP PA EEV +AE Sbjct: 221 LGPTKGLEEKELLALAANKDLSFTYTPKPTE-DVPAKEEVIVAE 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs31770 (397 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs810 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16690 111 1e-26 >Contig16690 Length = 243 Score = 111 bits (277), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 75/239 (31%), Positives = 114/239 (47%), Gaps = 27/239 (11%) Query: 2 GGHTRDIVVKATALILILTGSESTYLGIIWTLSLLLNHPKELKKAQEELDVHVGRDRWVN 61 G D ++ + +++ G E+T + W + L +P ++KKAQEE+D +G+D Sbjct: 3 GTDVDDRQLRDDLMTMLIAGHETTAAVLTWAVFFLAQNPSKMKKAQEEIDSVLGQDGPTY 62 Query: 62 ESDMKNLKYLRAIVKETLRIYPPGPVTGIREAMEDCEIGGYH-------VPKGTRLIVNI 114 ES +K L+Y R I E+LR++P P+ R D GGY+ VP GT L +++ Sbjct: 63 ES-IKKLEYTRLIAVESLRLFPQPPLLIRRSLKPDKLPGGYNGAKDGYAVPAGTDLFISV 121 Query: 115 WKLHRDPRMWENPCEFRPERFLTTH-------ADVDVNTQ-----------HFEYIPFSF 156 + LHR P W+NP EF PERFL A D + F ++PF Sbjct: 122 YNLHRSPYFWDNPNEFEPERFLVEKKSHVEGWAGFDPSRSPGALYPNEIIADFAFLPFGG 181 Query: 157 GRRSCPGMTSGLQIVQLTLARILQGFDLATVGGTPVGMQIGLGLALPKSNPLEVIIKPR 215 G R C G L + LA +LQ F + + G+P ++ G L N L ++ R Sbjct: 182 GPRKCVGDQFALMESTVALAMLLQKFTV-ELKGSPDSVEQVTGATLHTKNGLWCKLQKR 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15066 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88301 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83058 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74790 (135 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226786909 127 6e-32 >226786909 Length = 132 Score = 127 bits (320), Expect = 6e-32, Method: Compositional matrix adjust. Identities = 69/121 (57%), Positives = 77/121 (63%), Gaps = 3/121 (2%) Query: 1 MAAITASVGTSSITPSVLVHKPSIVASSSPVLGLPAKAVKGKVRCSMEEKPSKQESKTNV 60 MA ITAS SS+ + LVHKPS A SS VL LP+ A KG+V CSME K+ES +N+ Sbjct: 1 MATITASTAASSVVRASLVHKPSAGAPSSTVLALPSLARKGRVSCSME---GKKESNSNM 57 Query: 61 GXXXXXXXXXXXXXXXXXXXXLVDDRMSTEGTGLPFGLSNNLLGWILLGVFGLIWALYIP 120 LVDDR+STEGTGLPFGLSNNLLGWIL GVFGLIWALY Sbjct: 58 AKGGSLAAAAMAATMSSPAMALVDDRLSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFI 117 Query: 121 Y 121 Y Sbjct: 118 Y 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58068 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5936 198 6e-53 >Contig5936 Length = 173 Score = 198 bits (503), Expect = 6e-53, Method: Compositional matrix adjust. Identities = 108/191 (56%), Positives = 127/191 (66%), Gaps = 35/191 (18%) Query: 11 HLKATELRLGLPGS-DKPSVR--------ANNNKRAXXXXXXXXXXXXCAFNAGDDDERD 61 + KATELRLGLPGS ++P + A NNKRA C+ ++ D Sbjct: 6 NFKATELRLGLPGSSEEPENKKAAPSPPMAKNNKRASPDSAAEE----CSTSSDPID--- 58 Query: 62 SAPPAKAQVVGWPPIRSYRKNTLQVQAKTSESELCRGMYVKVSMDGAPYLRKIDLKVYTC 121 PP K QVVGWPPIRSYRKN+LQ+ R YVKVS+DGAPYLRKIDLKVY Sbjct: 59 -VPPTKTQVVGWPPIRSYRKNSLQL----------REAYVKVSVDGAPYLRKIDLKVYNS 107 Query: 122 YPELLNALENMFQLTIGKYSEREGYNGSDYAPTYEDKDGDWMLVGDVPWDMFITTCKRLR 181 YPEL+ ALE MF L NGSD+APTYEDKDGDWMLVGDVPW+MF+++CKRLR Sbjct: 108 YPELIKALEKMFNLA--------NINGSDFAPTYEDKDGDWMLVGDVPWNMFVSSCKRLR 159 Query: 182 IMRGSEAKGLA 192 IM+GSEA+GL+ Sbjct: 160 IMKGSEARGLS 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99128 (302 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41318 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96617 (103 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77665 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104312 (223 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs124106186 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73386 (634 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1996 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82956 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41088 (299 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12866 272 6e-75 >Contig12866 Length = 268 Score = 272 bits (695), Expect = 6e-75, Method: Compositional matrix adjust. Identities = 136/188 (72%), Positives = 149/188 (79%) Query: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEEARDAED 60 MSSR+SRT+YVGNLPGDIR REVEDLF KYGPI IDLKIPPRPPGYAFVE+E+ RDA+D Sbjct: 1 MSSRSSRTIYVGNLPGDIRMREVEDLFLKYGPIVDIDLKIPPRPPGYAFVEYEDPRDADD 60 Query: 61 AIRGRDGYDFDGHRLRVELAXXXXXXXXXXXXXXXXXXXXXXXXXXXEYRVLVTGLPSSA 120 AI GRDGYDFDG RLRVELA +YRVLVTGLP +A Sbjct: 61 AIYGRDGYDFDGFRLRVELAHGGRHSSSHRSSSYSRSSSSRGASRRSDYRVLVTGLPPAA 120 Query: 121 SWQDLKDHMRRAGDVCFSQVFRDGSGTTGIVDYTNYDDMKHAIKKLDDSEFRNAFSRAYV 180 SWQDLKDHMRRAGDVCFSQVFRD G TGIVDYTNY+DMK+AI+KLDDSEFRNAF+R+Y+ Sbjct: 121 SWQDLKDHMRRAGDVCFSQVFRDRGGMTGIVDYTNYEDMKYAIRKLDDSEFRNAFARSYI 180 Query: 181 RVREYDHR 188 RVREYD R Sbjct: 181 RVREYDSR 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45089 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16961 (301 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12231 (62 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs106107 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93559 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11290 412 e-117 >Contig11290 Length = 316 Score = 412 bits (1060), Expect = e-117, Method: Compositional matrix adjust. Identities = 183/300 (61%), Positives = 235/300 (78%), Gaps = 1/300 (0%) Query: 1 IAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLRGYGDTEAPSSISSYSCH 60 +A G GP VLFLHGFPELWY+WR Q+L+LSSLGYR IAPDLRG+GDT+AP S +SY+ Sbjct: 18 VASIGAGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLRGFGDTDAPPSPTSYTAM 77 Query: 61 HIVGDLVALINSLGVEQVFVVAHDWGAIIAWYLCLFCPERVKAFVCLSVPFLPRNPNIKP 120 HIVGDL+ L++ LG++QVF+VAHDWGA+IAW+ CLF P+RVKA V +S+ F PRNP KP Sbjct: 78 HIVGDLIGLLDHLGIDQVFLVAHDWGAVIAWWFCLFRPDRVKALVNMSIAFSPRNPKRKP 137 Query: 121 VESMRALFGDDYYICRFQEPGKIEAQIAQVGTAEVLKNILANRKPGPSCFPEENAFGIDP 180 V+ RALFGDDYYICRFQEP +IE +GTA V+K L +R P P C P++ Sbjct: 138 VDGFRALFGDDYYICRFQEPEEIERDFDSIGTAAVMKRFLTSRSPKPPCIPKDQGLK-SW 196 Query: 181 ENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWEMTAAWTEVQVKVPVKFIV 240 VTLP+W +E+DL++ +KF+++GFTG LNYYRA+NL WE+T WT +Q+KVPVKFIV Sbjct: 197 AAPVTLPAWLTEEDLNYIVSKFSKSGFTGGLNYYRALNLTWELTGPWTGLQIKVPVKFIV 256 Query: 241 GELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFINQERAEEINAHIYDFIKKF 300 GELD+ Y PG++ Y+H GGFK+DVP L+E+VV+E A HFI QE+ +E++ H+YDFIKKF Sbjct: 257 GELDVTYNIPGVQAYIHKGGFKRDVPFLQEVVVMEGAAHFIAQEKPDEVSQHVYDFIKKF 316 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93079 (56 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82881 (287 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32826 291 1e-80 >Contig32826 Length = 455 Score = 291 bits (744), Expect = 1e-80, Method: Compositional matrix adjust. Identities = 146/286 (51%), Positives = 192/286 (67%), Gaps = 1/286 (0%) Query: 1 MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQI 60 MS+ H++ +P PAQGHV+PL+E SQCL HGF+VTFVNT++ HKR+V +L G+ ++ ++I Sbjct: 1 MSNLHIIAVPFPAQGHVLPLMELSQCLVNHGFKVTFVNTEFNHKRIVNALAGETHVGDRI 60 Query: 61 RLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWS 120 LVS+PDG+EP EDRND G L E +VMPGKLE+LIE+IN E EK+ C +AD N GW+ Sbjct: 61 HLVSLPDGLEPKEDRNDLGLLCEGIQRVMPGKLEELIEKINEEESEKVACVLADENSGWA 120 Query: 121 LEVAKKMNVRGAVFWSSSAALVALVFCIPKLIDDGIIDS-HGTPMSMQMFRIAPKMPEMN 179 L+VA KM +R FW +SAA +AL IPKLI +GIID+ GTP+ Q +A P+M Sbjct: 121 LDVAAKMKIRRVAFWPASAAALALSLNIPKLIHEGIIDNDDGTPLKSQEIELAKNQPKMK 180 Query: 180 SRDCFWAHIGDLTTQKIFFDLLERNRRAMMAVNFHFCNSTYELESEAFTMFPELLPIGPL 239 + + W L TQKI F LL RN + A ++ CNS Y+LE AFT+ PE+LPIGPL Sbjct: 181 TANLLWTCFHTLDTQKIIFQLLVRNNKYAKAADWLVCNSAYDLEPAAFTLAPEILPIGPL 240 Query: 240 IASNRQGNSAGYFWREDSNCLKWAKPTATQLCHLCCFCSLTFLTQS 285 +AS+R NS G FW +DS CL W + F SLT Q+ Sbjct: 241 LASSRLENSQGNFWPQDSTCLDWLDQQKPRSVIYVAFGSLTVFDQT 286 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41998 (349 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32826 414 e-118 >Contig32826 Length = 455 Score = 414 bits (1065), Expect = e-118, Method: Compositional matrix adjust. Identities = 196/345 (56%), Positives = 260/345 (75%), Gaps = 1/345 (0%) Query: 1 MNRPHVLVLPIPAQGHVIPLLEFSQCLAKQGFRVTFVNTDYDHKRIMESLEGKNDLGEQI 60 M+ H++ +P PAQGHV+PL+E SQCL GF+VTFVNT+++HKRI+ +L G+ +G++I Sbjct: 1 MSNLHIIAVPFPAQGHVLPLMELSQCLVNHGFKVTFVNTEFNHKRIVNALAGETHVGDRI 60 Query: 61 RLVSIPDGMEPWEDRNDFGKLFEKVLQVMPGKLEELIEDINSREDEKLDCFIADGYMAWS 120 LVS+PDG+EP EDRND G L E + +VMPGKLEELIE IN E EK+ C +AD W+ Sbjct: 61 HLVSLPDGLEPKEDRNDLGLLCEGIQRVMPGKLEELIEKINEEESEKVACVLADENSGWA 120 Query: 121 MEVAKKMNVRGALFWPSSAASVALLFHIPKLIDDGIIDSN-GTPMSKQMFRIAPNMPEMN 179 ++VA KM +R FWP+SAA++AL +IPKLI +GIID++ GTP+ Q +A N P+M Sbjct: 121 LDVAAKMKIRRVAFWPASAAALALSLNIPKLIHEGIIDNDDGTPLKSQEIELAKNQPKMK 180 Query: 180 SGDCFWTNIGDLNTQKIIFDLLDRNMRAMRAVNFQLCHSTYELESEAFTVVPELLPIGPL 239 + + WT L+TQKIIF LL RN + +A ++ +C+S Y+LE AFT+ PE+LPIGPL Sbjct: 181 TANLLWTCFHTLDTQKIIFQLLVRNNKYAKAADWLVCNSAYDLEPAAFTLAPEILPIGPL 240 Query: 240 LAGNRLGNSAGHFWREDSSCLEWLDQQQPSSVLYAPFGNLTILDQVHFQELAFGLKLCNR 299 LA +RL NS G+FW +DS+CL+WLDQQ+P SV+Y FG+LT+ DQ FQELA L+L R Sbjct: 241 LASSRLENSQGNFWPQDSTCLDWLDQQKPRSVIYVAFGSLTVFDQTQFQELALALELSGR 300 Query: 300 PFLWVVRPDITTDANDRYPDGFQERVSARGRMIGWAPQQKGLTHP 344 PFLWVVRPD T A+D YP+G+QERV +RG M+GWAPQQK L+HP Sbjct: 301 PFLWVVRPDTTDGASDPYPEGYQERVGSRGLMVGWAPQQKVLSHP 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69971 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20751 88 9e-20 >Contig20751 Length = 177 Score = 87.8 bits (216), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 76/194 (39%), Positives = 97/194 (50%), Gaps = 38/194 (19%) Query: 1 MQRQSLG-SPVSKLHIHXXXXXXXSSKEDLRLTELHPXXXXXXXAT-------------S 46 MQRQSLG SP SKLH D LT + + Sbjct: 1 MQRQSLGGSPASKLH------QTHGGPNDQTLTVVDSPNRNKDLSVFSTTASTSSSSSSI 54 Query: 47 PTVYNDDDESKTTKPRRFXXXXXXXXXXXXXXTHSRPEKLIHLIPLLTLFCFLVLYFSSH 106 Y DD++ K +KP R P K IH+IP+LTL CFL+L+ SH Sbjct: 55 SAAYQDDEDHKASKPHRLSSPPPIA-----------PHKSIHVIPVLTLLCFLILFLFSH 103 Query: 107 SPSPSDLAQFHAFQR-PSNRR----DSGEIDDVNRFIELRRGDFLAIRSLRNIQEIEKQS 161 PS SDLAQF+ F + P + + EIDD+ RFI++R+ D LAIRSLRN+Q+ + Q Sbjct: 104 IPSQSDLAQFNGFTKLPGSAKRVVSADSEIDDIGRFIDIRKSDVLAIRSLRNLQDTQTQK 163 Query: 162 --PKFRPHRKIADF 173 P+ R HRKIADF Sbjct: 164 LVPRSRSHRKIADF 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52106181 (312 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25947 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6152 116 4e-28 >Contig6152 Length = 382 Score = 116 bits (290), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 74/237 (31%), Positives = 111/237 (46%), Gaps = 15/237 (6%) Query: 25 PAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYVLRDXXXXXXXXXXXTHFN-------TWF 77 P + PPF +GE++ AIP HC+ ++ RS SYV D + + ++ Sbjct: 25 PYSKPPFSLGEVKKAIPPHCFQRSVIRSFSYVFYDLTIASILYYIASTYIQNLSQPLSFL 84 Query: 78 FWPLYWVAQGTMFWAIFVLGHDCGHGSFSESPLLNSFVGHILHSSILVPYNGWRISHRTH 137 WP++W QG + ++V+ H+CGH +FS+ L+ VG ILHS +LVPY W+ SHR H Sbjct: 85 AWPIFWYVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRH 144 Query: 138 HQNHGNVEHDESWVPMPE-------KIYSKLDSSTRILRFSXXXXXXXXXXXXWYRSPGK 190 H N G++E DE +VP + K + L P K Sbjct: 145 HSNTGSLERDEVFVPKQKFEIGWHAKYLNNPPGRFLTLLIQLTLGWPLYLAFNVSGRPYK 204 Query: 191 D-GSHFNPYSSLFSPGERKAVVISTACWTFMFGLLVYLSFVFGPITMFKLYGVPYLV 246 HF+PY ++S ER + +S A +F L L+ G + YG P +V Sbjct: 205 GFACHFHPYGPIYSDRERLQIFVSDAGVLAVFYGLYRLAVAKGLAWVICFYGGPLMV 261 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91748 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40106185 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27589 75 8e-16 >Contig27589 Length = 543 Score = 74.7 bits (182), Expect = 8e-16, Method: Compositional matrix adjust. Identities = 28/43 (65%), Positives = 35/43 (81%) Query: 1 MIGPADFEKSVDYWQQDKWSGQFPVKWHTIKDVPNSQFRHIVL 43 M+GP DF K+++YWQQDKW+G PVKWH +KDVPNS +HI L Sbjct: 501 MLGPVDFNKNLEYWQQDKWNGCSPVKWHIVKDVPNSLLKHITL 543 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs153106186 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs153106187 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41343 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 51912285 192 3e-51 >51912285 Length = 154 Score = 192 bits (487), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 96/150 (64%), Positives = 112/150 (74%) Query: 12 LDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQDDESRNLLWSDTGSPLIPLEEFRDQE 71 +DFSK SK AL+WAI NL +KGDTLYIIHIK ESR+ LW+ +GSPLIPL EFR+ + Sbjct: 1 MDFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLTEFREPQ 60 Query: 72 VMKQYEXXXXXXXXXXXXAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGL 131 +MK Y S+QK V VV KLYWGDAR+KL +AVE +KLDSLVMGSRGL Sbjct: 61 IMKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGL 120 Query: 132 GTIQRVLLGSVSNHVLANASCPVTIVKDPS 161 TI+R++LGSVSN VL NAS PVTIVKDPS Sbjct: 121 STIKRIVLGSVSNFVLTNASIPVTIVKDPS 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58462 (290 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17769 352 5e-99 >Contig17769 Length = 297 Score = 352 bits (902), Expect = 5e-99, Method: Compositional matrix adjust. Identities = 170/299 (56%), Positives = 221/299 (73%), Gaps = 11/299 (3%) Query: 1 MEYKNENKQVSNQKYDCLLFDLDDTIYPLTSGLSKEVTKNIQEYMLQKLCIEEAKVPELC 60 ME+ + Q K+DCLLFDLDDT+YP SG++ NI++YM++KL I+ + +PEL Sbjct: 1 MEFDDRFMQAQRTKFDCLLFDLDDTLYPYCSGIATACRINIEDYMVEKLGIDRSIIPELG 60 Query: 61 VSLYKFYGTTLAGLRAIGYQFDCDDFHSYVHGRLPYMMLKPDPVLRNLLLSLPIRKVIFT 120 LYK YGTT+AGLRAIGY FD D++HS+VHGRLPY +KPDPVLR+LLL+LP RK+IFT Sbjct: 61 NLLYKNYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFT 120 Query: 121 NADKTHAARVLSRLGLEDCFERIISFETLNSTDKGTVLVDQDASE---------SERPTE 171 NADK HAA+ LSRLGLED FE II FETLN K TV D+D E + ++ Sbjct: 121 NADKIHAAKALSRLGLEDIFEGIICFETLNPIHKNTVSDDEDDIEFVGLSSTTTTTSSSQ 180 Query: 172 LFDIDDYCSRPNADLELPRTPVVCKPFEEAFEQVFKIANINPRKTIFFDDSIRNLETGKR 231 +FDI + + PN +LP+TP+VCKP E+A E+ KIANINP++T+FF+DS+RN++ GKR Sbjct: 181 IFDIIGHFATPNPTSKLPKTPIVCKPSEDAIERALKIANINPQRTLFFEDSVRNIQAGKR 240 Query: 232 LGLHTVWVGTSHRAEGVDYALESIHNIKEALPELWEVAGENSESISYSGKVSIETSVIA 290 +GL TV VGTS R +G DYALESIHN++EA+PELWE + + YSGK+++ETSV A Sbjct: 241 VGLQTVLVGTSQRVKGADYALESIHNLREAIPELWE--ADRKSKVGYSGKIAVETSVTA 297 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104404 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104928 (72 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs183106187 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18919 126 5e-31 >Contig18919 Length = 282 Score = 126 bits (316), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 73/233 (31%), Positives = 128/233 (54%), Gaps = 20/233 (8%) Query: 2 VLSKLQHPHLVTLLGACPEAWS--LVYEYLPNGSLQDRLFRK-SNVSPLLWKDRARIAAE 58 +LS++ H +LV LG C E L+YE++ NG+L++ L+ ++ + W R IA + Sbjct: 29 LLSRIHHRNLVQFLGYCQEDGRSMLIYEFMHNGTLKEHLYGPLTHEQSINWIKRLEIAED 88 Query: 59 IASGLCFLHSSKPEKIVHGDLKPQNILLDSELSSKICDFGICRLVTEDTLYLPSFHRSTA 118 A G+ +LH+ I+H DLK NIL+D + +K+ DFG+ +L + + H S+ Sbjct: 89 AAKGIEYLHTGCVPAIIHRDLKSSNILIDKHMRAKVSDFGLSKLAVD-----GASHVSSI 143 Query: 119 PKGSFPYADPEYHRTGVLTPKSDSYSFGLIILQLLTGRLPV----------GLAGEVRRA 168 +G+ Y DPEY+ + LT KSD YSFG+I+L+L++G+ + + + Sbjct: 144 VRGTVGYLDPEYYISQQLTDKSDVYSFGVILLELISGQEAISNENFGVNCRNIVQWAKLH 203 Query: 169 VSCGKLSSILDP-LAGDWPTFVARRLVDLGLQCCELYGRERPDITPSLVKELE 220 + G + I+DP L G++ ++ + L C + +G RP ++ L KE++ Sbjct: 204 IESGDIQGIIDPSLDGEYDIQSMWKIAEKALMCVQAHGFMRPSMSEVL-KEIQ 255 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23635 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24312 150 2e-38 >Contig24312 Length = 482 Score = 150 bits (380), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 83/216 (38%), Positives = 117/216 (54%), Gaps = 7/216 (3%) Query: 24 ITTLPGFDGDLPFKLETGYIGVGQNDDVQLFYYFIESERSPEDDPLVLWLTGGPGCSGFS 83 + LPG +L F +GY+ V ++ LFY+F+E+ P P+VLWL GGPGCS + Sbjct: 41 VADLPGQSFNLSFAHFSGYVPVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIA 100 Query: 84 -GLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKVANIIFLDAPVGTGFSYANTWQGYIMN 142 G+ EIGP + + + LNPYSW +VAN++F D+PVG GFSY+NT + N Sbjct: 101 YGMAEEIGPFHIEADGKTL-----YLNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSN 155 Query: 143 -DTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDSYSGIIVPMIVQHISDGIDVGHRPRMN 201 D +A + FL +W P + YI G+SY G VP + Q I +N Sbjct: 156 GDKRTANDSLTFLLQWFERFPQYKGRDFYITGESYGGHYVPQLSQAIVKYNLKTKEKTVN 215 Query: 202 LKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYE 237 LKGY++GN LTD + V F + LIS + Y+ Sbjct: 216 LKGYMVGNALTDDYHDHLGVFQFMWSAGLISDQTYK 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79752 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53949 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32826 151 1e-38 >Contig32826 Length = 455 Score = 151 bits (381), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 73/204 (35%), Positives = 121/204 (59%), Gaps = 7/204 (3%) Query: 32 WKPEDRCLEWLNKQSNSSVVYISFGSLAQLSANQMEVIATALKNIKLPFLWIVKQSESAS 91 W + CL+WL++Q SV+Y++FGSL Q + +A AL+ PFLW+V+ + Sbjct: 254 WPQDSTCLDWLDQQKPRSVIYVAFGSLTVFDQTQFQELALALELSGRPFLWVVRPD---T 310 Query: 92 SDGEGT-LPLWFLEETKNRGLVVSWCPQTKVLAHPALACFVTHCGWSSLLETIVAGVPVI 150 +DG P + E +RGL+V W PQ KVL+HP++ACF++HCGW+S LE + +G+P + Sbjct: 311 TDGASDPYPEGYQERVGSRGLMVGWAPQQKVLSHPSIACFISHCGWNSTLEGLSSGLPFL 370 Query: 151 AYPQWSDQPTNAKLVADVFKIGLRLRPSEDGFVGNEELEKCVEEIINGPKSEYYKKNAVE 210 +P ++DQ N + D++K+GLR +E G + E++ VE++++ E + A + Sbjct: 371 CWPYFADQLLNESYICDIWKVGLRFDKNESGIITEGEIKTKVEQLLS---DENFTARASK 427 Query: 211 LKHAARQAVAGGGSSDQNIQLFAD 234 LK A + GG S + + F + Sbjct: 428 LKEVAMNNIKEGGQSYETFKNFIE 451 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38466 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38962 (274 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48626 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98310 (347 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98309 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70312 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8738 156 3e-40 >Contig8738 Length = 259 Score = 156 bits (395), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 72/124 (58%), Positives = 88/124 (70%), Gaps = 13/124 (10%) Query: 129 VSWVPSSLEHKKQQPLTWYKAYFDAPEGDEPLAMDMSSMNKGQVLINGQNIGRYWT---- 184 V W+ S + +Q L WYKAYF+AP G+EPLA+DM M KGQV INGQ+IGRYW Sbjct: 12 VGWIRRSQATQTKQTLKWYKAYFNAPGGNEPLALDMRRMGKGQVWINGQSIGRYWMAYAK 71 Query: 185 ---------GTYRPTNCGFDCGKPSQQWYHVPRSWLKPRQNLLIVFEEISGDASKISLVK 235 GT+RPT C CG+P+Q+WYHVPRSWLKP QNL++VFEE+ GD SKI+LV+ Sbjct: 72 GDCSSCSYIGTFRPTKCQLHCGRPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVR 131 Query: 236 RLVT 239 R VT Sbjct: 132 RSVT 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102609 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103630 (345 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17317 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93976 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76267 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37597 (375 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98427 (298 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64062 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34732 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226786909 88 6e-20 >226786909 Length = 132 Score = 87.8 bits (216), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 52/126 (41%), Positives = 68/126 (53%), Gaps = 9/126 (7%) Query: 1 MASISSTNFPALLPRSGFV--PKGLTHASPVYGMPAMATTRGRVRCSLEEXXXXXXXXXX 58 MA+I+++ + + R+ V P +S V +P++A +GRV CS+E Sbjct: 1 MATITASTAASSVVRASLVHKPSAGAPSSTVLALPSLAR-KGRVSCSME------GKKES 53 Query: 59 XXXXXXXXXXXXXXXXXXXXXXXXXXVDERMTTEGTGLPFGLSNNTLGWILFGVFGLIWA 118 VD+R++TEGTGLPFGLSNN LGWILFGVFGLIWA Sbjct: 54 NSNMAKGGSLAAAAMAATMSSPAMALVDDRLSTEGTGLPFGLSNNLLGWILFGVFGLIWA 113 Query: 119 LYFIYT 124 LYFIYT Sbjct: 114 LYFIYT 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95125 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27549 271 6e-75 >Contig27549 Length = 173 Score = 271 bits (692), Expect = 6e-75, Method: Compositional matrix adjust. Identities = 125/170 (73%), Positives = 145/170 (85%) Query: 7 RSRPNILVXXXXXXXXXXXXXALAESTQLRHINIGELVREKNLHDGWDDELECHVINEDL 66 R+RPNILV ALAE+TQLRHIN+G+LV+ KNLHDGWDDEL+C+VINEDL Sbjct: 3 RTRPNILVTGTPGTGKTTTSSALAEATQLRHINVGDLVKAKNLHDGWDDELDCYVINEDL 62 Query: 67 VCDELEDIMEQGGNIVDYHGCDFFPERWFDRVVVLQTENSVLYDRLTKRGYTGAKLTNNI 126 VCDELED ME+GGNIVDYHGCDFFPERWFD VVVLQT+N+VLYDRLT+RGY+ +KL+NNI Sbjct: 63 VCDELEDTMEEGGNIVDYHGCDFFPERWFDLVVVLQTDNTVLYDRLTRRGYSNSKLSNNI 122 Query: 127 ECEIFQVLLEEAKESYPEDIVLALKSDTIEDITRNIAILTDWVRNWQPRS 176 ECEIFQ LLEEAKESYP+DIV+ LKSD+I+DI+ N+ LTDWV WQP S Sbjct: 123 ECEIFQTLLEEAKESYPQDIVIPLKSDSIQDISTNLTTLTDWVTRWQPSS 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49042 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40066 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18393 (80 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22449 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14679 115 1e-27 >Contig14679 Length = 327 Score = 115 bits (287), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 71/221 (32%), Positives = 113/221 (51%), Gaps = 33/221 (14%) Query: 1 MLDHPFVPALYASFQTKTHVCLITDYCPGGELFLLLDRQPTKVLKEDAVRFYAAEVVVAL 60 ++ HP + LY TKT + + +Y GGELF ++ LKE+ R Y ++++ AL Sbjct: 18 LVRHPNIIHLYEVMATKTKIYFVIEYAKGGELF---NKVAKGKLKEEVARKYFSQLIDAL 74 Query: 61 EYLHCQGIIYRDLKPENVLLQGNGHVSLTDFDLSCLTSCKPQ-LLLPTTNEKKRRHKGQQ 119 ++ H +G+ +RD+KPEN+LL N ++ ++DF LS L K Q LL TT Sbjct: 75 DFCHSRGVYHRDIKPENLLLDENDNLKISDFGLSALAESKRQDGLLHTT----------- 123 Query: 120 NPVFMAEPMRASNSFVGTEEYIAPEIIAGAGHTSA-VDWWALGILLYEMLYGYTPFRGKT 178 GT Y+APE+I G+ D W+ G++LY +L G PF+ Sbjct: 124 ---------------CGTPAYVAPEVINRRGYDGVKADIWSCGVVLYVLLAGCLPFQDSN 168 Query: 179 RQKTFANILHKDLKFPSSTPTSLHAKQLMYRLLHRDPKSRL 219 + + I + K P+ S A++L+YR+L +P SR+ Sbjct: 169 LMEMYRKIGKAEFKCPNF--FSPEARRLLYRMLDPNPNSRI 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34675 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41944 (375 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24129 686 0.0 >Contig24129 Length = 370 Score = 686 bits (1770), Expect = 0.0, Method: Compositional matrix adjust. Identities = 321/375 (85%), Positives = 351/375 (93%), Gaps = 5/375 (1%) Query: 1 MADVAQVNGVGQTADFPAVPTHGGQFIQYNIFGNLFEITAKYRPPIMPIGRGAYGIVCSV 60 MAD+ NG DFPAVP+HGGQ+IQYNIFGNLFEIT KYRPPIMPIGRGAYGIVCSV Sbjct: 1 MADLTPSNG-----DFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSV 55 Query: 61 LNTETNELVAIKKIANAFDNHMDAKRTLREIKLLQHFDHENVIAVKDVVPPPLRREFTDV 120 LN+ET E+VAIKKIANAFDNHMDAKRTLREIKLL+H DHENVIA++DV+PPPLRREF+DV Sbjct: 56 LNSETKEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENVIAIRDVIPPPLRREFSDV 115 Query: 121 YIAAELMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLLLNAN 180 YIA ELMDTDLHQIIRSNQ LSEEHCQYF+YQ+LRGLKYIHSANVIHRDLKPSNLLLNAN Sbjct: 116 YIATELMDTDLHQIIRSNQGLSEEHCQYFMYQILRGLKYIHSANVIHRDLKPSNLLLNAN 175 Query: 181 CDLKICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR 240 CDLKICDFGLARPT+ENE +TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR Sbjct: 176 CDLKICDFGLARPTAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR 235 Query: 241 RPLFPGKDHVHQMRLLIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHP 300 +PLFPGKDHVHQMRLL ELLGTPT++DLGFVRNEDA+RYIRQL QHPRQ L ++FPHV+P Sbjct: 236 KPLFPGKDHVHQMRLLTELLGTPTESDLGFVRNEDARRYIRQLAQHPRQPLERLFPHVNP 295 Query: 301 LAIDLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIK 360 +AIDLVDRMLTFDP +RITV++ALAHPYL RLHD ADEP+C EPFSFDFEQQ LGEEQ+K Sbjct: 296 MAIDLVDRMLTFDPTRRITVEQALAHPYLERLHDVADEPICTEPFSFDFEQQPLGEEQMK 355 Query: 361 DMIYQEALALNPGFA 375 DMIY+EA+ALNP +A Sbjct: 356 DMIYREAIALNPEYA 370 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53149 (737 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91041825 239 1e-64 >91041825 Length = 192 Score = 239 bits (610), Expect = 1e-64, Method: Compositional matrix adjust. Identities = 104/162 (64%), Positives = 133/162 (82%) Query: 34 FVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNG 93 F +VSYDH+A+II+G++R+L+S IHYPR+TPEMWPDLI K+K+GG DVIQTY FW+G Sbjct: 31 FKPFNVSYDHRALIIDGKRRMLVSAGIHYPRATPEMWPDLIAKSKEGGADVIQTYAFWSG 90 Query: 94 HEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFR 153 HEP +G Y F+ RYD+V+F LV +GLY+HLRIGPYVCAEWN+GGFPVWL+ +PGIEFR Sbjct: 91 HEPVRGQYNFEGRYDIVKFANLVGASGLYLHLRIGPYVCAEWNFGGFPVWLRDIPGIEFR 150 Query: 154 TDNGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENE 195 T+N FK M +F +K+V +M+ E+L QGGPII+ QIENE Sbjct: 151 TNNALFKEEMQRFVKKMVDLMQEEELLSWQGGPIIMLQIENE 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26457 (135 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101205 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3052 117 2e-28 >Contig3052 Length = 287 Score = 117 bits (292), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 65/196 (33%), Positives = 104/196 (53%), Gaps = 15/196 (7%) Query: 1 HEDTVEDVTFCPSSAQEFCSVGDDSCLILWDARVGTSPVIKVEKAHDADLHCVDWNPLDD 60 HE V DV++ P + F SVGDD L++WD R T+ KAH+ +++ + +NP ++ Sbjct: 93 HESVVGDVSWHPKNENLFGSVGDDCQLMIWDLR--TNQTQHCVKAHEKEVNYLSFNPYNE 150 Query: 61 NLILTGSADNSVRMFDRRNLTSNGVGSPINKFEGHSAAVLCVQWSPDKSSVFGSSAEDGL 120 ++ T S+D +V +FD RNLT P++ H V V+W P +V S A+D Sbjct: 151 WILATASSDTTVGLFDMRNLTV-----PLHVLSTHGEEVFQVEWDPSHETVLASYADDRR 205 Query: 121 LNIWDYEKVGKKVEQGPRTTNYPAGLFFQHAGHRDKVVDFHWNASDPWXXXXXXXXXXXX 180 L +WD ++G + +G + P L F H GH+ K+ DF WN ++PW Sbjct: 206 LMVWDLNRIGDEQAEG-DGDDGPPELLFVHGGHKAKISDFSWNKNEPW-------VISSV 257 Query: 181 XXXXXLQIWRMSDLIY 196 LQ+W+++D I+ Sbjct: 258 SEDNTLQVWQIADSIF 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7008 (471 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59461 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15008 302 3e-84 >Contig15008 Length = 219 Score = 302 bits (774), Expect = 3e-84, Method: Compositional matrix adjust. Identities = 153/220 (69%), Positives = 176/220 (80%), Gaps = 3/220 (1%) Query: 1 MASVSSPMASQLKSSFTSPVSR--SLLTPRGISGSPFRVVPSKRSPRFIVKAIQSEKPTY 58 MAS +SPMASQLKS+FTSP++ +LL+P+G+S SP ++ PSKR F +KA+QS+K + Sbjct: 1 MAS-ASPMASQLKSNFTSPITTRPALLSPKGLSASPLKLFPSKRLSSFSIKAVQSDKQNF 59 Query: 59 QVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPF 118 QVIQPINGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVSPLLRG+EVGLAHGFLLVGPF Sbjct: 60 QVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPF 119 Query: 119 VKAGPLRNTEIXXXXXXXXXXXXVVILSICLTIYGIASFNEGEPSTAPGLTLTGRKKEPD 178 VK GPLRNT VVIL++CLTIYGI+SF EGEPS+AP LTLTGRKKEPD Sbjct: 120 VKTGPLRNTPYAGGAGSLAAAGLVVILTLCLTIYGISSFKEGEPSSAPALTLTGRKKEPD 179 Query: 179 QLQTADGWAKXXXXXXXXXISGVIWAYFLLYVLNXXYSFN 218 QLQTA+GW+K ISGV WAYFLLYV+N Y F Sbjct: 180 QLQTAEGWSKFTGGFFFGGISGVTWAYFLLYVVNLPYFFK 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25906 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3769 114 2e-27 >Contig3769 Length = 178 Score = 114 bits (284), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 74/187 (39%), Positives = 97/187 (51%), Gaps = 31/187 (16%) Query: 1 MGRKCSHCGNIGHNSRTCTS-HKAVXXXXXXXSSLRLFGVQLIDVXXXXXXXXXXXXXXX 59 M R CS CGN GHNSRTC+ + + LFGV++ + Sbjct: 1 MSRTCSQCGNNGHNSRTCSDVSGGGCGGPIAENGIMLFGVRVTEGNAFRKSVSMNNLSQY 60 Query: 60 XXXXXXXMDCXXXXXXXXXXXXXXXXXXXIDEDKTAVGYLSDGLIMIPPTSNHQHQERKK 119 + GY SD ++ S H+ +ER++ Sbjct: 61 ERPQQA-------------------------DTNAEAGYASDEVVH---ASGHR-RERRR 91 Query: 120 GVAWTEEEHRKFLMGLEKLGKGDWRGISRKFVSTRTPTQVASHAQKYFLRLASDLNKKKR 179 GVAWTEEEH+ FL+GL+ +G+GDWRGISR FV TRTPTQVASHAQKYFLR + +++R Sbjct: 92 GVAWTEEEHKLFLVGLQMVGRGDWRGISRNFVKTRTPTQVASHAQKYFLRRNNHN-RRRR 150 Query: 180 RSSLFDM 186 RSSLFD+ Sbjct: 151 RSSLFDI 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1144 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56306 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24178 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101535 (297 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29208 171 9e-45 >Contig29208 Length = 288 Score = 171 bits (434), Expect = 9e-45, Method: Compositional matrix adjust. Identities = 100/281 (35%), Positives = 135/281 (48%), Gaps = 41/281 (14%) Query: 2 DLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPII 61 D G++ V+E +G+F E A H + GAKKV+I+AP D P +VVGVN + YKP+ I+ Sbjct: 41 DYGVEYVVESSGIFTTLEKAALHKKGGAKKVVISAP-SADAPMFVVGVNENTYKPNMDIV 99 Query: 62 SNASCTTNCLAPFVKVLDQKFGKYQKHLQKSSLSLCSDIIHLRKRQKVTQLDDRIFPMCA 121 SNASCTTNCLAP KV+ ++FG Sbjct: 100 SNASCTTNCLAPLAKVIHEEFG-------------------------------------- 121 Query: 122 GIIKGTMTTTHSYTGDQRLLDA-SHRDLRRARSAALNIVPTSTXXXXXXXXXXXXXXXXX 180 I++G MTT H+ T Q+ +D S +D R R A NI+P+ST Sbjct: 122 -ILEGLMTTVHATTATQKTVDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGKL 180 Query: 181 NGIALRVPTPNXXXXXXXXXXSKITFAEDVNAAFRDSADNELKCILXVCDEPLVXVDFXC 240 G+A RVPTPN K + EDV A R +AD L+ IL +E +V DF Sbjct: 181 TGMAFRVPTPNVSVVDLTCRLEKSSSYEDVKATIRYAADGPLRGILGYTEEDVVSNDFVG 240 Query: 241 SDVFSNRDSSLTLVMGDXMXKVXAWYDNXWGYSQRXVDFAD 281 S D+ L + K+ +WYDN WGYS R +D + Sbjct: 241 DSRSSIFDAKAGLALSSSFVKLVSWYDNEWGYSTRVLDLIE 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59697 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9074 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80410 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27617 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8513 134 1e-33 >Contig8513 Length = 286 Score = 134 bits (338), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 71/171 (41%), Positives = 97/171 (56%), Gaps = 2/171 (1%) Query: 8 YDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDGIVMGVEKLIASKMMLPGSNRRI 67 YD VTT+SP GR+FQ+EYA +AV IG++ K +V+ S+ L ++I Sbjct: 6 YDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSE--LSSHQKKI 63 Query: 68 HSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYW 127 V H G+A+AGL ADGR + +SEA NY Y P+PV L ++A +CT Sbjct: 64 FKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESPLPVGRLVVQLADKAQVCTQRS 123 Query: 128 WLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEK 178 W RP+G G+++GG D G LY PSG + Y AIG QAAKT +E+ Sbjct: 124 WKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18472 (412 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42174 (337 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101711 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28069 90 2e-20 >Contig28069 Length = 447 Score = 89.7 bits (221), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 62/187 (33%), Positives = 96/187 (51%), Gaps = 22/187 (11%) Query: 1 MIVRIAFEINNYSFRLFYDCSSPGA----SHVYFQACYFPDHLPVELMPIDTFFSDGQRG 56 + + +A E + FRL Y+ S GA +H++FQA Y P+E P S Sbjct: 213 LALHMAAEAGSPYFRLGYN--SLGAFATINHLHFQAYYLAVTFPIEKAPTKKI-STLNAE 269 Query: 57 IYISTLIDYPIKTILFEYTYNNRIIMMEAIFEICSSLREKNISYNLLISDCGKRIFLFLQ 116 + +S L++YP++ ++FE N + + + C L+E N+ YN+LISDCGKRIFL Q Sbjct: 270 VKVSELLNYPVRGLVFEGG-NTLEDLSYTVSDACICLQENNVPYNVLISDCGKRIFLLPQ 328 Query: 117 ----KSAISG----------NLLAWECGGYFLFGSKYEFDQVTEEAIHKRLSAVSLNDEG 162 K A+ N WE G+ + K ++D+ ++E K L+ VSL++E Sbjct: 329 CYAEKQALGEVSAEVLDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLSEER 388 Query: 163 FQVVKQL 169 FQ V L Sbjct: 389 FQEVNAL 395 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44201 (378 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8947 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24412 (388 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68903 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs194106183 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 52024425 300 9e-84 >52024425 Length = 183 Score = 300 bits (768), Expect = 9e-84, Method: Compositional matrix adjust. Identities = 141/181 (77%), Positives = 161/181 (88%), Gaps = 3/181 (1%) Query: 1 MASSMISSTTVATA--NRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQ 58 MASSMISS TV+T +RA+ AQASMVAPFTGLKSSSAFP T+K+N DITSIASNGGRVQ Sbjct: 1 MASSMISSATVSTVYTDRAAPAQASMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQ 59 Query: 59 CMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSP 118 CM+VWPP GLKKFETLSYLPPLS E+L KE+ YLLR W+PCLEFELE G+VYRE+H SP Sbjct: 60 CMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSP 119 Query: 119 GYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAK 178 GYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP++F+RIIGFDN RQVQCISF+A K Sbjct: 120 GYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYK 179 Query: 179 P 179 P Sbjct: 180 P 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1613 (476 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41514 (285 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52071 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52926 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24131 95 1e-21 >Contig24131 Length = 311 Score = 94.7 bits (234), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 65/185 (35%), Positives = 95/185 (51%), Gaps = 22/185 (11%) Query: 59 LRYHMGPVLSSSPINIYLVWYGRWPNYQKLLIKDFILSISPXXXXX--KPSVSDWWRTVS 116 L+YH GP+LS I I L+WYG + QK ++ DFI S++ +PSV+ WW+T Sbjct: 49 LKYHNGPLLSGK-ITINLIWYGNFKPSQKAIVSDFISSLASSSPSKTPQPSVAAWWQTTE 107 Query: 117 LY---TDQTGANVSRTVLIAGEHSDHLYSHGKSLTRLSVQQVIGTAVESAPFPVDHKNGI 173 Y T ++ S ++ + + D YS GKSLT +Q++ A + D KN I Sbjct: 108 KYYHLTSNKKSSNSLSLSLGRQILDQSYSLGKSLT---TKQIVALAAKG-----DQKNAI 159 Query: 174 FLILTADDVTMQDYCRAVCGFHYFTFPSM-VGYT-------MPYAWIGNSTKQCPEVCSY 225 ++LT+ DV + +C CG H S G+T Y W+GNS QCP C++ Sbjct: 160 NVVLTSADVAVDGFCMNRCGTHGSASGSFKTGHTKGSKNSKFAYIWVGNSETQCPGQCAW 219 Query: 226 PFAVP 230 PF P Sbjct: 220 PFHQP 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41385 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86377 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7310 254 8e-70 >Contig7310 Length = 583 Score = 254 bits (650), Expect = 8e-70, Method: Compositional matrix adjust. Identities = 142/255 (55%), Positives = 174/255 (68%), Gaps = 22/255 (8%) Query: 4 VQLPLD-ETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGAN 62 VQLPLD ETG CKGFGFVQFA LE A+ A +LNG+LEI GR IKVS+VTD G Q+ GA Sbjct: 348 VQLPLDLETGQCKGFGFVQFAHLEHAKAAQSLNGKLEIAGRTIKVSSVTDHVGSQEAGAK 407 Query: 63 TTXXXXXXXXXXLSLNARSRALLMQKLDRSGSATTIAGSVVTPAVNXXXXXXXXXXXXXX 122 + LSLNA+SRALLMQKLDRSG AT+IAGS+ P +N Sbjct: 408 SADFDDDDGGG-LSLNAQSRALLMQKLDRSGIATSIAGSIGVPGLNGA------------ 454 Query: 123 XXXVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETY 182 P T+P + GQ + + A+V + + +G PSECLLLKNMFDP E Sbjct: 455 -------APNQRAVTLPIN-GQAAVSAPILPAAVAVNEPVGNPSECLLLKNMFDPATERE 506 Query: 183 EEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKM 242 +FD+DIKEDVE ECSK+G++KHI+V+K+SAGFVYLRFE ++A AAQRA+H RWFAG++ Sbjct: 507 PDFDVDIKEDVEEECSKYGRVKHIYVDKNSAGFVYLRFEAVEAAAAAQRAMHLRWFAGRL 566 Query: 243 ITATFMVPQTYEAKF 257 I+A FM PQ YEAKF Sbjct: 567 ISALFMQPQVYEAKF 581 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82072 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10909 436 e-124 >Contig10909 Length = 570 Score = 436 bits (1121), Expect = e-124, Method: Compositional matrix adjust. Identities = 217/270 (80%), Positives = 232/270 (85%), Gaps = 5/270 (1%) Query: 1 IKLIRFCRKLERLWILDSIGDRGLRVVAFTCKELQELRVFPS---GVDNAAVTEEGLVAI 57 I+LIR C KL+RLWILD IGD+GL VVA +CKELQELRVFPS +A+VTEEGLVAI Sbjct: 303 IELIRQCVKLQRLWILDCIGDKGLGVVAKSCKELQELRVFPSDPFAAGHASVTEEGLVAI 362 Query: 58 SAGCPKLHSLLYFCQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFGAI 117 SAGCPK+HSLLYFCQQMTNAALITVAKN NF RFRLCILD KPD VTMQPLDEGFGAI Sbjct: 363 SAGCPKIHSLLYFCQQMTNAALITVAKNCPNFIRFRLCILDPTKPDAVTMQPLDEGFGAI 422 Query: 118 VQSCKXXXXXXXXXXXTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKKLRKLE 177 VQ+CK TDQVFLYIGMYAEQLEMLSIAFAG+SDKGMLYVLNGCKKLRKLE Sbjct: 423 VQACKKIRRLSLSGLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLE 482 Query: 178 IRDSPFGNTALLTDVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIINEDDQMEFS 237 IRDSPFGN ALL DVGKYE MRSLWMSSCEVTLGGC+ LAKKMPRLNVEIINE+DQM+ Sbjct: 483 IRDSPFGNKALLRDVGKYEAMRSLWMSSCEVTLGGCKALAKKMPRLNVEIINENDQMD-- 540 Query: 238 LDDRQKVGKMYLYRTLVGPRKDAPDFVWTL 267 LDD Q+V KMYLYRTLVG R+D P+FVWTL Sbjct: 541 LDDEQRVEKMYLYRTLVGKRRDTPEFVWTL 570 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55139 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54601 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82862 (332 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92249 (171 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2264 91 1e-20 >Contig2264 Length = 143 Score = 90.9 bits (224), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 44/94 (46%), Positives = 65/94 (69%), Gaps = 9/94 (9%) Query: 52 DSNKPKRPPTAFFLFMDDFRKEYKEAHPDSKGVTGVAKEAGEKWKNMTDEEKKPYLDKAA 111 D NKPKRP +AFF+FM+DFR ++K+ HP++K V V K G+KWK++++ EK PY+ KA Sbjct: 30 DPNKPKRPASAFFVFMEDFRVKFKKDHPNNKSVAAVGKAGGDKWKSLSEAEKAPYIAKAE 89 Query: 112 ELKADYSKAME---------GNGDDNEVEDKAEN 136 + KA+Y+K M GNG D+E DK+++ Sbjct: 90 KRKAEYTKTMNAYNKRIAEGGNGADDEESDKSKS 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94242 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9665 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs136106187 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs191106188 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75388 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62677 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34689 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226742903 222 5e-60 >226742903 Length = 195 Score = 222 bits (565), Expect = 5e-60, Method: Compositional matrix adjust. Identities = 109/110 (99%), Positives = 110/110 (100%) Query: 1 VSTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 60 VSTSVVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS Sbjct: 83 VSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 142 Query: 61 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 110 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL Sbjct: 143 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18122 (107 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5998 104 3e-25 >Contig5998 Length = 107 Score = 104 bits (260), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 53/91 (58%), Positives = 60/91 (65%), Gaps = 1/91 (1%) Query: 17 SMLQTMVVAANGQGGRHYDSKHYGPGTVKSYQCPGKCDTRCSQTQYRKPXXXXXXXXXXX 76 SM T V+A Q DS YGPG++KSYQCP +C RCSQTQY KP Sbjct: 18 SMAATQVMAKE-QARNQLDSGGYGPGSLKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAK 76 Query: 77 XXXVPPGYYGNKAVCPCYNNWKTKEGGPKCP 107 VPPG+YGNKAVCPCYNNWKT++GGPKCP Sbjct: 77 CLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36939 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13954 69 1e-13 >Contig13954 Length = 239 Score = 68.6 bits (166), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 27/45 (60%), Positives = 37/45 (82%) Query: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKVRKLQL 45 +II L ALLGNRW+ IA LP RTDN++KNYWN+H++KK+ K+ + Sbjct: 76 LIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGI 120 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89949 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7976 366 e-103 >Contig7976 Length = 241 Score = 366 bits (939), Expect = e-103, Method: Compositional matrix adjust. Identities = 193/241 (80%), Positives = 206/241 (85%), Gaps = 1/241 (0%) Query: 1 MALWVILCVGFLSLVSSVQGY-GGWINAHATFYXXXXXXXXXXXXXXYGNLYSQGYGTNT 59 MA IL +GFLSLVSSV GY GGW NAHATFY YGNLYSQGYGTNT Sbjct: 1 MASLGILVIGFLSLVSSVNGYYGGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT 60 Query: 60 AALSTALFNNGLSCGACFQIMCANDPQWCLRGSIIVTATNFCPPGGWCDPPNHHFDLSQP 119 AALSTALFNNGL+CGAC+QI C NDPQWCL GSIIVTATNFCPPGGWCDPP HFDLSQP Sbjct: 61 AALSTALFNNGLTCGACYQIRCVNDPQWCLPGSIIVTATNFCPPGGWCDPPQQHFDLSQP 120 Query: 120 VFQHIAQYRAGIVPVIYRRVRCKRNGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGS 179 VF IAQY+AG+VPV YRRVRC+R GGIRFT+NGHSYFNLVL+TNVGGAGDV +V+IKGS Sbjct: 121 VFLRIAQYKAGVVPVSYRRVRCRRRGGIRFTVNGHSYFNLVLVTNVGGAGDVQSVAIKGS 180 Query: 180 RTRWQPMSRNWGQNWQSNSYLNGQSLSFVVTTSNGHSVVSYNVAPPNWSFGQTYTGRQFR 239 RTRWQ MSRNWGQNWQSNSYLNGQSLSF+VTTS+G +VSYNVAPPNWSFGQTYTGRQF Sbjct: 181 RTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSYNVAPPNWSFGQTYTGRQFL 240 Query: 240 Y 240 Y Sbjct: 241 Y 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33140 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24372 154 1e-39 >Contig24372 Length = 148 Score = 154 bits (388), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 73/145 (50%), Positives = 97/145 (66%) Query: 8 RRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMA 67 +RI+KE + L +P SA P ++M ++ I+GP SPY GGVF + + P +YP Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPGDSPYTGGVFLVSIHFPPDYPFK 63 Query: 68 APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENI 127 PKV F TK++HPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDDPL I Sbjct: 64 PPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 123 Query: 128 AKHWKTNEAEAVETAKEWTRLYASG 152 A +KT+ A+ TA+ WT+ YA G Sbjct: 124 AHMYKTDRAKYEATARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3081 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2618 238 5e-65 >Contig2618 Length = 161 Score = 238 bits (606), Expect = 5e-65, Method: Compositional matrix adjust. Identities = 115/159 (72%), Positives = 130/159 (81%), Gaps = 1/159 (0%) Query: 4 AETQTMVVGIDDSEQSTYALQWTLDHFFAN-STVNPPFKLVIVHARPSPSAVIGLAGPGA 62 A Q MV+G DDSE+ YAL+WTLDH F PFKL+IVHA+PS S+V+G GP Sbjct: 3 AGKQVMVIGADDSEEGHYALEWTLDHLFKPLGGDTAPFKLIIVHAKPSVSSVVGFVGPAG 62 Query: 63 VEVLPHVDSDFKKIAARVVEEAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASILV 122 EVLP VD+D KK+AARV E AKE C+SKSV D VVEV+EGDARN+LCEAVE+HHASILV Sbjct: 63 AEVLPIVDADLKKMAARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHHASILV 122 Query: 123 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKTKH 161 VGSHGYGAIKRA+LGSVSDYCAHH HCTVMIVK+PKTKH Sbjct: 123 VGSHGYGAIKRALLGSVSDYCAHHVHCTVMIVKKPKTKH 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6004 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63748 (80 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22323 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55995 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8 76 4e-16 >Contig8 Length = 262 Score = 76.3 bits (186), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 36/97 (37%), Positives = 62/97 (63%) Query: 35 VGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISIHVVMMLSAGYFR 94 V R EFS +YF L+ ++ + V E LM+VVAS+ + I+T I ++M+++G+FR Sbjct: 60 VKFRPEFSHYVYFCLDIYLSISVIESLMMVVASLVPNFLMGIITGAGIMGILMMTSGFFR 119 Query: 95 IRNALPGPVWTYPISYVAFHTYSIKGLLENEYLGTSF 131 + LP P W YPISY+ + +++++G +N+ +G F Sbjct: 120 LLPDLPKPFWRYPISYIGYGSWALQGSYKNDLIGLEF 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79764 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8738 147 1e-37 >Contig8738 Length = 259 Score = 147 bits (371), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 80/171 (46%), Positives = 113/171 (66%), Gaps = 8/171 (4%) Query: 3 GSYSSNKCLKNCGKPSQSLYHVPRSWLKSSGNTLVLFEEIGGDPTKISFVTKQLGSSLCS 62 G++ KC +CG+P+Q YHVPRSWLK + N +V+FEE+GGDP+KI+ V + + + +C Sbjct: 81 GTFRPTKCQLHCGRPTQRWYHVPRSWLKPTQNLVVVFEELGGDPSKITLVRRSV-TGVCG 139 Query: 63 HVTDSHPLP--VDMWGS-DSKIQRKPGPVLSLECPNPNQVISSIKFASFGTPLGTCGSFS 119 + ++HP D+ G+ DSK + + L C P Q ISSIKFASFGTP GTCGSF Sbjct: 140 DLHENHPNAENFDVEGNEDSKTLHQAQ--VHLHCA-PGQSISSIKFASFGTPSGTCGSFQ 196 Query: 120 RGRCSSARSLSVVRQACVGSKSCIIGVSVNTFG-DPCKGVMKSLAVEASCT 169 +G C + S +VV + C+G +SC + VS + F DPC V+K L+VEA C+ Sbjct: 197 QGTCHATNSHAVVEKNCIGRESCSVAVSNSAFETDPCPNVLKRLSVEAVCS 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23665 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21714 (286 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2343 209 4e-56 >Contig2343 Length = 585 Score = 209 bits (532), Expect = 4e-56, Method: Compositional matrix adjust. Identities = 114/275 (41%), Positives = 156/275 (56%), Gaps = 6/275 (2%) Query: 15 SQLLGS-CEPAKSWQMLYLYTVLYITGFGAAGIRPCVSSFGADQFDERSKDYKTHLDRFF 73 ++ +GS C A S Q L LY+ G GI+PC+ FGADQFD+ + +F Sbjct: 141 AECVGSVCPAATSAQYAVLIAGLYLIALGTGGIKPCIWPFGADQFDDTDPKERVKKGSYF 200 Query: 74 NFFYLSVTVGAIVAFTLVVYIQMEHGWGSAFGALAIAMGISNMLFFIGTPLYRHRLPGGS 133 N+FY S +GAI+A +L+V+IQ GWG FG MG+ IGTPLYR + PGGS Sbjct: 201 NWFYFSQNIGAIIASSLLVWIQENVGWGIGFGIPTALMGVCIASLLIGTPLYRFQKPGGS 260 Query: 134 PLTRVAQVLVAAFRKRHAAFSSSELIGLYEVPGKHSAIKGSGKIDHTDDFRCLDKAALEL 193 PLTR+ QVLVAAFRKR+ + LYE K SAI+GS K+DH+++ RCLDKAAL Sbjct: 261 PLTRIFQVLVAAFRKRNVKVLGDSV--LYETQDKSSAIEGSRKLDHSNELRCLDKAALIT 318 Query: 194 KEDVIN---PSPWKLCTVTQVEESKTLVRLVPIPACTIMLNVNLTEFLTLSVQQAYTMNT 250 ++ PW+LCTVTQVEE K LVR+ PI A I+ + + TL V Q M+ Sbjct: 319 NTEIAYGNFSDPWRLCTVTQVEELKILVRMFPIWATGIVFSAVFAQMSTLFVVQGKLMDR 378 Query: 251 HMGKLKTSVTCMPVFPGLAXFYTGSLYSNIVPHVA 285 +G + + F ++ +Y ++ +A Sbjct: 379 TVGSVTIPAASLSFFDFVSVIIWVPIYDRVITPIA 413 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28553 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8538 147 8e-38 >Contig8538 Length = 155 Score = 147 bits (371), Expect = 8e-38, Method: Compositional matrix adjust. Identities = 70/87 (80%), Positives = 79/87 (90%) Query: 1 MRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDREGAVS 60 MRRLTKANIRIL KENLPKIASEDDEMVQISGDLD+ KDALIQV+TRLRAN+FDREG +S Sbjct: 1 MRRLTKANIRILSKENLPKIASEDDEMVQISGDLDIVKDALIQVVTRLRANIFDREGGMS 60 Query: 61 TFVPVLPYIPVSENGSDGLNYESRDSK 87 F+PVLPY+PVS +G DG NY+SRD + Sbjct: 61 GFLPVLPYLPVSADGPDGPNYDSRDGR 87 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52884 (196 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29046 (73 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64340 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75520 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24121 120 2e-29 >Contig24121 Length = 439 Score = 120 bits (302), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 55/106 (51%), Positives = 71/106 (66%) Query: 1 MRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALPCGTLPFDDENIPNLF 60 +RD L T+CG+PNY APEV++ + Y G D+WSCGVIL+ L G LPFDD N+ NL+ Sbjct: 164 VRDDGLLHTTCGTPNYVAPEVLNDRGYDGATADLWSCGVILFVLLAGYLPFDDSNLMNLY 223 Query: 61 KKIKGGIYTLPSHLSPGARDLIPRMLIVDPMKRITIPEIRQHPWFQ 106 KKI +T P LS GA LI R+L +PM R+TI EI + WF+ Sbjct: 224 KKISAAEFTCPPWLSFGAMKLIARILDPNPMTRVTIAEILEDEWFK 269 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11919 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21820 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23077 135 3e-34 >Contig23077 Length = 211 Score = 135 bits (339), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 1/106 (0%) Query: 1 MGRIFLVELKGRSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERL 60 MGR+F+V L+G+ Y C+ C +HLAL D V+S SF CR G+AYLFS VVN+ G E+R Sbjct: 83 MGRLFVVSLEGK-IYSCKHCRTHLALCDDVVSKSFYCRHGKAYLFSKVVNVYSGECEDRA 141 Query: 61 MLSGMHTVEDIFCCCCGQIVGWKYVAAHDKNQKYKEGKFVLERWRI 106 M++G+HTV DIFC CG IVGWKY AH+K QKYKEGK VLER ++ Sbjct: 142 MMTGLHTVADIFCVGCGSIVGWKYETAHEKGQKYKEGKSVLERIKV 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105273 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25880 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81219 (348 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97065 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3005 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67006 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12644 (127 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32000 60 1e-11 >Contig32000 Length = 143 Score = 60.5 bits (145), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/109 (28%), Positives = 49/109 (44%) Query: 14 VVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPXXXXXXXXX 73 V + S ET +S A+ +++FTA WC P ++PL+ LA Y Sbjct: 35 VTGIHSARELETKLSAASKASRLAILYFTATWCGPCRFISPLYTSLAGKYKKVVFLKVDI 94 Query: 74 XXXXXXASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSI 122 A+ + +P F +R G VDK+VGA+ + ++I SI Sbjct: 95 DEARDVAANWNISGVPAFFFVRNGKEVDKMVGADKAALERKIAQHAGSI 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5815 (104 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96674 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48384743 71 1e-14 >48384743 Length = 152 Score = 70.9 bits (172), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 37/52 (71%), Positives = 41/52 (78%), Gaps = 5/52 (9%) Query: 26 FSALFKELCEVKRKSSALQMQQFVGEEKNDLLDYLRSLQPEKVVELSEPTCP 77 S+ KEL EVKRKS+ALQMQQFVGEEKNDLLDYLRSLQPE+ +CP Sbjct: 96 LSSAKKELHEVKRKSAALQMQQFVGEEKNDLLDYLRSLQPEES-----NSCP 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99190 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59703 (424 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18148 412 e-117 >Contig18148 Length = 365 Score = 412 bits (1060), Expect = e-117, Method: Compositional matrix adjust. Identities = 186/367 (50%), Positives = 257/367 (70%), Gaps = 3/367 (0%) Query: 55 LVDLTLLHNAKDRGALCLDGSLPGYHFQKGFGSGSNNWLLHIEGGGWCNTIESCSTRKTT 114 +V LTL++ A +GA+CLDG+LP YH +G+GSG+N+WL+ +EGGGWC+TI +C RK T Sbjct: 1 MVGLTLINGAAAKGAVCLDGTLPAYHIHRGYGSGANSWLVQLEGGGWCDTIRNCVYRKKT 60 Query: 115 ALGSSNFMERQVSFSGILSSDPSQNPDFFSWNKVKIHYCDGASFAGRPESEFKNGTNLFF 174 G S +ME+Q+ FSGILS+ +NPDF++WN+VK+ YCDGASF+G ++E L F Sbjct: 61 RRGCSVYMEKQIPFSGILSNKAGENPDFYNWNRVKVRYCDGASFSGDSQNE---AARLHF 117 Query: 175 RGQLIWEALMDELLSVGMSNAKQAFLTGCSAGGLAAVIHCDDFRERLPQHATVKCLADAS 234 RGQ IW+A M++L+S GM A QA L+GCSAGG+A V+HCD FR P VKCL+D Sbjct: 118 RGQRIWKAAMEDLMSKGMRYANQALLSGCSAGGVATVLHCDGFRGMFPSTTKVKCLSDGG 177 Query: 235 FFLDESDVQGNRTMRSFYDDVFHLQGVAKSLDKNCLSRMGNSSCLFPREFIKNIRTPVFI 294 FLD DV G RT+RS + V LQGV K+L +C +R+ + C FP+ I +++TP+F+ Sbjct: 178 LFLDAIDVSGTRTLRSMFTRVVSLQGVQKNLPWSCTNRLNPTLCFFPQHLIASVKTPLFL 237 Query: 295 VNPAYDFWQIRNILVPDVSDPQGYWQTCRLNIHSCNPNQLEILKGFRNSLLNALSEFQQK 354 VN AYD WQI+ L P +DP G W C N +C ++ L+GFRN +L A+S F + Sbjct: 238 VNAAYDTWQIQASLAPRTADPNGLWHACTNNNANCAAWLIKFLQGFRNQMLKAVSGFSRA 297 Query: 355 NEAGMFVNSCYIHCQTWMAETWHSPSSPRINSKTIAESVGDWYFNRGAVKLIDCPYPCNP 414 + G+F+NSC+ HCQT +TW S + P I +K IA+SVG+WYF+R ++K IDCPYPC+ Sbjct: 298 GKNGLFINSCFSHCQTERQDTWFSQNPPLIGNKGIAKSVGNWYFDRYSIKAIDCPYPCDK 357 Query: 415 TCYNMDF 421 TC+N+ F Sbjct: 358 TCHNLVF 364 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68106183 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2584 130 1e-32 >Contig2584 Length = 157 Score = 130 bits (326), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 93/166 (56%), Positives = 105/166 (63%), Gaps = 15/166 (9%) Query: 1 MEGRKQTGSSSS-LTNELFGSKEXXXXXXXXXXXXXXXXK--VLGRESLHSESMEKKHDS 57 MEGRKQTGSSSS T+ELFGSKE K VLGRES+HSE KK Sbjct: 1 MEGRKQTGSSSSSFTSELFGSKESSASPGIFGAIFAPPSKDLVLGRESVHSEFTGKKL-- 58 Query: 58 SKEAWNTKPTTPVLLLSFPGDASRSYETESQGTAYKDM-SSMYQDQRVQ-PCHLSSSIYY 115 S E + P P AS+ E ES+ + KD+ +S+Y+DQRVQ PCHLSSSIYY Sbjct: 59 SDEPLHFTPGDQ------PDGASKESEGESKSISNKDIINSIYRDQRVQQPCHLSSSIYY 112 Query: 116 GGQDVYSPRPPNSQGPGVNSVFKKDG-EDDSGSASRGNWWQGSLYY 160 GGQD+YS N Q P NS +KKDG EDDSGSA RGNWWQGSLYY Sbjct: 113 GGQDIYSYSQSN-QSPEYNSTYKKDGTEDDSGSACRGNWWQGSLYY 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66047 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59796 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2196 (83 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs168106181 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67005 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14009 94 1e-21 >Contig14009 Length = 203 Score = 93.6 bits (231), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 39/74 (52%), Positives = 55/74 (74%) Query: 40 SNPVSVIGPQYCLPYPVDLSIVRKFLTLTDGSFAVTDINDNLMFKVKEKLISLHDKRTLL 99 +NPV+V+ PQ+ YPVDL I K +T+ +G+F V+D+N NLMF +K L SLHD+R L+ Sbjct: 18 ANPVTVVSPQFLAAYPVDLVITEKMMTIKEGAFTVSDVNGNLMFNIKGSLFSLHDRRVLV 77 Query: 100 DPAGNPIVTITEKV 113 D AGNPIV+ +K+ Sbjct: 78 DNAGNPIVSFRQKI 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104791 (155 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21106183 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226762029 99 3e-23 >226762029 Length = 221 Score = 98.6 bits (244), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 55/125 (44%), Positives = 77/125 (61%), Gaps = 7/125 (5%) Query: 14 KKFEATVTRLNPSS-QGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFH 72 K V LN QG +E++ +VN L L+HPNL KL+G+ D D R+L+YE +F Sbjct: 97 KSLPVAVKVLNKEGYQGHREWLTEVNFLGQLRHPNLVKLIGYCCED--DHRLLVYEFMFR 154 Query: 73 GSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHE-EGPFQAMYNEFSTANIQIDKDF 131 GSL+ ++ R P+ W TR+ IAL AA+GL FLH E P +Y +F T+NI +D D+ Sbjct: 155 GSLENHLF-RKATVPLSWGTRMMIALGAAKGLAFLHNAERP--VIYRDFKTSNILLDSDY 211 Query: 132 SAKLS 136 + KLS Sbjct: 212 ATKLS 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40802 (41 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6371 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53503 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37497 (285 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29234 70 6e-14 >Contig29234 Length = 344 Score = 69.7 bits (169), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 57/203 (28%), Positives = 93/203 (45%), Gaps = 16/203 (7%) Query: 20 LITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIX-------------XXXXX 66 +I+G RG+G+ AR F G +V++A + ++ +++ Sbjct: 15 VISGSTRGLGKALAREFLLSGDRVVVASRSPESVQATVRELEENLREGINSAGGLSKNLK 74 Query: 67 XXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERIL 126 V CDV + D++ N AV++ G +DI NNAG +P + D+ + ++I+ Sbjct: 75 HAKVVGVACDVCEAGDVQKLANFAVSELGHIDIWINNAGANKGFRPLLQFTDE-DIKQIV 133 Query: 127 SINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAA--THAYASSKHGLLGLMKNT 184 S NLVG+ L T+ A R+M +G I G G + T Y S+K GL L + Sbjct: 134 STNLVGSILCTREAMRIMMNQAKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL 193 Query: 185 AVELGRFGIRVNCVSPYVVSTPL 207 E + V+ SP +V T L Sbjct: 194 LKECKGSKVGVHTASPGMVLTDL 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96109 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104240 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34540 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85196 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9746 135 3e-34 >Contig9746 Length = 169 Score = 135 bits (340), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 69/142 (48%), Positives = 96/142 (67%) Query: 5 LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI 64 LT + E KEAF LFD DG G I KEL MR+LG TE ++ MI +VD DG+G I Sbjct: 21 LTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAI 80 Query: 65 DFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDE 124 DF EF ++M K+ + D++EEL +AF++ D D+NG ISAA+++ + +LGE TD E+ E Sbjct: 81 DFDEFAHMMTAKIGERDTKEELMKAFQLIDLDRNGKISAADIKSIAKDLGENFTDSEIQE 140 Query: 125 MXREADVDGDGXINYEEFVKVM 146 M EAD D DG +N +EF+++M Sbjct: 141 MIEEADRDRDGEVNADEFIRMM 162 Score = 57.8 bits (138), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 29/66 (43%), Positives = 44/66 (66%) Query: 84 EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMXREADVDGDGXINYEEFV 143 +E+KEAF +FD D +G I A EL M LG ++T+E++ +M + D DG G I+++EF Sbjct: 27 QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAIDFDEFA 86 Query: 144 KVMMAK 149 +M AK Sbjct: 87 HMMTAK 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs113106184 (384 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16230 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71989 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10279 115 7e-28 >Contig10279 Length = 76 Score = 115 bits (288), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 56/76 (73%), Positives = 66/76 (86%), Gaps = 1/76 (1%) Query: 1 MALPVSAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSN 60 MA+ SAIGFEGYEKRLE++FFEP +F DP GRGLRSLSK Q+DE L+ AECTIVSSLSN Sbjct: 1 MAMEGSAIGFEGYEKRLEIAFFEPSIFLDPEGRGLRSLSKAQIDEFLEQAECTIVSSLSN 60 Query: 61 EHLDSYVLSE-SSLFV 75 +++DSYVL E SSLF+ Sbjct: 61 DNVDSYVLXESSSLFI 76 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71992 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24180 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21994 218 1e-58 >Contig21994 Length = 571 Score = 218 bits (554), Expect = 1e-58, Method: Compositional matrix adjust. Identities = 120/291 (41%), Positives = 182/291 (62%), Gaps = 9/291 (3%) Query: 2 DQYEKVEKIGEGTYGVVYKARNCVTNETIALKKIRLEQ-EDEGVPSTAIREISLLKEMQH 60 D +EK++KIG+GTY VYKAR+ ++ + +ALKK+R + E E V A REI +L+ + H Sbjct: 118 DTFEKLDKIGQGTYSNVYKARDALSGKIVALKKVRFDNLEPESVKFMA-REILILRRLDH 176 Query: 61 GNIVRLQDVVHSEKK--LYLVFEYLDLDLKKHMDSCPDFANDPRLIKTFLYQILRGIAYC 118 N+V+L+ +V S LYLVFEY++ DL + + P +K ++ Q+L G+ +C Sbjct: 177 PNVVKLEGLVTSRMSCSLYLVFEYMEHDLAG-LAASPAIKFTEPQVKCYMNQLLSGLEHC 235 Query: 119 HSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRT-FTHEVVTLWYRAPEILLG 177 H+ VLHRD+K NLLID LK+ADFGLA F + T VVTLWYR PE+LLG Sbjct: 236 HNRYVLHRDIKGSNLLIDN-GGVLKIADFGLASFFDPNYKQPMTSRVVTLWYRPPELLLG 294 Query: 178 SRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEDTWPGVTSLPDF 237 + Y VD+WS GCI AE++ +P+ PG +E+++L KIF++ G+P++D W + LP Sbjct: 295 ATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIFKLCGSPSDDYW-KKSKLPHA 353 Query: 238 KSAFPKWPSKE-LGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYF 287 P+ K + ++ P+ + L+ +L +DP+ R TA +AL +E+F Sbjct: 354 TIFKPQQSYKRCIAETFKDFPPSSLPLIETLLAIDPAERRTATAALRNEFF 404 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7741 (190 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59902 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27642 503 e-145 >Contig27642 Length = 351 Score = 503 bits (1296), Expect = e-145, Method: Compositional matrix adjust. Identities = 241/247 (97%), Positives = 245/247 (99%) Query: 1 MIDNVVLIVTGTLHERDVQELLEKCHPWGMFDSIATLAVAQNMRELYRLVLVDTPLAPYF 60 MIDNVVLIVTGTLHERDVQELLEKCHP GMFDSIATLAVAQNMRELYRLVLVDTPLAPYF Sbjct: 105 MIDNVVLIVTGTLHERDVQELLEKCHPLGMFDSIATLAVAQNMRELYRLVLVDTPLAPYF 164 Query: 61 SECITSEDLDDMNIEIMRNTLYKAYLEDFYKFCQKLGGATAEIMSDLLAFEADRRAVNIT 120 SECITS+DLDDMNIEIMRNTLYKAYLEDFY+FCQKLGGATAEIMSDLLAFEADRRAVNIT Sbjct: 165 SECITSDDLDDMNIEIMRNTLYKAYLEDFYRFCQKLGGATAEIMSDLLAFEADRRAVNIT 224 Query: 121 INSIGTELTRDDRRKLYSNFGLLYPYGHEELAVCEDIDQVRGVMEKYPPYQSIFSKLSYG 180 INSIGTELTRDDRRKLYS+FGLLYPYGHEELAVCEDIDQVRG MEKYPPYQSIFSKLSYG Sbjct: 225 INSIGTELTRDDRRKLYSSFGLLYPYGHEELAVCEDIDQVRGCMEKYPPYQSIFSKLSYG 284 Query: 181 ESQMLDKAFYEEEVKRLCLAFEQQFHYGVFFAYMRLREQEIRNLMWISECVAQNQKSRVH 240 ESQ+LDKAFYEEEVKRLCLAFEQQFHYGVFFAYMRLREQEIRNLMWISECVAQNQKSRVH Sbjct: 285 ESQLLDKAFYEEEVKRLCLAFEQQFHYGVFFAYMRLREQEIRNLMWISECVAQNQKSRVH 344 Query: 241 DSVVFIF 247 DSVVFIF Sbjct: 345 DSVVFIF 351 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74778 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51243 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78299 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7976 308 5e-86 >Contig7976 Length = 241 Score = 308 bits (789), Expect = 5e-86, Method: Compositional matrix adjust. Identities = 163/244 (66%), Positives = 195/244 (79%), Gaps = 16/244 (6%) Query: 14 LSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALST 73 LSL ++ N G W +AHATFYGG DASGTMGGACGYGNLYSQGYG NTAALST Sbjct: 12 LSLVSSVNGYYGG------WSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST 65 Query: 74 ALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHF 133 ALFNNGL+CGAC++++C DPQWC PG +I++TATNFCPP GGWC+PP+ HF Sbjct: 66 ALFNNGLTCGACYQIRCVNDPQWCLPG--SIIVTATNFCPP--------GGWCDPPQQHF 115 Query: 134 DLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRV 193 DL+ P+FL++AQY+AG+VPVSYRRV CR+RGGIRFT+NG YFNLVLVTNV GAGD+ V Sbjct: 116 DLSQPVFLRIAQYKAGVVPVSYRRVRCRRRGGIRFTVNGHSYFNLVLVTNVGGAGDVQSV 175 Query: 194 SVKGANTQWLSMSRNWGQNWQSNSQLVGQALSFRVTGSDRRTSTSWNVAPANWQFGQTFS 253 ++KG+ T+W +MSRNWGQNWQSNS L GQ+LSF VT SD R S+NVAP NW FGQT++ Sbjct: 176 AIKGSRTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSYNVAPPNWSFGQTYT 235 Query: 254 GKNF 257 G+ F Sbjct: 236 GRQF 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95342 (288 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9527 157 2e-40 >Contig9527 Length = 247 Score = 157 bits (397), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 103/275 (37%), Positives = 139/275 (50%), Gaps = 51/275 (18%) Query: 17 TRLPDIYSNSGRIQARFGFGKRKTAPKKSKQSSGSSDRPLWYPGAKAPEWLDGSLVGDYG 76 T P + S+S +++F + + SS S W PG P +LDGS GD+G Sbjct: 14 TAFPSVLSSS---KSKFATSAVQLPSIGANASSRFSMSAEWMPGEPRPPYLDGSAPGDFG 70 Query: 77 FDPFGLGKPAEYLQYDYDSLDQNLAKNPAGDIIGTRIEASDMQSTPLQPYTEVFGLQRFR 136 FDP LG+ E L+RF+ Sbjct: 71 FDPLRLGEVPE-------------------------------------------NLERFK 87 Query: 137 ECELIHGRWAMLATLGALTVEWLTGITWQDAGKVELVEG--SSYLGQPLPF-SITTLIWI 193 E ELIH RWAMLA G L E L W A + V G ++YLG P+P+ ++ T++ I Sbjct: 88 ESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAAVPGGQATYLGNPVPWGTLPTILVI 147 Query: 194 EVLVIGYIEFQRNSELDPEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFL 253 E L I ++E QR+ E DPEK+ YPGG F DPLG + DP+K ++ E+K+ RLA++AF+ Sbjct: 148 EFLSIAFVEHQRSMEKDPEKKKYPGGAF-DPLGYSKDPKKFEEYKVKEVKNGRLALLAFV 206 Query: 254 GFAV-QAVVTGKGPLNNWATHLSDPLHTTILDTFI 287 GF V Q+ G GPL N ATHL+DP H I D I Sbjct: 207 GFVVQQSAYPGTGPLENLATHLADPWHNNIGDVII 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs86437 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83834 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46148 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20450 302 2e-84 >Contig20450 Length = 148 Score = 302 bits (773), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 144/148 (97%), Positives = 146/148 (98%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKSDKAKYEATARSWTQKYAMG 148 PEIAHMYK+D+ KYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRNKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26492 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22383 109 4e-26 >Contig22383 Length = 371 Score = 109 bits (273), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 59/175 (33%), Positives = 97/175 (55%), Gaps = 2/175 (1%) Query: 1 MMFSATMPPWIRSLTNKYLKNPLTVDLVGDSDQKLAD-GISLYSIATSMYEKPSIIGQLI 59 +M++AT P +R + L P+ V+ +G+ D+ +A+ I+ Y + EK + QL+ Sbjct: 43 LMYTATWPKEVRKIAADLLVKPVQVN-IGNVDELVANKSITQYVEVLTSMEKHRRLEQLL 101 Query: 60 TEYAKGGKCIVFTQTKRDADRLAHAMAKSYNCEPLHGDISQSQRERTLSAFRDGRFNILI 119 G K I+F TK+ D+L+ + + + +HGD SQS+R+ L+ FR GR IL+ Sbjct: 102 RSQEPGSKIIIFCSTKKMCDQLSRNLTRQFGAAAIHGDKSQSERDYVLNQFRSGRTPILV 161 Query: 120 ATDVAARGLDVPNVDLIIHYELPNTSETFVHXXXXXXXXXXXXSAILIYTDQQAR 174 ATDVAARGLD+ ++ ++I+Y+ P E +VH A + DQ A+ Sbjct: 162 ATDVAARGLDIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAK 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83855 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6443 (77 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18106185 (418 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73025 (382 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 157 4e-40 >Contig31581 Length = 128 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGM 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 137 IQKESTLHLVLRLRGGM 153 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 213 IQKESTLHLVLRLRGGM 229 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 289 IQKESTLHLVLRLRGGM 305 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 156 bits (395), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 76/76 (100%), Positives = 76/76 (100%) Query: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 365 IQKESTLHLVLRLRGG 380 IQKESTLHLVLRLRGG Sbjct: 61 IQKESTLHLVLRLRGG 76 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74143 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105224 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69106190 (396 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14799 225 1e-60 >Contig14799 Length = 428 Score = 225 bits (573), Expect = 1e-60, Method: Compositional matrix adjust. Identities = 122/297 (41%), Positives = 181/297 (60%), Gaps = 9/297 (3%) Query: 103 LKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIAEAPKT 162 L G +F W+ LNV+FNI NKKV N FPYP+ S + L G + LVSW+ + + Sbjct: 121 LITGFFFFMWYLLNVIFNILNKKVYNYFPYPYFVSVIHLLVGVVYCLVSWSVGLPKRAPI 180 Query: 163 DLEFWKSLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLFGETLPMP 222 D E L PVA H +GHV + VS + VAVSFTH IK+ EP F+ S+F+ G +P+ Sbjct: 181 DKEQLALLTPVAFCHALGHVMSNVSFAAVAVSFTHTIKALEPFFNASASQFVLGHHIPLS 240 Query: 223 VYMSLLPIIGGCALAAVTELNFNMIGFMGAMISNLAFVFRNIFXXXXXXXXXXXXXNYYA 282 +++SL P++ G ++A++TEL+FN +GF AMISN+AF +R+I+ N YA Sbjct: 241 LWLSLAPVVIGVSMASLTELSFNWLGFGSAMISNIAFTYRSIY--SKKAMTGMDSTNVYA 298 Query: 283 CLSMMSLLILTPFAIAVEGPQMWAAGWQKAIAQIGP-NFV---WWVAAQSIFYHLYNQVS 338 +S+++LL+ P AI +EGPQ+ G++ AIA++G FV +W+ +FYHLYNQ++ Sbjct: 299 YISIIALLVCIPPAILIEGPQLMQYGFKDAIAKVGLYKFVSDLFWIG---MFYHLYNQLA 355 Query: 339 YMSLDQISPLTFSIGNTMKRXXXXXXXXXXFHTPVQPVNALGAAIAILGTFIYSQAK 395 +L++++PLT ++GN +KR F + +G AIAI G IYS K Sbjct: 356 TNTLERVAPLTHAVGNVLKRVFVIGFSIVVFGNKISTQTGIGTAIAIAGVAIYSLIK 412 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67856 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30488 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24121 140 6e-36 >Contig24121 Length = 439 Score = 140 bits (352), Expect = 6e-36, Method: Composition-based stats. Identities = 66/83 (79%), Positives = 77/83 (92%) Query: 10 RTRVGKYELGRTLGEGSFAKVKFARNTETGENVAIKILDKEKVLKHKMIGQIKREISTMK 69 + RVGKYE+GRT+GEG+FAKVKFARN+ETGE VA+KILDKEKVLKHKM QIKREI TMK Sbjct: 7 KRRVGKYEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMK 66 Query: 70 LIRHPNVIRMYEVMASKTKIYIV 92 LI+HPNV+++YEVM SKTKI+IV Sbjct: 67 LIKHPNVVQLYEVMGSKTKIFIV 89 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30197 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24121 309 3e-86 >Contig24121 Length = 439 Score = 309 bits (791), Expect = 3e-86, Method: Compositional matrix adjust. Identities = 152/230 (66%), Positives = 188/230 (81%), Gaps = 7/230 (3%) Query: 1 MAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEW 60 +AGYLPF++SNLM LYKKI A+F PPW S A KLI+RILDPNP+TR+T+AE++E+EW Sbjct: 208 LAGYLPFDDSNLMNLYKKISAAEFTCPPWLSFGAMKLIARILDPNPMTRVTIAEILEDEW 267 Query: 61 FKKGYKPPSFEQP-NIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQG 119 FKK YK P FE+ N +LDDV+++F +S + V E++EE PVA MNAFELIS S+G Sbjct: 268 FKKDYKAPVFEEKENTNLDDVEAVFKDSEEHH--VTEKKEEQPVA---MNAFELISMSKG 322 Query: 120 LNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGR 179 LNL +LF+ + G KRETRFTSK P NEII KIEEAA PLGFDV K N+KL+L+ K GR Sbjct: 323 LNLGNLFDVEQGF-KRETRFTSKCPANEIIHKIEEAAKPLGFDVHKKNYKLRLENMKAGR 381 Query: 180 KGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKS 229 KG+L+VATEIF+VAPSL+MVE+RK+ GDTLEFHKFYKNL+TGL+DVVWK+ Sbjct: 382 KGNLNVATEIFQVAPSLHMVEVRKAKGDTLEFHKFYKNLATGLEDVVWKT 431 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72430 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4401 (355 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs117106181 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27547 351 6e-99 >Contig27547 Length = 219 Score = 351 bits (900), Expect = 6e-99, Method: Compositional matrix adjust. Identities = 165/219 (75%), Positives = 182/219 (83%) Query: 1 MSQKSLIYAFVARGNVVLAEYTEFSGNFNSIAYQCLQKLPASNNKFTYNCDAHTFNYLVD 60 M Q+SLIY+FVARG V+LAEYTEF+GNF SIA QCLQKLPA+NNKFTYNCD HTFNYLVD Sbjct: 1 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVD 60 Query: 61 NGYTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQY 120 NG+TYCVVA E+ GRQ+P+AFLER+K++F+ +YGGGKAATA AN LNKEFG KLKE MQY Sbjct: 61 NGFTYCVVAVEAVGRQVPIAFLERIKEDFIGRYGGGKAATAVANSLNKEFGSKLKEHMQY 120 Query: 121 CVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTG 180 CVDHPEEISKL+KVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENL QAQDFR G Sbjct: 121 CVDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQG 180 Query: 181 TKMRRKMWLQNMXXXXXXXXXXXXXXXXXXXSVCHGFNC 219 T+MRRKMW QNM SVC+GF C Sbjct: 181 TQMRRKMWFQNMKIKLIVLGILIALILIIVLSVCNGFKC 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18129 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25471 97 2e-22 >Contig25471 Length = 119 Score = 97.4 bits (241), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 47/63 (74%), Positives = 53/63 (84%) Query: 57 FSVKMFFKGMSITEVGESSSGFSGIGVVMERSFNIPIMQVQKKLDFFVEESVADYLALMD 116 FSVKMFFKGMSI G++S G SGIGVVMERS N+ +QVQK LDF+VEE VADYLALMD Sbjct: 57 FSVKMFFKGMSIAGYGDASCGLSGIGVVMERSTNVRAIQVQKTLDFYVEEPVADYLALMD 116 Query: 117 GLI 119 GL+ Sbjct: 117 GLM 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66981 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30223 (379 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31405 75 2e-15 >Contig31405 Length = 317 Score = 75.5 bits (184), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 64/241 (26%), Positives = 106/241 (43%), Gaps = 11/241 (4%) Query: 76 ILKNEGLKGLYRGLSPTLLALLPNWAVYFAVYERLKGLLRTHGDGNSQLSVGKNMXXXXX 135 I + EG+K L+ G+S T+L +YE LK GN L + + + Sbjct: 84 IFQTEGVKALFSGVSATVLRQTLYSTTRMGLYEILKVKWADPNSGN--LPLARKIFAGLV 141 Query: 136 XXXXXXXXXNPLWVVKTRLQTQGMRSNVVPYKSILSALRRISHEEGMRGLYSGILPSLAG 195 NP V R+Q G YK+++ A+ +++ EG+ L+ G ++ Sbjct: 142 AGGVGAAVGNPADVAMVRMQAGGRD-----YKNVIDAISKMARSEGVLSLWRGSSLTVNR 196 Query: 196 VSHV-AIQFPAYERIKHYMAKKDDTDVDKLNPGSVMIASSIAKVLASVITYPHEVVRSRL 254 V A Q +Y++IK + D + K G+ + AS A +ASV + P +V+++R+ Sbjct: 197 AMIVTASQLASYDQIKEAIL---DRHLMKDGLGTHVTASFAAGFVASVASNPIDVIKTRV 253 Query: 255 QEQGQNRKVDVQYAGVVDCVKKVFQKEGFPGFYRGCATNLLRTTPSAVITFTSYEIIQSF 314 D Y G +DC K + EG Y+G + R P V+ F + E I+ Sbjct: 254 MNMKVEAGRDPPYTGALDCALKTVRAEGPMALYKGFIPTISRQGPFTVVLFVTLEQIRKV 313 Query: 315 L 315 L Sbjct: 314 L 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98775 (146 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93807 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2557 251 5e-69 >Contig2557 Length = 195 Score = 251 bits (642), Expect = 5e-69, Method: Compositional matrix adjust. Identities = 117/153 (76%), Positives = 137/153 (89%) Query: 27 DVPFIVAHKKASLKRLKSGAERVSVSVDIYNQGTSTAYDVSLTDDSWPQDKFDVISGNIS 86 D+PFIVAHKKASL RLKSG ERV VS+DIYNQG+STAYDVSL+DDSWPQD F+V+SGN S Sbjct: 27 DLPFIVAHKKASLNRLKSGVERVLVSIDIYNQGSSTAYDVSLSDDSWPQDIFEVVSGNTS 86 Query: 87 QSWERLDAGGILSHSFELDAKVKGMFHGSPALITFRIPTKAALQEAYSTPMLPLDVLAEK 146 +SWERLDAG I+SHSFEL+AK K +F+G+PALITFRIPTKAALQE+YSTP+ PLDVLA++ Sbjct: 87 KSWERLDAGAIISHSFELEAKEKLLFNGAPALITFRIPTKAALQESYSTPIFPLDVLADR 146 Query: 147 PTENKLELAKRLLAKYGSQISVISIIVLFVYLI 179 P E K + KR LAKYGS ISV+SI+VLFVYL+ Sbjct: 147 PPEKKFQWVKRFLAKYGSLISVVSIVVLFVYLV 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21536 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74366 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226801430 92 4e-21 >226801430 Length = 222 Score = 92.4 bits (228), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 47/135 (34%), Positives = 74/135 (54%), Gaps = 3/135 (2%) Query: 11 VVYVGSRLGADLLSNAISVTTGMKALSIHGEKPMKERREIMRSFLVGEVPVIVATXXXXX 70 +V+V ++ GAD L + + + G A +IHG++ +ER + +RSF G P++VAT Sbjct: 77 LVFVETKKGADSLEHWLCMN-GFPATTIHGDRSQQEREQALRSFKSGNTPILVATDVAAR 135 Query: 71 XXXXXXXXXXXXFDMPNSIKEYVHQIGRASQMGEEGTAIVFVNEENKNLFQELVDILKSS 130 FD+PN I +YVH+IGR + G+ G A F NE N +L + L ++++ S Sbjct: 136 GLDIPHVAHVVNFDLPNDIDDYVHRIGRTGRAGKSGLATAFFNENNSSLARSLSELMQES 195 Query: 131 GAGIPRELINSRYTV 145 +P L SRY Sbjct: 196 NQEVPAWL--SRYAA 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45360 (378 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29071 216 7e-58 >Contig29071 Length = 194 Score = 216 bits (549), Expect = 7e-58, Method: Compositional matrix adjust. Identities = 103/146 (70%), Positives = 120/146 (82%), Gaps = 3/146 (2%) Query: 60 GGKCNIFQGKWVYDASY--PLYSH-CPFVDPEFDCQKYGRPDDIYLKYRWQPFSCSIPRF 116 GKCN F+G WVYDAS P YS CPFVDP+FDC KYGRPD +LKYRWQPFSC++PRF Sbjct: 49 AGKCNWFRGTWVYDASSKPPYYSSTCPFVDPQFDCLKYGRPDTAFLKYRWQPFSCALPRF 108 Query: 117 NGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWVPKTKYSVVRTAVLSSITFQEFGL 176 NGLYFLEK+RGKKIMFVGDSLS NQW SL CM+H+WVP ++ S V+ L+S+TFQ++G+ Sbjct: 109 NGLYFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTSYVKKDGLASVTFQDYGV 168 Query: 177 QILLYRTTYLVDLVREPAGTVLRLDS 202 QILLYRT YLVDLV E G VL+LDS Sbjct: 169 QILLYRTPYLVDLVNEKVGRVLKLDS 194 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102752 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100171 (92 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94822 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42616 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1132 473 e-135 >Contig1132 Length = 265 Score = 473 bits (1217), Expect = e-135, Method: Compositional matrix adjust. Identities = 230/265 (86%), Positives = 241/265 (90%) Query: 1 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSAPQSIWYGPDRPKYLGP 60 MATSAIQQSAFAGQTAL+QS+E VRK+G GGR +MRRTVKSAPQSIWYGPDRPKYLGP Sbjct: 1 MATSAIQQSAFAGQTALKQSSELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP 60 Query: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK 120 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS+ Sbjct: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSR 120 Query: 121 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXX 180 NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+ Sbjct: 121 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGP 180 Query: 181 XXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE 240 AFDPLGLADDP+ FAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+E Sbjct: 181 LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE 240 Query: 241 NLYDHIADPVANNAWAYATNFVPGK 265 NL+DHIADPVANNAWAYATNFVPGK Sbjct: 241 NLFDHIADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75309 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14657 173 1e-45 >Contig14657 Length = 175 Score = 173 bits (438), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 83/131 (63%), Positives = 96/131 (73%), Gaps = 13/131 (9%) Query: 2 VNRRVAEGALKKHGAIVTCVDCGRAAVDKLTPPHNFDACFMDLQMPEMDGFQATWQIRHL 61 VN RVA GALKK+GA V C D G+ A+ LTPPH+FDACFMD+QMPEMDGF+AT +IR L Sbjct: 52 VNLRVAAGALKKYGAEVICADSGKKAISLLTPPHHFDACFMDIQMPEMDGFEATRRIRDL 111 Query: 62 ENEINEQIASGESSAEMFGNVGLWHVPILAMTADVIQASNEQCMKCGMDDYVSKPFEDEQ 121 E I+ I + WHVPILAMTADVIQA++E+C KCGMD YVSKPFE EQ Sbjct: 112 ERNISNSIQA-------------WHVPILAMTADVIQATHEECTKCGMDGYVSKPFEAEQ 158 Query: 122 LYTAVARFFMS 132 LY V+RFF S Sbjct: 159 LYREVSRFFQS 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105081 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67511 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24696 (218 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32840 114 1e-27 >Contig32840 Length = 103 Score = 114 bits (285), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 52/70 (74%), Positives = 57/70 (81%) Query: 143 DVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFD 202 DVRNHPVLIHCKRGKHRTGCLVGCLRK Q WCLSSVF+EYQRFA K+R +D RF+E FD Sbjct: 4 DVRNHPVLIHCKRGKHRTGCLVGCLRKFQNWCLSSVFEEYQRFAGVKSRPTDLRFIEGFD 63 Query: 203 ISSLKHLPMS 212 I L+ S Sbjct: 64 IMLLRQCLYS 73 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91241 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs49471 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76512 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48489292 81 3e-18 >48489292 Length = 105 Score = 81.3 bits (199), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 41/75 (54%), Positives = 49/75 (65%) Query: 1 MDMAVLVEAQGEILDNIESQVSNAVTNVQSGTTALQSAKKHQKSSRKWMCXXXXXXXXXX 60 +DMAVLV+AQG++L+NIE+QVS+AV +VQ G ALQ AKK QKSSRKWMC Sbjct: 29 LDMAVLVDAQGDLLNNIETQVSSAVDHVQQGNNALQKAKKLQKSSRKWMCIAILILLIIV 88 Query: 61 XXXXXXXXKPWKSGN 75 KPW S N Sbjct: 89 AIIAVAVLKPWSSNN 103 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1214 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92350 (61 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76516 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8750 309 4e-86 >Contig8750 Length = 294 Score = 309 bits (791), Expect = 4e-86, Method: Compositional matrix adjust. Identities = 151/294 (51%), Positives = 200/294 (68%), Gaps = 19/294 (6%) Query: 8 FSLFVGLLMVVLVSSA---------KFDDLYQTSWAFDHVQY--DGDTLKLNLDNYSGAG 56 +++F+ LL +V + A F Y +WAFDH++Y G ++L+LD Y+G G Sbjct: 7 WTVFLSLLCLVSATVAAPPKKPVAVPFGRNYMPTWAFDHIKYFNGGKEIQLHLDKYTGTG 66 Query: 57 FASKSKYLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTN 116 F SK YLFG +QIK+V GDSAGTVTA+Y+SS H+E DFEFLGN TG+PY++QTN Sbjct: 67 FQSKGNYLFGHFHMQIKMVPGDSAGTVTAYYLSSQNNEHDEIDFEFLGNRTGQPYILQTN 126 Query: 117 VYVNGVGNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKD 176 V+ G G+REQR+ LWFDPT +H+Y++LWN Q+VFLVD+ PIRV N + G+ FP + Sbjct: 127 VFTGGKGDREQRIFLWFDPTAAYHSYAVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFN 186 Query: 177 QAMGVYSSIWNADDWATQGGRVKTDWSHAPFIASYKGFDIDACECPASVAGADNAKKCSS 236 Q M +YSS+WNADDWAT+GG KTDWS APFIASY+GF ID CE ASV AK C++ Sbjct: 187 QPMKLYSSLWNADDWATRGGLEKTDWSKAPFIASYRGFHIDGCE--ASV----EAKYCAT 240 Query: 237 SAEKRFWWDEPTLSELNVHQSHQLMWVRANHLIYDYCTDTSRFPAIPTECVHHR 290 ++ WWD+ +L+ Q +L WVR IY+YCTD R+P++P EC R Sbjct: 241 QGKR--WWDQKEFQDLDAQQWRRLRWVRKKFTIYNYCTDRVRYPSMPPECKRDR 292 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11412 (222 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103596 (61 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57664 (171 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24234 128 5e-32 >Contig24234 Length = 174 Score = 128 bits (322), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 83/176 (47%), Positives = 104/176 (59%), Gaps = 7/176 (3%) Query: 1 MLENPXXXXXXXXXXXXVVKRYAPPNQRNRSLNRRKSGDR---SSNLYG-NDGEKNQLAA 56 MLENP VVKRYAPPNQRNR LNRRKS DR ++N +G +D EK+Q+++ Sbjct: 1 MLENPPSAAAAAADPGAVVKRYAPPNQRNRPLNRRKSADRFDRTNNPHGGSDMEKSQISS 60 Query: 57 LRNAAVTDHGDSGSSNFANVNSQPRLVPLEGFSRSEGAQLLKDRGRAIWNLFHDPSIDLS 116 RN +V DHGD GSS+ + L+ LEG SE QLL R A F+DPS+DL Sbjct: 61 SRNISVMDHGD-GSSSSLLNENSRGLIALEGCCTSEAFQLLHSRWAAAMRCFNDPSVDLP 119 Query: 117 ERPVLYSSGASHLG-VKLPHQMQPPTNSMGSTSGTQMDFLAELRRKMQASGASFDN 171 ERPV+Y+ +S G LPHQ+ T GS G+ MDFL+E R S A F+ Sbjct: 120 ERPVMYTGSSSAWGPFLLPHQLMASTVGAGSP-GSPMDFLSEPCRSKNISSAGFET 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68303 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73743 (111 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105095 (141 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94093 (207 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24831 230 1e-62 >Contig24831 Length = 317 Score = 230 bits (587), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 105/190 (55%), Positives = 140/190 (73%) Query: 18 PVFLQHGLLMDAVTWLLLPPEQSLAFLLADNGYDVWLANTRGTKYSRGHVSLSPDDSAFW 77 PV +QHG+L+D VTWLL P+++L +LADNG+DVW+ANTRGT++SR H S+ PDD FW Sbjct: 94 PVLIQHGVLVDGVTWLLNSPDRNLPLILADNGFDVWIANTRGTRFSRQHTSMDPDDPKFW 153 Query: 78 DWTWDELVAYDLPATLQHVHDQTGQKPHYVGHSLGTLIALASFSKDQPVNKLRSAALLSP 137 +W+WDELVA+DLPA V+ + GQK +YVGHS GTLI LAS S+ + V++++SAALLSP Sbjct: 154 NWSWDELVAFDLPAVFDFVYGKAGQKINYVGHSQGTLIVLASLSEGKLVDQMKSAALLSP 213 Query: 138 IAYVGQMTSPLAKNAADHFLAEALYWLGLDEFDPRGEAVVKLLKNICQKPGVDCTNLLNS 197 IAY+ M + L AA F+ E GL EF+P+G+ + L +C PGVDC +LL + Sbjct: 214 IAYLSHMKTALGVAAAKTFVGEITTLFGLAEFNPKGDPETQYLDALCAYPGVDCYDLLQA 273 Query: 198 FTGQNCCLNS 207 TG+NCCLNS Sbjct: 274 VTGKNCCLNS 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65078 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79560 (319 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30395 391 e-111 >Contig30395 Length = 274 Score = 391 bits (1005), Expect = e-111, Method: Compositional matrix adjust. Identities = 183/276 (66%), Positives = 221/276 (80%), Gaps = 5/276 (1%) Query: 44 EFMDTVERLTKAHYRKCMEQRFKELVASRALEGIQTEVNDMDWESTFYVRHLPQSTINEV 103 + +DTV+++TK HY+K MEQRFKE+VA++ L+ +Q+E++D+DWESTF++RHLP S I+E+ Sbjct: 4 DLLDTVDKMTKDHYKKTMEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEI 63 Query: 104 PDLDEEYRKVMXXXXXXXXXXXXXXXXXXXXXXXXXXGYLKKVFHGANGPTFGTKVSNYP 163 PDL+EEYRK M GYLKKVF+G+ GP FGTKVSNYP Sbjct: 64 PDLEEEYRKTMKEFAVELEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYP 123 Query: 164 PCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEV 223 PCPKPDLIKGLRAH+DAGGIILLFQDDKVSGLQLLKDG+W+DVPP+ HSIV+NLGDQIEV Sbjct: 124 PCPKPDLIKGLRAHSDAGGIILLFQDDKVSGLQLLKDGEWVDVPPMHHSIVINLGDQIEV 183 Query: 224 ITNGKYKSVEHRVVSQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKKQVYPKFVFE 283 ITNGKYKSV HRV++Q+DG RMS+ASFYNPG+D+ I PAPA+LEK+ E YPKFVF+ Sbjct: 184 ITNGKYKSVMHRVIAQSDGT-RMSIASFYNPGNDSFISPAPAVLEKKTEDAPTYPKFVFD 242 Query: 284 DYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIATA 319 DYMKLY LKFQAKEPRFEAMKA E+ P+ATA Sbjct: 243 DYMKLYSGLKFQAKEPRFEAMKAKEST----PVATA 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51828 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6904 87 1e-19 >Contig6904 Length = 421 Score = 87.4 bits (215), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 52/126 (41%), Positives = 74/126 (58%), Gaps = 9/126 (7%) Query: 1 FIQSPQYFYDRPE------NLCILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQI 54 F+Q PQ FYD E N+ + I G+ GIQGP Y GTG FHRR V+YGL L Sbjct: 40 FVQFPQMFYDTLEDDPFGSNVVEAVKKIWPGLAGIQGPIYAGTGCFHRRKVIYGLSL--T 97 Query: 55 EHQGNIVEDELLKK-FGNSKEFIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGS 113 +++GN+ + L K+ FGNS E I+SA Q L + ++S +++ A++VA YE + Sbjct: 98 DNEGNLTSERLNKECFGNSPELIRSATQILLEENIDQLDDLSCAVEIAYQVAGSEYEDDT 157 Query: 114 SWGDEV 119 WG +V Sbjct: 158 LWGKKV 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28926 (71 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6102 80 9e-18 >Contig6102 Length = 212 Score = 79.7 bits (195), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 39/55 (70%), Positives = 44/55 (80%) Query: 1 MCVHEQPDMRPVIADVVTALAYLASQKYESDAEKVQSPCLDPGTPTRTKRDKERK 55 MCV EQP+MRPVIADVVTAL YLASQKY+ + E VQS L P TP RTKRD E++ Sbjct: 154 MCVQEQPNMRPVIADVVTALTYLASQKYDHETEPVQSSRLAPCTPPRTKRDIEKE 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52976 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26935 344 8e-97 >Contig26935 Length = 201 Score = 344 bits (882), Expect = 8e-97, Method: Compositional matrix adjust. Identities = 167/206 (81%), Positives = 183/206 (88%), Gaps = 5/206 (2%) Query: 1 MTLSDEEIKRLFRIRRTVMQMLRDRGYFVGDFEINMSKEQFIAKFGENMKREDLVINKAL 60 M L++EEI RL+R+R+TVMQML+DR Y VGDFEINMSKEQF K+GENMKREDL+INK Sbjct: 1 MVLTEEEITRLYRVRKTVMQMLKDRNYLVGDFEINMSKEQFKDKYGENMKREDLIINKTK 60 Query: 61 RNDSSDQIYVFFPDEQKVGVKTMKTYTNRMKSENVFRAILVVQQNLTPFARTCIQEISAK 120 R D++DQIYVFFPDE KVGVKTMKTYTNRMKSENVFRAILV QQ+LTPFA+TCI EIS K Sbjct: 61 RTDTNDQIYVFFPDEPKVGVKTMKTYTNRMKSENVFRAILVTQQSLTPFAKTCISEISGK 120 Query: 121 FHLEVFQEAELLVNIKEHVLVPEHQVLTNEEKKTLLKRYTVKETQLPRIQVTDPXCRYYG 180 FHLEVF EAELLVNIKEHVLVPEH+VLTNEEKKTLL+RYTVKETQL T P +YYG Sbjct: 121 FHLEVFLEAELLVNIKEHVLVPEHRVLTNEEKKTLLERYTVKETQL-----TQPIAKYYG 175 Query: 181 LKRGQVVKIIRPSETAGRYVTYRYVV 206 LKR QVVKIIRPSETAGRYVTYRYV+ Sbjct: 176 LKRAQVVKIIRPSETAGRYVTYRYVI 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35363 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77599 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51219 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24056 156 3e-40 >Contig24056 Length = 423 Score = 156 bits (394), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 84/188 (44%), Positives = 118/188 (62%), Gaps = 6/188 (3%) Query: 5 EHTSIEFTGTDRPGLFSEVCAVLADLHCNVENAEIWTHNDRAAAVVHVTDHSTGYAIKDP 64 +HT+IE G DRPGL SE+ AVLA+LH NV A++WTHN+R A VV+V D +T ++D Sbjct: 127 DHTAIELIGRDRPGLLSEISAVLANLHFNVIAADVWTHNERIACVVYVNDDTTCQTMEDQ 186 Query: 65 KRLSTIKELLFNVLRGYDDFRKAKTSLSPPGIMNRERRLHQIIFDDRDYERVEKAVGRVE 124 RLST++E L N+LRG +D K + G + +RRLHQ++F DRDYE + Sbjct: 187 ARLSTMEEQLKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYE--GGGLAHEV 244 Query: 125 DK---SSRPQVTVLNI-EKDYTVITMRSKDRPKLLFDIVCTSTDMPYVVSHGMGNHGRPK 180 D +P++ + EK Y+V+++R KDR KL+FDIVCT TDM YVV H + P Sbjct: 245 DHFPPCFQPKIAIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISSDGPY 304 Query: 181 LIRKFIFR 188 +++ R Sbjct: 305 ASQEYFIR 312 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103388 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs130106184 (411 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82372 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24831 179 2e-47 >Contig24831 Length = 317 Score = 179 bits (454), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 91/132 (68%), Positives = 108/132 (81%), Gaps = 5/132 (3%) Query: 23 AYGSSRGWL-GRAGDATAAQEIGICASSVIIHGYKCQEIDVTTKDGYILNLQRIPEGRAA 81 AYGS+ L GR DA AA +GICASSV+++GY CQE +VTT+DGYIL+LQRIPEGR + Sbjct: 22 AYGSAWDSLFGRKQDAAAAPTVGICASSVVVYGYPCQEFEVTTQDGYILSLQRIPEGRGS 81 Query: 82 GGVQ----IKRPPVLIQHGVLVDGLTWLLNPPEQNLPLILADHGFDVWIANTRGTRFSRR 137 G IK+PPVLIQHGVLVDG+TWLLN P++NLPLILAD+GFDVWIANTRGTRFSR+ Sbjct: 82 GSSGGGGGIKKPPVLIQHGVLVDGVTWLLNSPDRNLPLILADNGFDVWIANTRGTRFSRQ 141 Query: 138 HTSLDPSQMVFF 149 HTS+DP F+ Sbjct: 142 HTSMDPDDPKFW 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53942 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28826 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14424 146 5e-37 >Contig14424 Length = 111 Score = 146 bits (368), Expect = 5e-37, Method: Compositional matrix adjust. Identities = 69/84 (82%), Positives = 75/84 (89%) Query: 194 KSVKSSLPPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSG 253 K+ SS PPLKCPMAGTFYR PAPGEP FVKVGD+VQKGQV+CIIEAMKLMNEIEAD+SG Sbjct: 28 KTSTSSHPPLKCPMAGTFYRCPAPGEPSFVKVGDKVQKGQVICIIEAMKLMNEIEADQSG 87 Query: 254 TIVEIIAEDRKPVSVDTPLFVIEP 277 T+ EI+ ED KPVSVDTPLFVI P Sbjct: 88 TVAEILVEDGKPVSVDTPLFVIVP 111 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16106187 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18718 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16002 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96496 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27266 (81 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26030 104 3e-25 >Contig26030 Length = 246 Score = 104 bits (260), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 49/67 (73%), Positives = 59/67 (88%) Query: 1 MVAAILMESEIKLPDDLLEAIIDKTFADADIDKDGRINKEEWKEFAVRNPSLLKNMTLPY 60 MV AILMES++KLPDD+LE II+KTFADAD DKDG+INKEEWK F +R+PSLLKNMTLPY Sbjct: 168 MVIAILMESDVKLPDDILEEIIEKTFADADADKDGKINKEEWKVFVLRHPSLLKNMTLPY 227 Query: 61 LTYVISL 67 L + ++ Sbjct: 228 LKDITTV 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94258 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64199 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52237 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87821 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78040 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87083 (297 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6568 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89889 (475 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17598 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32102 188 2e-50 >Contig32102 Length = 494 Score = 188 bits (477), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 83/108 (76%), Positives = 98/108 (90%) Query: 1 MSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFESHCGALS 60 MSHRMH+D ++KLIGKLLFGIEKGP++LN VRPAGQPLVDDW CLK++VR+FE+HCG+LS Sbjct: 387 MSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLS 446 Query: 61 QYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWRSLDKGFSA 108 QYGMKHMRSLANICN G+ +E+MAEASAQAC + PSG W SL +GFSA Sbjct: 447 QYGMKHMRSLANICNAGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA 494 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15890 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8059 127 9e-32 >Contig8059 Length = 222 Score = 127 bits (319), Expect = 9e-32, Method: Compositional matrix adjust. Identities = 61/85 (71%), Positives = 73/85 (85%), Gaps = 1/85 (1%) Query: 66 VWPPKFVIALTNKEKEEDFMAIKGSKLPQRPKKRAKFIQRTVNLVSPGAWLCDLTLERYE 125 VWP K I L++KEKEEDF+A+KG KLPQRPKKRAK IQR++ LVSPGAWL D+ ERYE Sbjct: 139 VWP-KLYITLSSKEKEEDFLAMKGCKLPQRPKKRAKLIQRSLLLVSPGAWLTDMCQERYE 197 Query: 126 VREKKISKKRPRGLKAMGSMDSDSE 150 VREKK +KK+ RGLKAMGS+++DSE Sbjct: 198 VREKKSTKKKSRGLKAMGSLETDSE 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78696 (73 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26081 (399 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64600 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39988 (142 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104648 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8447 433 e-123 >Contig8447 Length = 236 Score = 433 bits (1113), Expect = e-123, Method: Compositional matrix adjust. Identities = 207/236 (87%), Positives = 225/236 (95%) Query: 1 MLGVFSSAIVSPPEELVAAGSRTPSPKTTSTALVDRFLQTNSSAVSVQVGDNVTLAYTHQ 60 MLGVFSSAIVSPPEELVAAGSRTPSPK T+T+LV+RF+QTN +AVSVQVGD+ LAY+H Sbjct: 1 MLGVFSSAIVSPPEELVAAGSRTPSPKITATSLVNRFVQTNDAAVSVQVGDDAQLAYSHS 60 Query: 61 NESPLRQRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP 120 NES L+ RSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP Sbjct: 61 NESALQPRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP 120 Query: 121 PNHVVGHLSGYFAFIVYDKSTSTLFVASDQFGKVPLYWGITADGHVAFADDADLLKGACG 180 PNHVVGHLSG FAFIV+DKSTST+FVASDQFGK+PL WGITADG+VAFADDA+LLKGACG Sbjct: 121 PNHVVGHLSGNFAFIVFDKSTSTVFVASDQFGKIPLSWGITADGYVAFADDAELLKGACG 180 Query: 181 KSLASFPQGCFFSTAVGGLRSFENPKNKITAVPAAEEEIWGATFKVEGPAVFAATE 236 KSLASFPQGCF+ST+VGGLRS+ENPKNKITAVPA +EEIWGATFKVEGPAV AAT+ Sbjct: 181 KSLASFPQGCFYSTSVGGLRSYENPKNKITAVPATDEEIWGATFKVEGPAVLAATK 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3529 (355 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6779 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13337 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3170 (316 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43708 (321 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28412 575 e-166 >Contig28412 Length = 361 Score = 575 bits (1482), Expect = e-166, Method: Compositional matrix adjust. Identities = 277/321 (86%), Positives = 299/321 (93%) Query: 1 MGGVSESTFQIDRTGGENGAPTGLFKGVVSTANNGGFTSIRTRNFAEPEDLSAYDGLKLR 60 MGGVSESTFQIDR GGENG PTGLFKGVVSTANNGGF+SIRT+N EDLS YDGL+LR Sbjct: 41 MGGVSESTFQIDRNGGENGGPTGLFKGVVSTANNGGFSSIRTKNLPTAEDLSGYDGLELR 100 Query: 61 LKGDGRRYKFVVRTSSDWDTVGYTASFDTVGGQWQSIRLPFSSLRPIFQARTVLDAPPFD 120 LKGDGRRYK +VRTSSDWDTVGYTA FDTVG QWQ++R+PFSSL+PIF+ARTV DAPPFD Sbjct: 101 LKGDGRRYKLIVRTSSDWDTVGYTAGFDTVGNQWQTVRIPFSSLKPIFRARTVSDAPPFD 160 Query: 121 PSNIVSLQLMFSKFEYDGKLNPTFVEGAFQLPVSSIQSYIKDPVTPRFVHVSSAGVTRPE 180 PSN+VSLQLMFSKFEYDGKLNPTFVEG FQLP+SSI++Y+K+P+TPRFVHV SAGVTRPE Sbjct: 161 PSNVVSLQLMFSKFEYDGKLNPTFVEGPFQLPLSSIRAYLKEPITPRFVHVGSAGVTRPE 220 Query: 181 RPGLDLSKQPPAVRLNKELGFILTFKLKGEDLIRESGIPYTIVRPCALTEEPAGADLIFD 240 RPGLDLSKQPPAVRLNKEL FILT+KLKGEDLIRESGIPYTIVRPCALTEEPAGADLIFD Sbjct: 221 RPGLDLSKQPPAVRLNKELDFILTYKLKGEDLIRESGIPYTIVRPCALTEEPAGADLIFD 280 Query: 241 QGDNITGKISREEVARICVAALESPFALDKTFEVKSTIPFSESFTVDPENPPQEKDYNIY 300 QGDNITGKISREEVA+ICVAALESP+A KTFEVKS IPFS+ FTVDPENPP EKDY++Y Sbjct: 281 QGDNITGKISREEVAQICVAALESPYATGKTFEVKSVIPFSQPFTVDPENPPPEKDYDVY 340 Query: 301 FKGLKDGITGKESLEQSPVPV 321 FK LKDGITGKE LEQ PVPV Sbjct: 341 FKTLKDGITGKEILEQDPVPV 361 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69121 (366 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84151 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92660 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2545 174 1e-45 >Contig2545 Length = 305 Score = 174 bits (440), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 78/104 (75%), Positives = 92/104 (88%) Query: 96 MTIKPVVRIAERKLIVKDRTILTGVPDNLITTSGSTSGPVEGVFIGAAFDEESSRHVLPI 155 MTIKP VRI+ERKLIVKDRTILTG+PDN++ TSGS+SGPV+GVF+GA F EE SRHV+ + Sbjct: 1 MTIKPAVRISERKLIVKDRTILTGLPDNVVATSGSSSGPVDGVFLGANFSEEKSRHVVSL 60 Query: 156 GALRDIRFLACFRFKLWWMAQKMGDHGSEIPLQTQFLLVETKRG 199 G L +RF+ACFRFKLWWMAQKMGD G +IPL+TQFLL+ETK G Sbjct: 61 GTLTGVRFMACFRFKLWWMAQKMGDQGRDIPLETQFLLLETKHG 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73710 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95758 (103 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12111 127 6e-32 >Contig12111 Length = 588 Score = 127 bits (318), Expect = 6e-32, Method: Compositional matrix adjust. Identities = 57/80 (71%), Positives = 67/80 (83%), Gaps = 1/80 (1%) Query: 3 SGGSDLYYSTLNSEDGPFVVDFYYHSHIEYRWGGEGLRKTLVRWASQVTDKKAESGEKVL 62 + GSDLYY ++NSED PF VDFYYHSHIEYRWGGEGLRKTL+RWA+ V DKK S E ++ Sbjct: 374 NSGSDLYYPSINSEDRPFAVDFYYHSHIEYRWGGEGLRKTLLRWATSVNDKKTGS-EAIV 432 Query: 63 TPAEQLSTNYCYAFSVQKPG 82 + A+QLST+YCYAF VQ PG Sbjct: 433 SAADQLSTDYCYAFKVQAPG 452 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103490 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70246 (301 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24758 67 5e-13 >Contig24758 Length = 354 Score = 66.6 bits (161), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 67/249 (26%), Positives = 122/249 (48%), Gaps = 22/249 (8%) Query: 69 IFVAGATGSSGKRIVEQLLAKGFAVKAGVRDL----------DKAKTTLSKDNPSLQIVK 118 +FVAGATG +G RI + LL +GF+V+AGV +L K K ++++ L V+ Sbjct: 105 VFVAGATGQAGVRIAQTLLREGFSVRAGVPELGAAQELARVASKYKIISNEESKRLNAVE 164 Query: 119 ADVTEGSAKLSEAIGDDSEAVVCATGFRPGWDLFAPWKVDNFGTVNLVEACRKRGVNRFI 178 + V + + +++AIG+ S+ VV G +V F + +++A + GV Sbjct: 165 S-VFQDAESIAKAIGNASKVVVTIGPAENG----PTTEVTPFDALQVIQAAQLAGVGHVA 219 Query: 179 LISSILVNGAAMGQILNP-AYIFLNVFGLT-LIAKLQAEQYIRKSGINYTIIRPGGLRNE 236 +I G++ +L+ + F N+F T L+ + Q + + ++YT I+ + Sbjct: 220 IIYDGNSVGSSTNNVLDGISSFFNNLFSQTQLLTVAEFLQKVIEMDVSYTFIKTSLTEDF 279 Query: 237 PPTG--NIVMETE--DTLYEGTISRDQVAEVAVEALLHPE-SSYKVVEIISRVDAPKRSY 291 P NIVM E + +++ Q+A + + + + KVVE+ + AP R Sbjct: 280 SPESSYNIVMSAEGGGGANDYKVAKSQIAALVADVFSNTSMAENKVVEVYTDPSAPMRPV 339 Query: 292 EDLFGSIKQ 300 + LFG+I + Sbjct: 340 DQLFGTIPE 348 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25743 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9187 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs143106181 (380 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28141 70 5e-14 >Contig28141 Length = 174 Score = 70.1 bits (170), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 30/71 (42%), Positives = 48/71 (67%) Query: 1 MSRPRSVYLVDFACYRPSDDLKVTREQFIEVAGKWSKSDEASLDFQRRIMKSSGIGDETY 60 ++RPR VYLV+F+CY+P + K T++ F+E + E +L FQRRI++ SG+GD TY Sbjct: 101 VTRPRPVYLVNFSCYKPEESRKCTKKIFMEQSQMTGTFTEDNLQFQRRILERSGLGDSTY 160 Query: 61 IPKVVMSAEEN 71 +P+ ++ N Sbjct: 161 LPEAGLNIPPN 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65106187 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26661 82 8e-18 >Contig26661 Length = 146 Score = 81.6 bits (200), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 39/85 (45%), Positives = 59/85 (69%) Query: 46 IKKATWIELKNLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAY 105 +K+ WIE+K ++ +A PAI + + + +Q F GH+G+LELAA SL T + F Sbjct: 32 LKRRVWIEIKKMWLVAGPAIFTRVASFGTNVVSQAFIGHIGSLELAAFSLVFTVLVRFGN 91 Query: 106 GLMLGMGSATETLCGQAYGAQKYDM 130 G++LGM SA ETLCGQ++GA++Y+M Sbjct: 92 GILLGMASALETLCGQSHGAKQYNM 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53960 (361 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77271 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5264 66 1e-13 >Contig5264 Length = 188 Score = 66.2 bits (160), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 36/82 (43%), Positives = 49/82 (59%), Gaps = 6/82 (7%) Query: 1 MLGYAEEDQTTVLELAYSYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITR 60 LG+ ED V+EL Y+YGV+ Y G + AI+T DV K E V + GG +TR Sbjct: 66 FLGFGPEDSHFVVELTYNYGVSSYDIGTGFGHFAIATPDVKKLVEDV----RAKGGNVTR 121 Query: 61 QPGPIPGLNTKITSFV-DPDGW 81 +PGP+ G T + +FV DPDG+ Sbjct: 122 EPGPVKG-GTSVIAFVKDPDGY 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78626 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61560 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30575 169 2e-44 >Contig30575 Length = 332 Score = 169 bits (428), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 78/119 (65%), Positives = 96/119 (80%) Query: 1 MWRNLLIQASYQVSVLLVLNFQGKRILNLESDSNAHSNKVKNTLIFNSFVLCQIFNEFNA 60 MWRNLL+QA YQV+VLLVLNF+G RIL L+ D H+ VKNTLIFN+FV CQIFNEFNA Sbjct: 213 MWRNLLVQAMYQVTVLLVLNFKGNRILGLQKDVQKHAIGVKNTLIFNAFVFCQIFNEFNA 272 Query: 61 RKPDEKNIFGGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFI 119 RKP+E N+F G+TKN LFMGI+ +TLVLQI+I+ FLGKF T RL+W+ W+I + I + Sbjct: 273 RKPEEINVFIGVTKNYLFMGIIGITLVLQIIIVMFLGKFTKTVRLSWQQWLICLGIAIV 331 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9739 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4062 186 2e-49 >Contig4062 Length = 281 Score = 186 bits (472), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 96/201 (47%), Positives = 127/201 (63%), Gaps = 7/201 (3%) Query: 1 MQRIFAEAGKIKSICIRDPNVVEESKKSSKYEYLVSNKLHAFXXXXXXXXXXXXXXTLND 60 ++ IF EAGKIK +CI DP+ +E S K K E L+SNKLHA TL + Sbjct: 85 LKTIFGEAGKIKDLCILDPHALEASTKGGKTEKLISNKLHALVEYDTVEAADKAVTTLRN 144 Query: 61 EQDWRNGLRVKLLKRMGNYGQRRQAWRGSDYEKNNSGRTSDPAGNEEHQNSNDRYDD--T 118 E DWRNG+RVKLLK++G YGQR+Q WRG D EK++ R++D G+EE+ +++++D T Sbjct: 145 EGDWRNGMRVKLLKQVGKYGQRKQPWRGFDSEKSSGNRSNDQTGDEENHTVSEKHNDART 204 Query: 119 PDEEEGEHLSNSKEKNDXXXXXXXXXXXXXXXXXXPNGLGHGTTSS-HALEPTKPPPGPR 177 DEE+GE + K + NG GHGTTS+ H +EP+KPPPGPR Sbjct: 205 TDEEDGERVPKEKTGH----RGRNRGQSGRQKYRGTNGFGHGTTSANHGIEPSKPPPGPR 260 Query: 178 MPDGTRGFSMGRGRPPISNQS 198 MPDGTRGF+MGRGR P + Q+ Sbjct: 261 MPDGTRGFTMGRGRTPSTAQT 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79393 (371 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48411817 233 4e-63 >48411817 Length = 154 Score = 233 bits (594), Expect = 4e-63, Method: Compositional matrix adjust. Identities = 113/134 (84%), Positives = 117/134 (87%) Query: 6 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMT 65 EITNV EYEA+AKEKLPKMVYDYYASGAEDQWTL ENRNAF+RILFRPRIL DVS+IDMT Sbjct: 21 EITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDMT 80 Query: 66 TTVLGFNISMPIMIAPTAFQKMAHPEGECXXXXXXXXXGTIMTLSSWATSSVEEVSSTGP 125 TTVLGF ISMPIMIAPTA QKMAHPEGE GTIMTLSSWATSSVEEV+STGP Sbjct: 81 TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 140 Query: 126 GIRFFQLYVTKHRN 139 GIRFFQLYV K RN Sbjct: 141 GIRFFQLYVYKDRN 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98329 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37247 (111 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3082 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65526 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81867 (293 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9543 68 2e-13 >Contig9543 Length = 535 Score = 68.2 bits (165), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 47/161 (29%), Positives = 75/161 (46%), Gaps = 6/161 (3%) Query: 36 LVGAYSWGLISDIYGRRMSILGGALVTFVAGLLSAFAPNYXXXXXXXXXXXXXXXXXHVF 95 L+G+ + G SD GRR +I+ + FV LL FA NY + Sbjct: 85 LIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGVGYALMI 144 Query: 96 FSWFMEFVPPSNRGKWMVVFSTFWT-----FGSVSEAALAWIVMPILTWRWLLALSAIPA 150 + V P++ ++ F + G VS A + + L WR +L + AIP+ Sbjct: 145 APVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPTH-LGWRLMLGVGAIPS 203 Query: 151 FVLLIFIVFMPESPRYLCTKGRITDAHNILDKIAQFNQTSL 191 L + ++ MPESPR+L +GR+ DA +LDK + + S+ Sbjct: 204 IFLAVGVLAMPESPRWLVMQGRLGDATRVLDKTSDSKEESM 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101267 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46990835 62 1e-11 >46990835 Length = 192 Score = 61.6 bits (148), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 4/139 (2%) Query: 15 AIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKARGIEVIGVVCHVSNGQ 74 A+VT T+GIG+ I E L GA V +R + ++++ + + + +G +V G VC V + Sbjct: 3 ALVTGGTKGIGYAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVSKT 62 Query: 75 QRKNLINQTIEKF-GKIXXXXXXXXXXXXXXXILQTKESVLDKLWDINVKSSILLLQDAA 133 QR+ LIN+ F GK+ + T E L N++S+ L Q + Sbjct: 63 QREELINKVSSLFDGKLNILINNVGANRPKATLEYTAED-YSFLMSTNLESAYHLCQLSH 121 Query: 134 PHLQKGSS--VVLISSIAG 150 P L+ S +VL+SSIAG Sbjct: 122 PLLKASGSANIVLLSSIAG 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61017 (73 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25354 133 5e-34 >Contig25354 Length = 245 Score = 133 bits (335), Expect = 5e-34, Method: Composition-based stats. Identities = 61/72 (84%), Positives = 66/72 (91%) Query: 1 MTIGMPDYTSTPENFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIG 60 MTIGMPDYTSTPENF+ L+KCR+EVCKAL + EE C+LSMGMSGDFE AIEMGSTNVRIG Sbjct: 171 MTIGMPDYTSTPENFRMLSKCRTEVCKALAMAEEHCELSMGMSGDFEQAIEMGSTNVRIG 230 Query: 61 STIFGAREYPKK 72 STIFG REYPKK Sbjct: 231 STIFGPREYPKK 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41383 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99051 (533 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31678 815 0.0 >Contig31678 Length = 529 Score = 815 bits (2104), Expect = 0.0, Method: Compositional matrix adjust. Identities = 404/528 (76%), Positives = 455/528 (86%), Gaps = 1/528 (0%) Query: 6 EAHPNSGDIKAPLLPSHRQIQRSPSSHFTLKTIFTPNNFYILLGPLLCAVICVCVKLDGQ 65 + HP S D K PLLP H QIQRS S H +LK+I T NF++LLGPLLC +IC+CVKLDG Sbjct: 2 DNHPISEDPKTPLLPLHDQIQRSQSFHSSLKSILTLKNFFVLLGPLLCTIICLCVKLDGP 61 Query: 66 ATSRNMLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLG 125 SRNML VL WVFAWWLTEAVPMPITSM+PLFLFPLFGI+SAD VAHSYMDDVIAL+LG Sbjct: 62 VASRNMLAVLVWVFAWWLTEAVPMPITSMSPLFLFPLFGIASADDVAHSYMDDVIALLLG 121 Query: 126 SFILALAVEHYNIHKRLALNITILFCGEPMNPPLLLLGICGTTAFVSMWMHNVAAAVIMM 185 SFILALAVEHYNIH+RLALNIT++FCG+P+NPPLLLLGICGT AF+SMWMHNVA AV+MM Sbjct: 122 SFILALAVEHYNIHRRLALNITLVFCGDPLNPPLLLLGICGTAAFISMWMHNVATAVMMM 181 Query: 186 PVATGILQNLPEVPLQSTLVRKYCKAVVLGVIYSAAVGGMSTLTGTGVNLILVGMWKTYF 245 PVATGIL+ P P QS + +CKAV+LG++YS +GGMSTLTGTGVNLILVGMWK+YF Sbjct: 182 PVATGILRRFPTGPDQSVVASNFCKAVILGMLYSITIGGMSTLTGTGVNLILVGMWKSYF 241 Query: 246 PEANPISFSTWFCFGFPLALVIFVALWAILCLFYCPRGSGPALSEYLDKANLKRELDMLG 305 P+A PI+FSTWFCF FP AL++F+ALWA+LC YC R SG ALS YLDKA+LK+EL++LG Sbjct: 242 PQAAPITFSTWFCFAFPSALLMFLALWALLCYLYCSRSSGQALSVYLDKAHLKKELELLG 301 Query: 306 PMAFAEKMVLAVFGMLIALWMTRSITDDIPGWGALFNDRAGDGTASVVMATLLFIIPSMK 365 PMAFAEKMVLA+F MLI LWMTRSIT+DIPGWG LFN RAGDGT SV++AT LFI PS K Sbjct: 302 PMAFAEKMVLALFSMLIVLWMTRSITEDIPGWGVLFNGRAGDGTVSVMVATFLFIFPSKK 361 Query: 366 QKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPI 425 +KGEKLMDW KCKKLPWNIILLLGAG AIADGVR+SGLA+ LS+ LDFLEA PY+AIAP Sbjct: 362 EKGEKLMDWEKCKKLPWNIILLLGAGLAIADGVRSSGLANILSETLDFLEAVPYVAIAPA 421 Query: 426 VCLISAIITEF-TSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPS 484 VCLIS+ ITE TSNNATTTL++PLLIQIA+ MHVHPLLLM+PG IGAQF+FLLPT TPS Sbjct: 422 VCLISSSITELITSNNATTTLIIPLLIQIARNMHVHPLLLMIPGGIGAQFAFLLPTATPS 481 Query: 485 NIVGFTTGHIEIQDMIKTGLPLKIAGIAALAFLMPTLGAYVFGTDGDV 532 N VGF TG IEIQDMIK GLPLKI GIA L+ LMPTLGAYVF T V Sbjct: 482 NTVGFATGRIEIQDMIKIGLPLKIVGIAVLSLLMPTLGAYVFKTSEPV 529 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs116106187 (282 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38092 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60654 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48903 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs31311 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78206 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7724 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5772 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54979 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7160 126 4e-31 >Contig7160 Length = 279 Score = 126 bits (316), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 63/140 (45%), Positives = 89/140 (63%), Gaps = 1/140 (0%) Query: 24 GCEGVMIDKLSISSPKLSPNTDGIHIENTKSVGIYNSMISNGDDCISIGTGCSDVDIADV 83 GC+ V + + + +P SPNTDG+HI + + + NS+++ GDDC+SIG G D+ + +V Sbjct: 3 GCKNVTMSNVHLIAPGDSPNTDGLHISTSSQIKVLNSVMATGDDCVSIGQGSHDITVKNV 62 Query: 84 TCGPSHGISIGSLGAHYSQACVSNITVRNAIIRESDNGLRIKTWQG-GTGCVSDLSFENI 142 TCGP HGISIGSLG + + VS I V N R + NG RIKTW G G + + +E+I Sbjct: 63 TCGPGHGISIGSLGKYADELSVSQIYVSNCTFRNTTNGARIKTWAGESAGEATGIIYEDI 122 Query: 143 QMENVRNCINIDQYYCLSKE 162 M+ V+N I IDQ Y K+ Sbjct: 123 IMDQVQNPIIIDQNYGAKKK 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10524 (80 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26030 115 1e-28 >Contig26030 Length = 246 Score = 115 bits (288), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 52/79 (65%), Positives = 65/79 (82%) Query: 1 MVVATLTESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQY 60 MV+A L ES + L DD++E II+KTF +AD DGKI+KEEW+ VLRHPSLLKNMTL Y Sbjct: 168 MVIAILMESDVKLPDDILEEIIEKTFADADADKDGKINKEEWKVFVLRHPSLLKNMTLPY 227 Query: 61 LKDITTTFPSFVFHSQVDD 79 LKDITT FPS++FH++V+D Sbjct: 228 LKDITTVFPSYIFHTEVED 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78173 (405 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4292 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92452 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26510 130 2e-32 >Contig26510 Length = 221 Score = 130 bits (327), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 64/107 (59%), Positives = 80/107 (74%), Gaps = 5/107 (4%) Query: 1 MAGAYGAEADSANRKLFVGGLAWETNSDTLRTYFEQFGDILEAVVITHKNTGRSKGYRFV 60 +AG +G D+ K+FVGGLAWET +T++ YFEQFGDILEAVVIT K TGRSKGY FV Sbjct: 6 LAGQFG---DTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFV 62 Query: 61 TFRDPGSALRACANPSPMIGGRKANCNLAHLG--RTRPDLPSFGHPR 105 TFR+ +A+RAC + +P+I GR+ANCNLA LG R++P P G R Sbjct: 63 TFREAEAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGRR 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68410 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52149 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13504 186 1e-49 >Contig13504 Length = 334 Score = 186 bits (472), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 85/99 (85%), Positives = 94/99 (94%) Query: 1 MEFKQNKFLSAEKQIVTANPDINSVELCDDDDFVVLACDGIWDCMSSQQLVDFIHEQLHS 60 MEFKQNKFL AEKQIVTA+PDIN+VELCDDD+F+VLACDGIWDCMSSQQ+VDF+HEQL S Sbjct: 206 MEFKQNKFLPAEKQIVTASPDINTVELCDDDEFIVLACDGIWDCMSSQQVVDFVHEQLLS 265 Query: 61 ESKISAVCERVLERCLAPSTAGGEGCDNMTMIIVQFKKP 99 ESK+S VCER L+RCLAPSTA GEGCDNMTMI+VQFKKP Sbjct: 266 ESKLSVVCERALDRCLAPSTADGEGCDNMTMIVVQFKKP 304 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61125 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62373 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93856 (309 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27175 132 7e-33 >Contig27175 Length = 545 Score = 132 bits (332), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 93/304 (30%), Positives = 148/304 (48%), Gaps = 32/304 (10%) Query: 19 ASEEESRGERRVADYDWTEEWYPLYLTKDVPDDAPLGLTVFDQQIVLYKDGKGELRCHQD 78 +E+E + ++W + WYP+ L +D+ P + + + ++ DG+ + D Sbjct: 80 GAEDEIEDATSTSKFNWRDHWYPVSLIEDLDPRLPTPFQLLGRDLAIWYDGESWV-AFDD 138 Query: 79 RCPHRLAKLSEGQLIDG-RLECLYHGWQFEGEGKCVKIPQLPADAKIPRS-----ACVRT 132 RCPHRLA LSEG++ +G L+C YHGW F+G G CVKIPQ ++ R+ AC Sbjct: 139 RCPHRLAPLSEGRIDEGGNLQCSYHGWSFDGCGSCVKIPQASSEGPESRAVRSPRACATR 198 Query: 133 YEVKESQGVVWVW-----MSQKTPPNPDKLPWFENFARPGFQDVSTIHELPYDHSILLEN 187 + SQG+++VW + P LP + F++P F V+ +L Y + L+EN Sbjct: 199 FPTLVSQGLLFVWPDENGWERANATKPTMLP--DEFSKPEFSSVTIQRDLFYGYDTLMEN 256 Query: 188 LMDPAHIPISHDRTDYSAKREDAQPLGFEVTERTDPGFASQWGREKDGSMPNFLRFEAPC 247 + DP+HI +H + + +R+ A+PL F++ + GF+ +G+ F APC Sbjct: 257 VSDPSHIDFAHHKV--TGRRDRAKPLPFKLEDSGPWGFSG----ANEGNPRITAEFIAPC 310 Query: 248 VLQNNRESVDNK---TGENTTPRVYSS-----ADHRTRGINAYCAXWNTGTSP---WXQV 296 N E +D K G+ S A +TR I + + P W QV Sbjct: 311 YYLNKIE-IDTKLPVVGDQKWVIWICSFNVPMAPGKTRSIVCSARNFFQFSMPGPAWWQV 369 Query: 297 VPDW 300 VP W Sbjct: 370 VPRW 373 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94907 (139 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13779 203 8e-55 >Contig13779 Length = 143 Score = 203 bits (517), Expect = 8e-55, Method: Compositional matrix adjust. Identities = 97/130 (74%), Positives = 106/130 (81%) Query: 10 SSDGRHDDDAALTEFLSSLMGYTPTIPDELVEHYLAKSGFQCPDVRLIRLVAVATQKFVA 69 S G+HDDDAALT+FL+SLM Y PTIPDELVEHYLAKSGFQCPDVRLIRLVAVATQKFV+ Sbjct: 14 SDGGKHDDDAALTDFLASLMDYAPTIPDELVEHYLAKSGFQCPDVRLIRLVAVATQKFVS 73 Query: 70 EVATDALQQCXXXXXXXXXXXXXXXXXXXXLILTMEDLSKALREYGVNVKHQEYFADNPS 129 EVATDALQQC LILTMEDLS+ALRE+GVNVKHQEYFAD+PS Sbjct: 74 EVATDALQQCKARQASVVKDKRDKQQKDKRLILTMEDLSRALREHGVNVKHQEYFADSPS 133 Query: 130 TGMDPASKEE 139 TGMDPA++EE Sbjct: 134 TGMDPATREE 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45674 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8154 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29068 129 4e-32 >Contig29068 Length = 216 Score = 129 bits (323), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 66/120 (55%), Positives = 78/120 (65%), Gaps = 35/120 (29%) Query: 45 LPKSAVPDPHNLELWLTVHNHYSLLSYFFMAFVKASNLFFTGWINFKCVSLQVDGEIRQK 104 LPK VP+P ++ELWL +VDGE++QK Sbjct: 131 LPKEMVPNPDDIELWL-----------------------------------KVDGELKQK 155 Query: 105 GSTKDMIFMIPYLISHISSIMTLFEGDVILTGTPQGVGPVKVGQKITAGITGLLDVHFDI 164 GSTKDMIF +P+LISHISSIMTL EGDVILTGTPQGVGPVK+GQKITAGIT L+DV F++ Sbjct: 156 GSTKDMIFKLPFLISHISSIMTLLEGDVILTGTPQGVGPVKIGQKITAGITNLVDVQFNV 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7246 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14657 72 8e-15 >Contig14657 Length = 175 Score = 72.0 bits (175), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 48/152 (31%), Positives = 69/152 (45%), Gaps = 29/152 (19%) Query: 50 NDDITGLDEKKVLEGLSVLLVEDQAVLQRIGIRMLKKLGAGVTLVKDGEAAVEAMTLMIN 109 N ++ L + +L G +L+++D V R+ LKK GA V G+ A+ +T Sbjct: 27 NGELPSLSLRNLLLGRKILIIDDNNVNLRVAAGALKKYGAEVICADSGKKAISLLT---- 82 Query: 110 AAGKNHQIQNLHHGSNLETHNPPH-YDLILMDCQMGSMDGCKATRVIRKLE---AEAETG 165 PPH +D MD QM MDG +ATR IR LE + + Sbjct: 83 ---------------------PPHHFDACFMDIQMPEMDGFEATRRIRDLERNISNSIQA 121 Query: 166 QSIPIIAFTALVTADNERECFNSGMDTFLNKP 197 +PI+A TA V EC GMD +++KP Sbjct: 122 WHVPILAMTADVIQATHEECTKCGMDGYVSKP 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87569 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68601 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91022484 327 1e-91 >91022484 Length = 196 Score = 327 bits (838), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 150/193 (77%), Positives = 170/193 (88%) Query: 31 MKEEYGLFVWPCSVILAEYVWQQRYRFSGANVVELGAGTSLPGLVAAKVGSNVTLTDDSN 90 MKEEYGLFVWPCS++LAEYVWQQR RFSGA+VVELGAGTSLPGLVAA+VG++VTLTDDS+ Sbjct: 1 MKEEYGLFVWPCSLVLAEYVWQQRLRFSGASVVELGAGTSLPGLVAARVGADVTLTDDSS 60 Query: 91 RIEVLKNMRRVCEMNKLNCRVMGLTWGFLDASIFDLNPNIILGADVFYDASAFDDLFATI 150 R+EVL NMRRV ++NKL C+VMGLTWG DAS F L+P ILGADV YDA+AFDDLFAT+ Sbjct: 61 RLEVLDNMRRVLDLNKLECKVMGLTWGAWDASTFSLHPKFILGADVLYDATAFDDLFATV 120 Query: 151 TYLLQSSPGSVFITTYHNRSGHHLIEFLMVKWGLKCVKLVDGFSFLPHYKARELNGNIQL 210 T+LLQ+SPGSVFITTYHNRSGH LIEFLMVKWGLKC+KL+D FSF+P YKA L GN+QL Sbjct: 121 TFLLQNSPGSVFITTYHNRSGHRLIEFLMVKWGLKCLKLLDAFSFMPSYKASGLRGNLQL 180 Query: 211 AEIVFDHESPEET 223 AEI D E E T Sbjct: 181 AEIALDSEQAETT 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44596 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6300 202 3e-54 >Contig6300 Length = 192 Score = 202 bits (515), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 93/184 (50%), Positives = 130/184 (70%), Gaps = 1/184 (0%) Query: 3 FWVFGYGSLVWNPGFEYDEKILGFIKDYRRVFDLACIDHRGTPQHPARTCTLEKSQETIC 62 WVFGYGSL+W GF YDE+++GFIK YRRVF DHRGTP++P RT TLE ++ +C Sbjct: 6 IWVFGYGSLIWKAGFNYDERLVGFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGEVC 65 Query: 63 WGVAYCVRGGPEKERLAMEYLERRECEYDSKTLVDFYREGEPSQPALTGVIVFTSTPDKV 122 WGVAY + E + +A+ YLE RE +YD K +DF+ + + A++GV+V+ ++PDK Sbjct: 66 WGVAYKI-SNKEDQEVAITYLEVREKQYDKKAYLDFFTDPMATTAAVSGVMVYIASPDKK 124 Query: 123 SNKYYLGPAPLEEMARQIATAVGPCGNNRDYLFKLEKAMFDIGHEDDYIIELANEVRKEL 182 N YLGPA EE+++QI A GP G NRDYLF+LE+A+ +G +D ++++LANEVR+ L Sbjct: 125 HNVNYLGPASTEEISKQIVQAEGPSGPNRDYLFRLEEALLQLGCKDRHVLDLANEVRRIL 184 Query: 183 GTAE 186 E Sbjct: 185 SERE 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74025 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60125 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25481 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75694 (102 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2940 68 4e-14 >Contig2940 Length = 312 Score = 67.8 bits (164), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Query: 13 QPRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHEFHASCVD 72 + R L + + +LP + + SS Q E+C IC D++DGE L +LSCKH +H+ C++ Sbjct: 232 ENRGLSADTIASLPSVSYKTGSS-QNGSNESCVICRLDFEDGENLTILSCKHSYHSECIN 290 Query: 73 SWLTKWGTFCPVC 85 +WLT CPVC Sbjct: 291 NWLT-INKICPVC 302 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95626 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27589 129 3e-32 >Contig27589 Length = 543 Score = 129 bits (324), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 82/163 (50%), Positives = 93/163 (57%), Gaps = 19/163 (11%) Query: 4 TVAPAVEKAXXXXXXXXXXXXXXXXEISEHTKKPSANQYGSVDSVNAAANGQIPSERSGT 63 TVAP VE+A EI E TKK +PSERS T Sbjct: 3 TVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKK-------------------VPSERSVT 43 Query: 64 PFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGDNGSL 123 P L DF+DP+MCY+PNGYPSTA+YYGGYDG EWDDY+RYV+ +GV+MTSGVYGDNGSL Sbjct: 44 PLLPDFVDPSMCYLPNGYPSTAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSL 103 Query: 124 MXXXXXXXXXXXXXXXXXXXXXXMGTDGQLYGPQHYQYPHYFQ 166 + MG DGQLYGPQ YQYP YFQ Sbjct: 104 LYHHGYGYAPYGPYSPAGSPVPTMGNDGQLYGPQQYQYPPYFQ 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs162106184 (292 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12008 66 6e-13 >Contig12008 Length = 392 Score = 66.2 bits (160), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 63/226 (27%), Positives = 101/226 (44%), Gaps = 22/226 (9%) Query: 54 IGVIADGVDKNAKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY-TNENGEIVKGVCSN 112 +GV V +P R YSI+SS S+ C LV+ G I KGVCS Sbjct: 156 LGVFFAAVAPRLQP---RYYSISSSP--RMASSRIHVTCA--LVHEKTRAGRIHKGVCST 208 Query: 113 FLCDLKPGAEVKIT--GPV---GKEMLMPRDPNATVIMLATGTGIAPFRGFLWKMFFEKH 167 ++ + P + P+ +P D ++M+ GTG APFRGFL + K Sbjct: 209 WMKNSIPLEKSDDCSWAPIFVRQSNFKLPADTKVPILMIGPGTGFAPFRGFLQERLALK- 267 Query: 168 EDYKFNGLAWLFLGVPTSS-SLLYKEEFEKMKEKAPENFRLDFAVSREQKNEKGEKMYIQ 226 ED G + LF G S +Y++E + L A SR+ K Y+Q Sbjct: 268 EDGAELGSSTLFFGCRNSQMDYIYEDELNNFLATGALS-ELVVAFSRQGPT----KEYVQ 322 Query: 227 TRMAEYANELWELLKKDNTYVYMCG-LRGMEKGIDDIMVSLAANDG 271 +M + A+++W ++ + Y+Y+CG +GM + + + ++ G Sbjct: 323 HKMMQKASDVWNMISQGG-YIYVCGDAKGMARDVHRTLHTIVQEQG 367 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20126 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96763 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46485 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37583 (233 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs251 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs158106188 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65605 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51257 (81 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20055 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41080 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11228 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20450 69 3e-14 >Contig20450 Length = 148 Score = 69.3 bits (168), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Query: 11 KELAEWQVNPPSGFKHK-ATDNLQRWVIEVNGAPGTLYANETYQLQVEFPEHYPMEAPQV 69 KEL + Q +PP+ +++ W + G P + YA + + + FP YP + P+V Sbjct: 8 KELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKV 67 Query: 70 IFLHPSPLHPHVYSNGHICLDILYDSWSPAMTV 102 F HP++ SNG ICLDIL + WSPA+T+ Sbjct: 68 AF-RTKVFHPNINSNGSICLDILKEQWSPALTI 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59303 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9171 71 8e-15 >Contig9171 Length = 496 Score = 71.2 bits (173), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 45/141 (31%), Positives = 69/141 (48%), Gaps = 1/141 (0%) Query: 35 VDGGAKLETGGERLGAKGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRS 94 VD K T + G I P + V+ DM IA +E FGPV +++ ++E I Sbjct: 353 VDAKQKGATFCQEYKRDGNLIWPLLLDNVRPDMRIAWEEPFGPVLPVIRITTVEEGIHHC 412 Query: 95 NASQYGLAAGVFTHNLDTANTLMRALRVGSVWINCFDVFDA-AIPFGGYKQSGQGREKGS 153 NAS +GL VFT +++ A + A+ G+V IN PF G K SG G + + Sbjct: 413 NASNFGLQGCVFTKDINKAMLIGDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGIT 472 Query: 154 YSLSNYLQVKAVVTALKNPAW 174 S++ ++K V L P++ Sbjct: 473 NSINMMTKIKTTVINLPTPSY 493 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7897 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1988 201 4e-54 >Contig1988 Length = 110 Score = 201 bits (512), Expect = 4e-54, Method: Compositional matrix adjust. Identities = 93/100 (93%), Positives = 97/100 (97%) Query: 57 LGIGDSQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILKLQEKF 116 +G +SQYYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILKLQEKF Sbjct: 11 MGGAESQYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILKLQEKF 70 Query: 117 RLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR 156 RLDLDDEA +HFFQDLINESVSALFPQMVETIHRWAQYWR Sbjct: 71 RLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24531 (314 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7532 201 9e-54 >Contig7532 Length = 295 Score = 201 bits (512), Expect = 9e-54, Method: Compositional matrix adjust. Identities = 110/268 (41%), Positives = 149/268 (55%), Gaps = 12/268 (4%) Query: 50 QGFSTFFGGSNVKRINNGSMATLALDKSSGSGLVSRNKYYHGFFSAAIKLPSGLSSGVVL 109 Q F FG K +N G + TL LDK+SGSG S+N+Y G IKL SG S+G V Sbjct: 33 QDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSAGTVT 92 Query: 110 AFYLSNADSYPHNHDEIDIELLGHDKRNDWVLQTNIYANGGVSTGREEKFYFWFDPTAQH 169 A+YLS S HDEID E LG+ + L TN+++ G RE++F+ WFDPT Sbjct: 93 AYYLS---SEGPTHDEIDFEFLGNSTGEPYTLHTNVFSQG--KGNREQQFHLWFDPTKTF 147 Query: 170 HYYSIIWNSHHIVFLVDNVPVREFPNTGAFSSVYP-SKPMSVYVTIWDGSQWATHGGKYP 228 H YSI+WNS I+FLVDN+P+R F N + +P ++PM +Y ++W+ WAT GG Sbjct: 148 HTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPMRIYSSLWNADDWATRGGLVK 207 Query: 229 VNYKYAPFVVSLAEMEMAGCVLSNSASAPASC-SKGSASSLDPVDGQKFTTLSKQQVAAL 287 ++ APF S + C +AS+P+SC S S +SL K L L Sbjct: 208 TDWTQAPFTASYRNFKANAC----TASSPSSCASTTSTNSLTEQSAWKTQGLDAAGRNRL 263 Query: 288 DWSRRKLMFYSYCKDTTRF-KVMPPECK 314 W ++K M Y+YC D RF + +P ECK Sbjct: 264 RWVQQKFMVYNYCSDLKRFPQGLPTECK 291 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69506 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17061 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28242 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15423 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80225 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25001 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52163 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103577 (58 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29637 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30618 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93789 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24889 375 e-106 >Contig24889 Length = 300 Score = 375 bits (964), Expect = e-106, Method: Compositional matrix adjust. Identities = 179/248 (72%), Positives = 210/248 (84%), Gaps = 1/248 (0%) Query: 1 MHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEILFSRHCPIWYGYGGRLK 60 MH GWRS+YCMPKRPAFKGSAPINLSDRL+QVLRWALGSVEIL SRHCPIWYGYG LK Sbjct: 54 MHCHGWRSVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLK 113 Query: 61 FLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQISNLASIVFISLFLSIFATG 120 +LERF+Y+N+ +YPLT+IPLL YC+LPAVCLLT KFI+P+ISN ASI+F++LFLSI AT Sbjct: 114 WLERFSYINSVVYPLTSIPLLAYCSLPAVCLLTGKFIVPEISNYASILFMALFLSIAATS 173 Query: 121 ILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGD 180 ILEM+W VGI +WWRNEQFWVIGG SSH FA+ QGLLKVL G++TNFTVTSKA+D DG+ Sbjct: 174 ILEMQWGHVGIHDWWRNEQFWVIGGASSHFFALIQGLLKVLGGVNTNFTVTSKAAD-DGE 232 Query: 181 FTELYMFKWXXXXXXXXXXXVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLY 240 F++LY+FKW +IN++GVV GVS AIN+GYQ+WGP FG LF A WVI+HLY Sbjct: 233 FSDLYLFKWTSLLIPPMSLLIINIIGVVLGVSDAINNGYQTWGPPFGTLFPATWVILHLY 292 Query: 241 PFLKGLMG 248 P KGL+G Sbjct: 293 PSPKGLVG 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44252 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42555 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31690 302 2e-84 >Contig31690 Length = 159 Score = 302 bits (774), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 146/159 (91%), Positives = 150/159 (94%) Query: 1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF 60 MSDEEHHFESKADAGASKT+PQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHF Sbjct: 1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF 60 Query: 61 VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 VGIDIF KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD Sbjct: 61 VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 Query: 121 ENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 159 ++LL+QIKDGF GKDLVVSV AMGEEQI ALKDIGPK Sbjct: 121 DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56038 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6829 154 9e-40 >Contig6829 Length = 173 Score = 154 bits (389), Expect = 9e-40, Method: Compositional matrix adjust. Identities = 85/172 (49%), Positives = 106/172 (61%), Gaps = 2/172 (1%) Query: 14 FTVCG-NPNNLHAIIP-SGCNNKHTHFXXXXXXXXXXXXFQRVIHKAVVPLAASVTVLLS 71 F C P NLH+ + C T +RV+ ++ V LAAS +LL Sbjct: 2 FRCCRFKPGNLHSRVQVKSCKRPTTVVVCSGSSSPAPTSRRRVLLQSSVSLAASAAILLC 61 Query: 72 PVPAKAGFLSGFSGIESVPGPELPQIEFLNRFNEENQKKYAEFDARFXXXXXXXXXXXXX 131 PA+AGFLSG +G +SVPGPELPQI+FL RFNEENQKKYAE DARF Sbjct: 62 SNPAEAGFLSGSTGKKSVPGPELPQIDFLKRFNEENQKKYAENDARFRSTQKLKELLEKS 121 Query: 132 XXXXXXXRQEIENKYCLRGAEWGVGDCSAEGMSPEERENFISMLKQKAGVNE 183 +EI++KYC+RGAEWGVGDCSAEGM+P E++ FI+MLK+KAGV + Sbjct: 122 KLNKEKNSKEIQDKYCIRGAEWGVGDCSAEGMTPNEKDKFIAMLKEKAGVKD 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs173106183 (286 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6580 239 5e-65 >Contig6580 Length = 269 Score = 239 bits (609), Expect = 5e-65, Method: Compositional matrix adjust. Identities = 112/177 (63%), Positives = 131/177 (74%), Gaps = 15/177 (8%) Query: 8 ELPPGFRFHPTDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEFGEKEWYF 67 +LPPGFRFHPTDEEL+VHYL+ +A S P PV+II EVD+YKFDPW+LP KA FGE+EWYF Sbjct: 14 QLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYF 73 Query: 68 FSPRDRKYPNGTRPNRATVSGYWKATGTDKAIYG--GSKYLGVKKALVFYKGRPPKGIKT 125 FSPRDRKYPNG RPNRA SGYWKATGTDK + G+ +GVKKALVFY G+PPKG KT Sbjct: 74 FSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPPKGTKT 133 Query: 126 DWIMHEYRLNDPTRQPYKHNG-------------SMKLDDWVLCRIYKKRQTGSRSV 169 +WIMHEYRL + T + S++LDDWVLCRIYKK + S+ Sbjct: 134 NWIMHEYRLVNNTTTTINMSSSTTKPSDAANKKPSLRLDDWVLCRIYKKNKGPVMSI 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37739 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6102 194 5e-52 >Contig6102 Length = 212 Score = 194 bits (492), Expect = 5e-52, Method: Compositional matrix adjust. Identities = 92/121 (76%), Positives = 104/121 (85%) Query: 1 MKIAAGAAKGLEYLHDKANPPVIYRDFKSSNILLEEGFHPKLSDFGLAKLGPVGDKSHVS 60 MKIAAGAAKGL+YLHDKA+PPV++R+ K SNILL EG+HPKLS FGLAKLGP GD +HVS Sbjct: 1 MKIAAGAAKGLKYLHDKASPPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVS 60 Query: 61 TRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSSRPHGEQNLVTWVIY 120 VMGTYGYCAPEYAMTGQLT+KSD+YSFGVV LE+ITGR AID++R GEQ LV W Sbjct: 61 KWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWART 120 Query: 121 L 121 L Sbjct: 121 L 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100626 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78025 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10738 151 5e-39 >Contig10738 Length = 362 Score = 151 bits (382), Expect = 5e-39, Method: Compositional matrix adjust. Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 1/178 (0%) Query: 6 MNQPGKSVGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSKKEEALSLLGADKFVVSSDLE 65 + +PGK VG++GLGGLGH+ VKF KAFG VTV+STS SKK+EAL LGAD FVVS D + Sbjct: 180 LAEPGKHVGIVGLGGLGHVGVKFAKAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQ 239 Query: 66 QMKALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSE-VKFSPASLNIGAKTVS 124 QM+A +LD IIDT S HP + LLK G +LVG P + + L +G K+V+ Sbjct: 240 QMQAAIGTLDGIIDTVSAAHPIVPLLGLLKPHGKLILVGVPEKPLDLHVFPLIMGRKSVA 299 Query: 125 GSVTGGTKDTQEMLEYCAAHKIYPQIETIPIENVNEALERLIKRDVKYRFVIDIQNSL 182 GS GG K+TQEM+++ A H I +E I ++ VN A+ERL K DV+YRFVID+ N+L Sbjct: 300 GSGIGGMKETQEMIDFAAKHNITADVEVISMDYVNTAMERLAKNDVRYRFVIDVGNTL 357 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7740 (77 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16453 (223 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22683 119 6e-29 >Contig22683 Length = 265 Score = 119 bits (297), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 57/162 (35%), Positives = 93/162 (57%), Gaps = 4/162 (2%) Query: 34 EEIISATNDFNAEHCIGKGGHGSVYRAKVPSGEIFAVKKFHSPLPGEMSFQQEEFLNEIQ 93 E I+ AT+ F+ + +G+GG G VY+ K+P G+ AVK+ S + EEF NE+ Sbjct: 107 ESILVATDYFSNANKLGQGGFGPVYKGKLPGGQEIAVKRLSSCSGQGL----EEFKNEVL 162 Query: 94 ALTEIRHRNIVKFYCFCSHPKHSFIIYEYLESGSLDKILCNDASAKELGWTQRLNVIKGV 153 + +++HRN+V+ +C + ++YEY+ + SLD + + L W R N+I G+ Sbjct: 163 LIAKLQHRNLVQLLGYCVEGEEKMLVYEYMANKSLDSFIFDRKLCVSLNWDMRFNIILGI 222 Query: 154 ADALFYLHNNCFPPIVHRDISSKNVLLDLGYEAHVSDFGIAK 195 A L YLH + I+HRD+ + N+LL +SDFG+A+ Sbjct: 223 ARGLLYLHQDSRLRIIHRDLKTSNILLGEEMNPKISDFGLAR 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61627 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84487 (72 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 68 3e-14 >Contig31581 Length = 128 Score = 67.8 bits (164), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 32/38 (84%), Positives = 36/38 (94%) Query: 31 TLEVKSSDTINNVKSKIQDKEGIPPDQQRLIFAGINLK 68 TLEV+SSDTI+NVK+KIQDKEGIPPDQQRLIFAG L+ Sbjct: 14 TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE 51 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57743 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48265854 149 1e-38 >48265854 Length = 138 Score = 149 bits (377), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 76/99 (76%), Positives = 76/99 (76%) Query: 25 LQFPVGRIARFLKAGKYAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKTRIVPRH 84 LQFPVGRIARFLKAGKYAERVGAGAP GNAARDNKK RIVPRH Sbjct: 27 LQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKNRIVPRH 86 Query: 85 IQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKTG 123 IQLAVRNDEELSKLLG VTIANGGVMPNIH LLPKK G Sbjct: 87 IQLAVRNDEELSKLLGAVTIANGGVMPNIHQNLLPKKVG 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64036 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52033 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7158 (61 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85456 (321 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44225 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36587 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28069 310 1e-86 >Contig28069 Length = 447 Score = 310 bits (794), Expect = 1e-86, Method: Compositional matrix adjust. Identities = 155/203 (76%), Positives = 177/203 (87%), Gaps = 5/203 (2%) Query: 1 MALPFPIEKAPTKKIISTGSGVKISELLNYPVRGLVFEGGNSLEDLSNTVSDACICLQEN 60 +A+ FPIEKAPTKKI + + VK+SELLNYPVRGLVFEGGN+LEDLS TVSDACICLQEN Sbjct: 249 LAVTFPIEKAPTKKISTLNAEVKVSELLNYPVRGLVFEGGNTLEDLSYTVSDACICLQEN 308 Query: 61 NIPYNVLIADCGKRIFLLPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYE 120 N+PYNVLI+DCGKRIFLLPQCYAEKQALGEVS+E+LDTQVNPAVWEISGHMVLKRKKDY+ Sbjct: 309 NVPYNVLISDCGKRIFLLPQCYAEKQALGEVSAEVLDTQVNPAVWEISGHMVLKRKKDYD 368 Query: 121 EASEENAWRLLAEVSLSEERYQEVNALIFEAIARGDDANGGVAESVIGEADAKPKSGGEV 180 EAS+ENAW+LLAEVSLSEER+QEVNALIFE IA G++ N + E + + KP+S EV Sbjct: 369 EASDENAWKLLAEVSLSEERFQEVNALIFERIASGNNGNENLPE----DPEVKPRSHEEV 424 Query: 181 DA-INKNSCPAMVSGTPECLVLQ 202 DA INK+S AMV T EC+VLQ Sbjct: 425 DATINKSSRAAMVGETQECIVLQ 447 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9986 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68717 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71761 (366 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76394 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58089 (285 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104403 (67 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42867 (334 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10594 63 6e-12 >Contig10594 Length = 408 Score = 63.2 bits (152), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 51/208 (24%), Positives = 97/208 (46%), Gaps = 14/208 (6%) Query: 36 TLVRFLKARDWNVSKAHKMLVDCLRWRIENDIDNILAKPILPAELYRAVRDSQLVGVSGY 95 L++FL+ARD+ V + M+ CL WR E D ++ + + EL + + + GY Sbjct: 84 VLLKFLRARDFRVPDSFAMITKCLAWRKEFGADGVVEEDLGFKEL-----EGVVAYMHGY 138 Query: 96 SKEGLPVIAVGVGLSTHDKASVNYYVQSHIQMNEY---RDRVVLPSASKKHGRYIGTSLK 152 K+G PV G+ DK ++ ++ R +V+ + H + G + Sbjct: 139 DKQGHPVCYNAYGV-FKDKEMYERIFGDDEKLKKFLRWRVQVLERGINALHFKAGGIN-S 196 Query: 153 VLDMTGLKLSALNQIKLMT--VITTIDDLNYPEKTETYYIVNAPYIFSACWKVVKPLLQE 210 ++ +T LK ++++ + +++ D NYPE +N P+ FS + + P L + Sbjct: 197 IIQVTDLKDMPKRELRVASNQILSLFQD-NYPEMVARKIFINVPWYFSVLYSMFSPFLTQ 255 Query: 211 RTRRKIQVL-QGNGRDELLKIMDYASLP 237 RT+ K + +GN + L K + +P Sbjct: 256 RTKSKFVIAKEGNVAETLYKFIRPEDVP 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26683 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48939927 181 3e-48 >48939927 Length = 124 Score = 181 bits (460), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 89/108 (82%), Positives = 90/108 (83%), Gaps = 1/108 (0%) Query: 1 MATLDSDVPMIPVGEXXXXXXXXXXXXXXXRFEIKKWSAVALWAWDIVVDNCAICRNHIM 60 MATLDSDVPMIP GE RFEIKKW+AVALWAWDIVVDNCAICRNHIM Sbjct: 1 MATLDSDVPMIPAGEGSSSAGPSSTKKPK-RFEIKKWNAVALWAWDIVVDNCAICRNHIM 59 Query: 61 DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN 108 DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPL Sbjct: 60 DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLGK 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60255 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7379 333 1e-93 >Contig7379 Length = 589 Score = 333 bits (854), Expect = 1e-93, Method: Compositional matrix adjust. Identities = 157/252 (62%), Positives = 188/252 (74%), Gaps = 17/252 (6%) Query: 1 MQPDWDMFHSLHPMAEYHGAARAVGGCAIYVSDKPGQHDFNLLRKLVLPDGSILRAKLPG 60 MQPDWDMFHSLHP AEYHGAARA+GGCAIYVSDKPG H+F+LLRKLVLPDGS+LRAKLPG Sbjct: 316 MQPDWDMFHSLHPAAEYHGAARALGGCAIYVSDKPGHHNFDLLRKLVLPDGSVLRAKLPG 375 Query: 61 RPTRDCLFSDPARDGKSLLKIWNLNDFTGVVGVFNCQGAGWCRVGKKNLIHDEQPGTTTG 120 RPTRDCLF+DPARD SLLKIWN+N+ +GVVGVFNCQGAGWC++ KK IHD PGT +G Sbjct: 376 RPTRDCLFADPARDRTSLLKIWNVNNLSGVVGVFNCQGAGWCKIEKKTRIHDYSPGTLSG 435 Query: 121 FIRAKDVDYLPRVAGDEWTGDAIAYSHLGGEVAYLPKNATLPITLKSREYEVYTVVPVKE 180 +RA DVD + +VAG +W G+ Y+H GEV LPK A++P+TLK +YEV+ P+KE Sbjct: 436 SVRAADVDAIAQVAGADWNGETAVYAHKSGEVLRLPKGASVPVTLKVLDYEVFHFCPLKE 495 Query: 181 LSSGTRFAPIGLVKMFNSGGAIKEVRYE---------SEG--------TATVDMKVRGCG 223 ++S FAPIGL+ MFNS A++EV S G TAT+ +K RGCG Sbjct: 496 ITSDVSFAPIGLLDMFNSSAAVEEVEIHLASDKKPELSNGEVSENRSPTATIGLKTRGCG 555 Query: 224 ELGAYSSARPQR 235 GAY S RP + Sbjct: 556 RFGAYCSRRPLK 567 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs169106190 (361 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11077 543 e-156 >Contig11077 Length = 317 Score = 543 bits (1399), Expect = e-156, Method: Compositional matrix adjust. Identities = 255/317 (80%), Positives = 280/317 (88%) Query: 45 FETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYR 104 E V+QV+G + H LSFARFA RYGK YESVEEMKLR+ F +N LIRSTN KGLSY Sbjct: 1 MEEQVVQVLGSSHHVLSFARFAHRYGKKYESVEEMKLRYEIFLENKKLIRSTNRKGLSYT 60 Query: 105 LGLNKFADWSWEEFQRHRLGAAQNCSATTKGNHKLTADVLPETKDWRESGIVSPVKDQGH 164 L +N+FADWSWEEF RHRLGAAQNCSATTKGNHKLT VLPE+K+W+E GIV+PVKDQGH Sbjct: 61 LAVNRFADWSWEEFARHRLGAAQNCSATTKGNHKLTDAVLPESKNWKEEGIVTPVKDQGH 120 Query: 165 CGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNG 224 CGSCWTFSTTG+LEAAY QAFGK ISLSEQQLVDCA FNN GCNGGLPSQAFEYIKYNG Sbjct: 121 CGSCWTFSTTGALEAAYVQAFGKQISLSEQQLVDCAGDFNNNGCNGGLPSQAFEYIKYNG 180 Query: 225 GLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVD 284 GLDTE AYPY G DG CKFSSENVGVQV+DSVNITLGAE+EL+HAV VRPVSVAF+VV Sbjct: 181 GLDTEAAYPYVGVDGACKFSSENVGVQVVDSVNITLGAEEELKHAVAFVRPVSVAFQVVQ 240 Query: 285 GFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEM 344 FRFYKSGVY+S CG++ MDVNHAV+AVGYGVEDGVP+WLIKNSWG++WGD+GYFKME Sbjct: 241 SFRFYKSGVYTSDTCGSSSMDVNHAVLAVGYGVEDGVPFWLIKNSWGQSWGDNGYFKMEY 300 Query: 345 GKNMCGIATCASYPVVA 361 GKNMCG+ATCASYPVVA Sbjct: 301 GKNMCGVATCASYPVVA 317 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76629 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12583 226 3e-61 >Contig12583 Length = 280 Score = 226 bits (577), Expect = 3e-61, Method: Compositional matrix adjust. Identities = 159/305 (52%), Positives = 191/305 (62%), Gaps = 47/305 (15%) Query: 1 MASSSEMS-------VNLPEK-SSFSQTCSLLSQYLKEGGSFGDLSLGISSN--IEANG- 49 M+SSSE + + EK S+F+QTCS+L QYLKE GSFGDL+L + N ++NG Sbjct: 1 MSSSSETAEVSGQRGMRTAEKPSNFTQTCSMLCQYLKEKGSFGDLNLDTACNNMQQSNGG 60 Query: 50 VPEIPRRPAATTMNLFPVSDNSGQDVSVRNM-VAPRNWESMNLFPQQAGFAP-----KND 103 PE+ R+ A MN FP +NS RNM A R+++SM+LFPQQAGF P + + Sbjct: 61 TPEMFRQ-KAPPMNFFPFVENS------RNMPTAVRDFKSMDLFPQQAGFGPSAPTPREE 113 Query: 104 TPNMIDSSLNKPAP---QTAQMTIFYGGQVIAFNDFPADKANEIMQLASNGSSLSHGTAY 160 P DSS+ K AP Q AQMTIFYGGQVI FNDFPADKA E+M LAS SS SH Sbjct: 114 VPMTADSSVKKSAPGEPQKAQMTIFYGGQVIVFNDFPADKAKEVMLLASKESSQSHTAPA 173 Query: 161 PPMQLPAQGYNSFAASLPKSPVESTPPVSPGPPKILTEPSCSVPPRSNSIPNFGNNLIPE 220 P PA+ N+FA+ L KSPV S S SVPP SN PNFGN I E Sbjct: 174 SP---PAKTNNAFASHLGKSPVNS---------------SSSVPPSSNMFPNFGNQAIQE 215 Query: 221 CAQPPSRP--CDLPIARRNSLHRFLEKRKDRIVARAPYQVNGSAGAPDKPADSKSWLGLA 278 +P RP CDLPIAR+ SLHRFLEKRKDR+ APYQ + A +P KP ++KSWLGLA Sbjct: 216 GVKPSPRPVVCDLPIARKASLHRFLEKRKDRLNTLAPYQTSSPASSPAKPTENKSWLGLA 275 Query: 279 AQTSQ 283 AQ +Q Sbjct: 276 AQQTQ 280 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96407 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10579 74 2e-15 >Contig10579 Length = 222 Score = 73.6 bits (179), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 56/164 (34%), Positives = 84/164 (51%), Gaps = 19/164 (11%) Query: 45 RFSFSSNLPIPSSTSFKTSISAKVSKGQAP------PSFTLK---DQEGRNVSLSKFKGK 95 R + S++LP S + K+ I K S G+ P P F + DQE NV LS++ GK Sbjct: 50 RVAHSASLPRGDSHTRKSFI-VKASAGELPLVGNVAPDFEAEAVFDQEFVNVKLSEYIGK 108 Query: 96 P-VVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYR---- 150 V+++FYP D T C + AF D + +F + E++G+S D SH A+ + R Sbjct: 109 KYVILFFYPLDFTFVCPTEITAFSDRHAEFAELNTEILGVSVDSVFSHLAWVQTDRKSGG 168 Query: 151 ---LPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYILDKNGVV 191 L Y L+SD + K +GV G + R +I+DK GV+ Sbjct: 169 LGDLNYPLISDVTKSISKSYGVLIPDQG-IALRGLFIIDKEGVI 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33540 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226756907 98 9e-23 >226756907 Length = 114 Score = 97.8 bits (242), Expect = 9e-23, Method: Compositional matrix adjust. Identities = 45/94 (47%), Positives = 65/94 (69%) Query: 20 LMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTVTYQKYTLNIWDVGGQRTIRSYWRN 79 LMVGLD +GKTTI+ K+ + PT+GFN++TV Y+ + +WDVGGQ IR WR+ Sbjct: 21 LMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 Query: 80 YFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEE 113 YF+ T GL++VVDS+D R+ + + EL +L E+ Sbjct: 81 YFQNTQGLIFVVDSNDRDRVVEARDELHRMLNED 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44383 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93067 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62790 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81803 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94224 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11942 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32866 83 5e-18 >Contig32866 Length = 129 Score = 83.2 bits (204), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 41/69 (59%), Positives = 48/69 (69%) Query: 218 FSLFLLRAAGFLLPCYIMAWAVSIXXXXXXXXXXXXXXXTEVAFMIQAGQRRGLHFTIAP 277 FSLFLLRAAGFLLPCYIMAWA+SI +VAF++Q+GQ RGL F +AP Sbjct: 54 FSLFLLRAAGFLLPCYIMAWAISILQRRQQRQEAAAMAAAQVAFVLQSGQHRGLQFAVAP 113 Query: 278 GPAVTPHQE 286 GP+ TPH E Sbjct: 114 GPSGTPHPE 122 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47924 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43967 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48265691 68 1e-13 >48265691 Length = 220 Score = 68.2 bits (165), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 43/138 (31%), Positives = 70/138 (50%), Gaps = 11/138 (7%) Query: 2 SKRKHLANYLGR----AQGKVARLQLIELANQYPDKLESPDLKFKGPEKLGKIEYFQHLR 57 SKR L + GR A GK+ + EL+ E ++ + GK +R Sbjct: 50 SKRTTLLFFRGRLKRNAGGKIRSQLVAELSGS-----EGVAIEEGTAGEAGKSAAQNGMR 104 Query: 58 NAKFCLAPRGESSWTLRFYESFFVECVPVILSDEAEFPFQNVIDYTQISIKWPSSRIGRQ 117 + FCL+P G++ + R +++ C+PVI+SDE E PF+ ++DY +I++ SS R Sbjct: 105 KSVFCLSPAGDTPSSARLFDAIVSGCIPVIVSDELELPFEGILDYRKIALFISSSDAVRP 164 Query: 118 --LLDYLATIPDEHIEQM 133 L+ +L I IE+M Sbjct: 165 GWLVTFLRNISHAQIEEM 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2793 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22577 (308 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41106181 (389 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10231 (254 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80871 (324 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27007 236 3e-64 >Contig27007 Length = 207 Score = 236 bits (603), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 125/206 (60%), Positives = 152/206 (73%), Gaps = 9/206 (4%) Query: 1 MMVVLDEEELLGCCGSTKFAKEMASASPFASLNQAVSAARHIWFNLVDVNGWLDAFSAHP 60 M + +EEE L CC STKFAKEMA ASPF+SL++AV+AAR IWFN VDVNGWL +FSAHP Sbjct: 1 MGLKFEEEEFLACCASTKFAKEMAEASPFSSLDEAVTAARDIWFNKVDVNGWLQSFSAHP 60 Query: 61 QIGQSPS-------SQWSKAEQSTALATANESSSQELSDWNNRYRLRFGFIFIICASGRT 113 QIG SPS +QWSK EQ+TA+ATA SS QEL++WN +YR +FGF+F+ICASG++ Sbjct: 61 QIGNSPSPSSHSTSAQWSKGEQATAVATATSSSLQELAEWNAKYRQKFGFVFLICASGKS 120 Query: 114 AAEILAELKKRYTNRPIIEFEIAAQEQMKITEXXXXXXXXXXXXXXXXTFQY-SATAKTA 172 + ILAELKKRY NRPI+EFEIAAQEQMKITE + + AK A Sbjct: 121 SDGILAELKKRYPNRPIVEFEIAAQEQMKITELRLAKLFAAKENVTSTGNKNPTIVAKKA 180 Query: 173 EDRVSIIEGHLCAS-TEASAGKISQI 197 EDRVSII GHL A+ +EAS+ K+SQ+ Sbjct: 181 EDRVSIIGGHLTATASEASSVKLSQL 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64416 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68418 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95907 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20948 (62 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97733 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs195106183 (111 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91356 (433 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32826 170 4e-44 >Contig32826 Length = 455 Score = 170 bits (430), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 128/455 (28%), Positives = 206/455 (45%), Gaps = 42/455 (9%) Query: 1 MLQLASILYSKGFSITIIHTNFNSPNPSNY--------PHFSFNSISESLWESEVSTENA 52 +++L+ L + GF +T ++T FN N S+ + L E N Sbjct: 20 LMELSQCLVNHGFKVTFVNTEFNHKRIVNALAGETHVGDRIHLVSLPDGLEPKE--DRND 77 Query: 53 ISLLTVLNDKCVVPFQDCLAKLIS--NGDQEEPVTCLITDAIWHFAQTVADTLRLPRIVL 110 + LL + V+P + L +LI N ++ E V C++ D +A VA +++ R+ Sbjct: 78 LGLLCEGIQR-VMPGK--LEELIEKINEEESEKVACVLADENSGWALDVAAKMKIRRVAF 134 Query: 111 RTXXXXXXXXXXXXXXXXEKGYLAEQVSFSSDSQLEKPVTELPPLRVKDIPIIVTH--DT 168 +G + SQ + P ++ ++ H DT Sbjct: 135 WPASAAALALSLNIPKLIHEGIIDNDDGTPLKSQEIELAKNQPKMKTANLLWTCFHTLDT 194 Query: 169 RNF-HQLISAVVSKTKACSGLIWNSFEDLEQTELTRLHKDFPIPMFPIGPFHKYCLAXXX 227 + QL+ KA L+ NS DLE T + PIGP Sbjct: 195 QKIIFQLLVRNNKYAKAADWLVCNSAYDLEPAAFT-----LAPEILPIGPLLASSRLENS 249 Query: 228 XXXX--XXXXCISWLDKQAAKSVMYVSFGSIVVVNVTEFLEIAWGLANSRVPFLWVVRPG 285 C+ WLD+Q +SV+YV+FGS+ V + T+F E+A L S PFLWVVRP Sbjct: 250 QGNFWPQDSTCLDWLDQQKPRSVIYVAFGSLTVFDQTQFQELALALELSGRPFLWVVRPD 309 Query: 286 LVPGVEWLEPLPKGFLEMLDGRGHIVKWAPQQEVLAHPAVGGFWTHNGWNSTLESICEGV 345 G +P P+G+ E + RG +V WAPQQ+VL+HP++ F +H GWNSTLE + G+ Sbjct: 310 TTDGAS--DPYPEGYQERVGSRGLMVGWAPQQKVLSHPSIACFISHCGWNSTLEGLSSGL 367 Query: 346 PMICQPCFGDQLVNARYVSHVWRVGLHLERK----FERREIETAIRRVTVE----AEGQE 397 P +C P F DQL+N Y+ +W+VGL ++ EI+T + ++ + A + Sbjct: 368 PFLCWPYFADQLLNESYICDIWKVGLRFDKNESGIITEGEIKTKVEQLLSDENFTARASK 427 Query: 398 MRERIMHXXXXXXXXXXXAGSSYQSLERLVDHILS 432 ++E M+ G SY++ + ++ + S Sbjct: 428 LKEVAMN-------NIKEGGQSYETFKNFIEWMKS 455 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13860 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29934 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64106189 (288 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31401 96 5e-22 >Contig31401 Length = 310 Score = 96.3 bits (238), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 72/232 (31%), Positives = 113/232 (48%), Gaps = 11/232 (4%) Query: 25 VHPLVIFNISDCYVR-RPDQAERVIGTLLGSVLPDGTVDIRNSYVVPHNEFSDQVA---L 80 VHPLV+ +I D Y R D +RV+G LLGS GTVD+ NSY VP E + L Sbjct: 19 VHPLVLLSIVDNYNRVAKDSRKRVVGVLLGSSFK-GTVDVTNSYAVPFEEDDKDPSIWFL 77 Query: 81 DIEYHHTMLKSHLKVNPQEVIVGWFSTGLGVTGGSALIHEFYCREVPNPVHLTVDTGFRN 140 D YH M ++N +E +VGW+STG + IH + VPNPV + +D + Sbjct: 78 DHNYHEAMYSMAKRINAKEHVVGWYSTGPKLRENDLDIHGLFYDYVPNPVLVIIDVQPKE 137 Query: 141 GEGTVKAYVSVNLSLGDRQLAAQ--FQEIPLDLRMIEAERVGFDIL----KSTSVDKLPS 194 KAY +V + +Q F +P ++ E E +G + L K T++ L + Sbjct: 138 LGIPTKAYCAVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLAT 197 Query: 195 DLEGMEVLMERLLTLINDIYKYVDDTVEGHAVPDNSVGRILSETVASLPKLS 246 ++ G ++ L + +I Y+D ++G ++ + L + LP L+ Sbjct: 198 EVTGKLTGLKGLEARLKEIRGYLDLVIDGKLPLNHEILYHLQDVFNLLPNLN 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54814 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83759 (140 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9623 129 1e-32 >Contig9623 Length = 673 Score = 129 bits (325), Expect = 1e-32, Method: Composition-based stats. Identities = 60/111 (54%), Positives = 75/111 (67%), Gaps = 5/111 (4%) Query: 11 YIPELFPDLNKILFLDDAVVVQHDLSSLLELDLNGKVVGAVVGSLCGDNCCPGRKYKDYL 70 Y+PE+FP LNK+LFLDD VVVQ DL+++ LDL G V GAV CG++ ++ YL Sbjct: 483 YLPEIFPKLNKVLFLDDDVVVQKDLTAVWSLDLKGNVNGAV--ETCGESF---HRFDRYL 537 Query: 71 NFSYPIISSNFDHDHCAWLYGMNVLDLEAWRRTNITATYHKWLKLEHFHQL 121 NFS P+IS NFD C W YGMN+ DL+ W++ NIT YH W KL H QL Sbjct: 538 NFSNPLISKNFDAHACGWAYGMNIFDLKEWKKQNITEVYHGWQKLNHDRQL 588 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41829 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2090 172 3e-45 >Contig2090 Length = 90 Score = 172 bits (435), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 80/90 (88%), Positives = 84/90 (93%) Query: 73 MHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPSGDPRGAGIGTP 132 MHAHLTAAVVSNDPLFLQ+VIGNTVNGTTYAGLRARTTGAPQNHWFGP+GDPRG GIGTP Sbjct: 1 MHAHLTAAVVSNDPLFLQDVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGVGIGTP 60 Query: 133 EAIKLVWSSHREIIYDYGPVPGNWEIPPST 162 EAIKLVWS HREIIYD GP+P W+ PPST Sbjct: 61 EAIKLVWSCHREIIYDVGPLPKQWQTPPST 90 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81139 (104 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8012 128 2e-32 >Contig8012 Length = 211 Score = 128 bits (322), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 53/81 (65%), Positives = 69/81 (85%) Query: 23 RLLDAPSLENVHSKSVSCGARHTAVIADDGKVFCWGWNKYGQLGLGDVIDRNIPSQVTIE 82 ++LD+P L + H+K SCGARH+ ++ +DG++F WGWNKYGQLGLGD +DRNIPSQV+IE Sbjct: 130 KILDSPGLGSKHAKVASCGARHSVILTEDGQLFSWGWNKYGQLGLGDAVDRNIPSQVSIE 189 Query: 83 GCVPRNVACGWWHTLLLAVPP 103 GC+ +N+ACGWWHTLLLA P Sbjct: 190 GCLLKNIACGWWHTLLLAERP 210 Score = 62.4 bits (150), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Query: 36 KSVSCGARHTAVIADDGKVFCWGWNKYGQLGLGDVIDRNIPSQV-TIEGCVPRNVACGWW 94 K ++CG RH+AVI D G + +GW YGQ G G+ ID+ PS V ++ +N+A G W Sbjct: 35 KEIACGGRHSAVITDAGALLTFGWGLYGQCGQGNTIDQLRPSYVKSLSETKVKNIAAGLW 94 Query: 95 HTLLLAV 101 HTL ++V Sbjct: 95 HTLCVSV 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54940 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100152 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33106181 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs115106185 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96229 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs14915 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100688 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56923 (174 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs58286 (281 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101477 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5682 258 8e-71 >Contig5682 Length = 246 Score = 258 bits (658), Expect = 8e-71, Method: Compositional matrix adjust. Identities = 140/216 (64%), Positives = 158/216 (73%), Gaps = 23/216 (10%) Query: 39 KRGF----------ADTVVDLKLNLS-----TKESGGID-VIEKTKGKSASATG----AT 78 KRGF A T VDLKLNLS T +GG D EK+K A+ Sbjct: 31 KRGFSETESDISTDASTCVDLKLNLSNNSKETNSTGGKDGSAEKSKTNKEKNNNLDFRAS 90 Query: 79 DLSKPPA-KSQVVGWPPVRSFRKNIM-AVQKDNEEGDNKAXXXXXXNVA-FVKVSMDGAP 135 D +KPPA K+QVVGWPPVRSFRKN+ AVQK +G+++ N A VKVSMDGAP Sbjct: 91 DPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAP 150 Query: 136 YLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYE 195 YLRKVDLK+YKSY ELSDAL KMFSSFTIGNCGSQGMKDFMNE KL+D+LNGSDY+PTY+ Sbjct: 151 YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYQ 210 Query: 196 DKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLA 231 DKDGDWMLVGDVPW+MFV+SCKRLRIMK EA+GL Sbjct: 211 DKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLG 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34637 (336 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20635 332 4e-93 >Contig20635 Length = 287 Score = 332 bits (852), Expect = 4e-93, Method: Compositional matrix adjust. Identities = 154/217 (70%), Positives = 181/217 (83%), Gaps = 2/217 (0%) Query: 28 GKLNGVCVSQGGRFAPFSSEGKPPERASKGRSDLTLCRVFRKKTCCDTAQTHPALLSIRK 87 GK + VC+SQGGRF PFSSEGKPP+R SKG DLTLCRVFRKKTCCD AQTHPAL+S+RK Sbjct: 21 GKPDSVCISQGGRFPPFSSEGKPPKRVSKGSKDLTLCRVFRKKTCCDVAQTHPALVSVRK 80 Query: 88 LASTGEASQECLHLWELLECSICDPNVGVQPGPPLICASFCERVYQACSNAYFSMDAKTQ 147 LAS+GEA ECLHLWELLECSICDP +GVQ GPP+ICASFC+RV++AC+ AY+S DA TQ Sbjct: 81 LASSGEAGPECLHLWELLECSICDPRIGVQSGPPVICASFCDRVFEACAEAYYSTDAITQ 140 Query: 148 VLAPCGVNDFVCGRAAQWVSNGTELCHAAGFAVKLPDDTYIDGEQTSCYGGNASLDKIAG 207 VLAPCGVND+VCGRA++W+ NGTE C+AAGFAVK DD + E+ CYGG ASLD IA Sbjct: 141 VLAPCGVNDYVCGRASEWIHNGTEFCYAAGFAVK--DDISVSKEEPFCYGGKASLDLIAD 198 Query: 208 SWSAPRSERPQKDKNIRILEDFQQWVQQMQFGERVSW 244 SW A SE PQK +++R+LE+FQQ ++M F ERVSW Sbjct: 199 SWKASPSEVPQKAESLRVLEEFQQRWREMPFSERVSW 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98430 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15104 119 7e-29 >Contig15104 Length = 324 Score = 119 bits (297), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 60/99 (60%), Positives = 73/99 (73%) Query: 179 MAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENI 238 MAIRDCYNARR+ SSS+RAH YMS+AL QL K+KEAL+FAIAAQ L PSNS +AE++E + Sbjct: 1 MAIRDCYNARRLISSSYRAHYYMSKALSQLAKHKEALEFAIAAQSLAPSNSQVAERLERV 60 Query: 239 KKHIXXXXXXXXXXXXDGGARSEPPTGRVLSLSDIIYRS 277 ++ + DG RSEP RVLSLSDI+YRS Sbjct: 61 QRDLAAAESERNSKPNDGAPRSEPRGERVLSLSDILYRS 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77739 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24056 245 4e-67 >Contig24056 Length = 423 Score = 245 bits (625), Expect = 4e-67, Method: Compositional matrix adjust. Identities = 122/164 (74%), Positives = 134/164 (81%), Gaps = 5/164 (3%) Query: 4 EGHITAGAKTWPSKQVGVHSVGDHTAIELIGRDRPGLLSEISAVLANLRFNVAAAEVWTH 63 +GHIT WP K VGVHS+GDHTAIELIGRDRPGLLSEISAVLANL FNV AA+VWTH Sbjct: 105 KGHITDLLNAWPGKGVGVHSIGDHTAIELIGRDRPGLLSEISAVLANLHFNVIAADVWTH 164 Query: 64 NRRIACVLYVNDDTTCRAVGDQTRLSLMEEQLKNILRGCDDEDSEKVARTSFSMGFTHVD 123 N RIACV+YVNDDTTC+ + DQ RLS MEEQLKNILRGC ED EKV RTSFSMGFTHVD Sbjct: 165 NERIACVVYVNDDTTCQTMEDQARLSTMEEQLKNILRGC--EDDEKVGRTSFSMGFTHVD 222 Query: 124 RRLHQMFFADRDYEGGGVTTADPVDH-TPSFKLEITVEPSKKKG 166 RRLHQM FADRDYEGGG+ A VDH P F+ +I +E ++KG Sbjct: 223 RRLHQMLFADRDYEGGGL--AHEVDHFPPCFQPKIAIERCEEKG 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17012 (364 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72556 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80709 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9610 147 2e-37 >Contig9610 Length = 418 Score = 147 bits (370), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 94/203 (46%), Positives = 122/203 (60%), Gaps = 14/203 (6%) Query: 1 MWIPLQNIKIGRLHLAITVLEESAKQGVDSPCDGGTLNKEGM--GNKEDQSNKEDIRE-- 56 MW+PLQ K GRLHLA+TVL+E+ K+ + G LN+ + D K D++E Sbjct: 222 MWLPLQ--KAGRLHLAVTVLDENGKEQKN--LQGLDLNRFHTQGDDSPDVQEKPDVKERR 277 Query: 57 -SFANETTDKGXXXXXXXXXXPKVADNFEPINIEGQQETGIWVHQPGSEVAQTWEPRKGK 115 SFA++T +KG KVAD+FEPI+I+GQ+ETGIWVH PGSEV+QTWE RKGK Sbjct: 278 NSFASDTGNKGSFSSISSGKSAKVADHFEPIDIDGQKETGIWVHHPGSEVSQTWEARKGK 337 Query: 116 NRRLDTLVRRVPNGSFNSTXXXXXXXXXXXXXXXXXXQEGKNSIRRGLRKIGSMFQRNSR 175 RRL+T ++ PNGS + S+RRGL KIGS+F RNS Sbjct: 338 GRRLNTQIQGEPNGS----GIGSQVNDTSSTDENPEDKRRMASVRRGLHKIGSVFHRNS- 392 Query: 176 KEDHAGSIGEGCPSPRANLRAVN 198 KED++ + E +PR NLRAVN Sbjct: 393 KEDNSCTFKEPLETPRVNLRAVN 415 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38944 (281 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48281431 258 6e-71 >48281431 Length = 178 Score = 258 bits (660), Expect = 6e-71, Method: Compositional matrix adjust. Identities = 119/141 (84%), Positives = 133/141 (94%) Query: 7 GPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQT 66 GP+LLEDYHLVEKLANFDRERIP+RVVHARGASAKGFF+VTHD+S+L+CADFLRAPGVQT Sbjct: 38 GPVLLEDYHLVEKLANFDRERIPKRVVHARGASAKGFFDVTHDISHLSCADFLRAPGVQT 97 Query: 67 PVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHA 126 PVIVR+STVIHERGSPET+RDPRGFA KFYT EGN+DLVGNN P FFVRD +KFPD++HA Sbjct: 98 PVIVRYSTVIHERGSPETIRDPRGFAAKFYTGEGNWDLVGNNLPAFFVRDAVKFPDVIHA 157 Query: 127 LKPNPKSHIQENWRIVDFFSH 147 KPNPKSHIQE WR++DF SH Sbjct: 158 FKPNPKSHIQEYWRVLDFLSH 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83469 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63212 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70579 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7970 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21497 191 3e-51 >Contig21497 Length = 261 Score = 191 bits (485), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 90/114 (78%), Positives = 100/114 (87%) Query: 1 MKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYE 60 MKGDYYRYLAEFK GD+RK A+ +M +Y+AA A TDL PTHPIRLGLALNFSVFYYE Sbjct: 127 MKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYYE 186 Query: 61 ILNSSEKACTMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQE 114 ILNS E+AC +AKQAF+EAI+ELDTL EESYKDSTLIMQLLRDNLTLWTSD+ E Sbjct: 187 ILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPE 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75205 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26204 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57835 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44263 (324 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11168 (102 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11568 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18794 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20723 372 e-105 >Contig20723 Length = 369 Score = 372 bits (955), Expect = e-105, Method: Compositional matrix adjust. Identities = 183/220 (83%), Positives = 194/220 (88%), Gaps = 8/220 (3%) Query: 1 MDMGGGTWDKETVTRALQAAYNNPERAVDYLYSGIPETAEVAVPVAHFPXXXXXXXXXXX 60 MDMGGG WDKETVTRAL+AAYNNPERAVDYLYS IPET EVAVPV +FP Sbjct: 155 MDMGGGNWDKETVTRALRAAYNNPERAVDYLYSSIPETTEVAVPVGNFPASQATDVA--- 211 Query: 61 XXPVSGVPNSSPLNMFPQETLSGAPASGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQ 120 PVSG PNS+PLNMFPQETLSGA A LGSL+FL+NN+QFQALRSMVQSNPQILQPMLQ Sbjct: 212 --PVSGAPNSAPLNMFPQETLSGAGAGALGSLNFLKNNRQFQALRSMVQSNPQILQPMLQ 269 Query: 121 ELGKQNPQLLRLIQEHQAEFLQLINEPVDGSEGDMFDQ---PEQDMPHAINVTPAEQEAI 177 ELGKQNPQLLRLIQEH EFLQLINEPV+GSEGD+FDQ P+QD+PHAINVTPAEQEAI Sbjct: 270 ELGKQNPQLLRLIQEHHTEFLQLINEPVEGSEGDIFDQADGPDQDLPHAINVTPAEQEAI 329 Query: 178 QRLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 217 +RLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED Sbjct: 330 ERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 369 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104345 (340 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69293 (135 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs740 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79506 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78333 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20670 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs14660 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40476 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26729 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67798 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5249 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76152 (290 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50623 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75504 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs153106185 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82779 (314 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12900 142 6e-36 >Contig12900 Length = 322 Score = 142 bits (359), Expect = 6e-36, Method: Compositional matrix adjust. Identities = 97/303 (32%), Positives = 161/303 (53%), Gaps = 16/303 (5%) Query: 19 KLHGAFKGWGCDTAVVIDILAHRDAIQRALIQQDYRAMYSEDLCKRL----SSELSGKLE 74 ++HG+ WG + LA+R +R I++ Y+++Y +DL RL ++ +S KL Sbjct: 15 EIHGS---WG-QLNRLARALANRTRHERQQIRETYKSIYGDDLVNRLKDAAAAGISPKLC 70 Query: 75 MAVLLWMHDPAGRDAVVMRNSLTTG----SLKAATEVICSRTPSQIQLIRQHYHSKFGVH 130 A+ +WM + RDAVV+R +L + A E+ R S I LI+Q Y+ +F Sbjct: 71 AALSMWMTEQHERDAVVVREALDDQKGDTNYNALVEIFVGRKSSHILLIKQAYYRRFWRQ 130 Query: 131 LEDDIKR-HTSGDHEKLLLAYVSPPWNEGLEVDRQMVENDAKALYKAGEKRLG-TDERTF 188 L+ DI ++K+L+A V+ +V + + + DA+ LY+ GE G +E Sbjct: 131 LDQDIINIEPPNPYQKILVALVASHKAHHADVSQHIAKADARRLYETGEGSSGPIEEAVV 190 Query: 189 IRIFCERSRAHLAYVAPVYHSMHGNSLKKVVKKETSGNFEYGLLTILKCSENPAKYFA-K 247 + I +RS L Y ++G+ + +K G E + I++C NP YFA + Sbjct: 191 LEILSKRSIPQLKLTFSCYKHIYGHEYTESLKTRNYGELENAMKMIVQCIYNPPDYFAMQ 250 Query: 248 VLHNAMKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSET-SGNYRTFL 306 +L+ +MKG +D+ + RV+V+R E+DM IK E+ KK+ L DA+ SG+YR FL Sbjct: 251 MLYASMKGCISDEGAVRRVVVSRAEVDMDEIKREFKKKHGMELRDAICDNIPSGDYRDFL 310 Query: 307 LSL 309 ++L Sbjct: 311 VAL 313 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12614 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs37297 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34972 (77 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41093 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18841 367 e-103 >Contig18841 Length = 355 Score = 367 bits (941), Expect = e-103, Method: Compositional matrix adjust. Identities = 183/253 (72%), Positives = 213/253 (84%), Gaps = 5/253 (1%) Query: 3 ELVRNKQVILKD-FVSGFPKETDMYMTESSIELKVPKGSNGVLLKNLYLSCDPYMRPRMT 61 E V NKQV+LK+ +SG PK+++M ++ S I+LK+P+G GVLLKNLYLSCDPYM RM Sbjct: 11 EEVSNKQVLLKEHLMSGNPKDSNMCVSTSKIKLKLPRGFTGVLLKNLYLSCDPYMAARMK 70 Query: 62 YIEGSY---VESFKPGLPISGYGVAKVLDSENPEFSKGDLVWGMTGWEEYSLITAP-YLF 117 ++ S ++ ++PG PISGYGV+KVLDS +P+F+KGDLVWG TGWEEYS+ITA L Sbjct: 71 KLDASSSYALDMYRPGQPISGYGVSKVLDSGHPKFAKGDLVWGFTGWEEYSVITATESLI 130 Query: 118 KIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSAKHGECVFISAASGAVGQLVGQFAKLLG 177 KIQHTDVPLSYYTGILGM GMTAY GFYEVCS K GE VF+SAA+GA+GQLVGQFAKL G Sbjct: 131 KIQHTDVPLSYYTGILGMNGMTAYAGFYEVCSPKPGEKVFVSAAAGAIGQLVGQFAKLSG 190 Query: 178 CYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDVYFENVGGKTLDA 237 CYVVG+AGSK KVDLLKNKFGFDEAFNYKEE DL ALKRYFPEGID+YFE+VGGK LDA Sbjct: 191 CYVVGTAGSKKKVDLLKNKFGFDEAFNYKEETDLVVALKRYFPEGIDIYFESVGGKMLDA 250 Query: 238 VLPNMKIRGRIAA 250 VL NM+ +GRIAA Sbjct: 251 VLLNMRFKGRIAA 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79718 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6386 95 2e-22 >Contig6386 Length = 57 Score = 95.1 bits (235), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 44/57 (77%), Positives = 49/57 (85%) Query: 40 MADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 96 MA T CVDIL+A++LPPLGVFLKFGC AEFWICLLLTI GY+PGIIYA+Y ITK Sbjct: 1 MASEGTLNCVDILIAILLPPLGVFLKFGCHAEFWICLLLTIFGYLPGIIYAIYVITK 57 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7972 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10660 77 4e-16 >Contig10660 Length = 324 Score = 76.6 bits (187), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 4/104 (3%) Query: 173 LLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYSFRFWP 232 L +K+L SD G +GR+VLPK AE + P + +G+ + ++D+ + W + FRFWP Sbjct: 44 LFEKMLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLRIQDV-KGKEW--MFQFRFWP 100 Query: 233 NNKSRMYLLENTGDFVKANGLQEGDFIVIYSDLKCGKYLIRGVK 276 NN SRMY+LE +++ LQ GD V +S + LI G + Sbjct: 101 NNNSRMYVLEGVTPCIQSMQLQAGD-TVTFSRMDPEGKLIMGFR 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67057 (281 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53549 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73368 (58 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38911 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs77660 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6106186 (109 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100012 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34284 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66719 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42241 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11882 (83 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78621 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51137 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95088 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32643 116 3e-28 >Contig32643 Length = 72 Score = 116 bits (290), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 56/69 (81%), Positives = 61/69 (88%) Query: 141 ESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKKNENQQKGMASDDKSQSNLNLNS 200 ESENK LK+RKPYLHESRH HALRRARGCGGRFLN+KKN NQ M S DKSQSN+NLN+ Sbjct: 1 ESENKALKNRKPYLHESRHQHALRRARGCGGRFLNAKKNGNQPDEMTSGDKSQSNINLNT 60 Query: 201 DKNEIASSD 209 DKNE+ASSD Sbjct: 61 DKNELASSD 69 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20256 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41958 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs87016 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4715 213 1e-57 >Contig4715 Length = 160 Score = 213 bits (541), Expect = 1e-57, Method: Compositional matrix adjust. Identities = 100/150 (66%), Positives = 117/150 (78%) Query: 2 DKKKVMVAIDESECRHYALQWALENLGDAISKSDLIIFTARPTEFIYVQASMFGAAPPDL 61 ++KKVMVAIDESE YA WALENL + I S L++FTA+P +F A+ +GAAP L Sbjct: 9 ERKKVMVAIDESEFSLYAFNWALENLRETIQSSQLVVFTAQPIDFASTYAASYGAAPAQL 68 Query: 62 LMSIQENQKKXXXXXXGRAKEICAKHGVVAETMTEMGDPKIVICEAAEKHKIQLLIVGSH 121 + S+ EN KK RAKEICAKHG+V ET+TE+GDPK+VICEA EKH IQLL++GSH Sbjct: 69 VTSLLENHKKVALALLERAKEICAKHGIVPETVTEVGDPKVVICEAVEKHNIQLLVLGSH 128 Query: 122 SRGPIQRAFLGSVSNYCVHNAKCPVLVVRK 151 RG IQRAFLGSVSNYCVHNAKCPVLVVRK Sbjct: 129 GRGGIQRAFLGSVSNYCVHNAKCPVLVVRK 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23191 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8707 254 6e-70 >Contig8707 Length = 249 Score = 254 bits (650), Expect = 6e-70, Method: Compositional matrix adjust. Identities = 130/199 (65%), Positives = 153/199 (76%), Gaps = 4/199 (2%) Query: 1 MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETA 60 MY GGY AEV LSP ATE+D++ FF HCG HVEIIRSGE TAYVTF +A+AL+TA Sbjct: 1 MYPGGYTAEVTSLSPKATEEDVYNFFGHCGAVEHVEIIRSGEYASTAYVTFRDAFALQTA 60 Query: 61 VLLSGAAIVDQPVCIIRWGAFTDEPNPWISSWGFDENSGSMTTHVGQFVSTPGEAVTVAQ 120 +LLSGA IVDQ VCI WG++ DE + W S + N+ S T H QFVSTPGEAVTV Sbjct: 61 ILLSGARIVDQCVCITSWGSYIDESDAWNGSTYPEGNTSSTTYHSSQFVSTPGEAVTV-- 118 Query: 121 DAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKS 180 VKT+ +KGYVL KDAL KAKA DES+ LSA+AAAKV ELS+RIGLT+KI+A E +K+ Sbjct: 119 --VKTLASKGYVLGKDALTKAKAFDESHQLSATAAAKVCELSDRIGLTEKIHAGREVVKT 176 Query: 181 VDEKYHVSDITKSAASFTG 199 VDEK+HVSDITKSAA+ TG Sbjct: 177 VDEKFHVSDITKSAATVTG 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs28197 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61925 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25868 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76009 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6310 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64173 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52138 (120 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28295 115 2e-28 >Contig28295 Length = 155 Score = 115 bits (289), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 70/130 (53%), Positives = 81/130 (62%), Gaps = 22/130 (16%) Query: 1 MSGT--EEVKDQEMVDGN----------------APEESQKTIPXXXXXXXXLKKKYGGI 42 MSG +EVK+QE+ D + E +P +KKKYGGI Sbjct: 1 MSGANMDEVKEQEVADSTPMDLGDGDDAGGDQKASNENHGNPMPSAQQEEAAIKKKYGGI 60 Query: 43 VPKKPPLISKDHERAYFDSADWALGKQQGVEKPKGPLEALRPKLQPT-QQQTRYRKSPYA 101 +PKK PLISKDHERAYFDSADWALGKQ KPKGPLEALRPKLQPT QQ R R+S Y+ Sbjct: 61 LPKKTPLISKDHERAYFDSADWALGKQGA--KPKGPLEALRPKLQPTPHQQGRSRRSAYS 118 Query: 102 PAG-GEDGGS 110 G G+DGG+ Sbjct: 119 RGGEGDDGGN 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95107 (120 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29712 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23023 188 2e-50 >Contig23023 Length = 350 Score = 188 bits (477), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 91/103 (88%), Positives = 98/103 (95%) Query: 2 DVWQGTQLLAVDVGAAMELLRRALVGDELTQKEKQALQRTLTDLASVVPIGVLMLLPVTA 61 DVWQGTQLLA+DVGAA LLRR L+GDELT+KEK+ LQRTLTDLASVVPIGVLMLLPVTA Sbjct: 237 DVWQGTQLLAIDVGAATGLLRRVLIGDELTEKEKKVLQRTLTDLASVVPIGVLMLLPVTA 296 Query: 62 VGHAAMLAAIQRYVPGLIPSTYGPERLDLLRQLEKVKEMESSE 104 VGHAAMLAAIQRYVP LIPSTYGPERL+LLRQ+EK+KEMESSE Sbjct: 297 VGHAAMLAAIQRYVPALIPSTYGPERLNLLRQVEKLKEMESSE 339 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59973 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8855 120 1e-29 >Contig8855 Length = 167 Score = 120 bits (302), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 68/172 (39%), Positives = 105/172 (61%), Gaps = 14/172 (8%) Query: 25 MTD-GKKKMKVMVAIDESAESVNALKWALDNLYGIVGFTPEAGGGGGILTIVHVQQPFQR 83 MTD + + +++VA+DE ES++AL W L N+ G L ++H + P R Sbjct: 1 MTDVAESERRILVAVDEGEESMHALSWCLKNVAG--------QNSKDTLVLLHAKPP--R 50 Query: 84 FVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKM--VKAESLVLEGDPK 141 V AL +A+ +S ++ + K + + ++ +A +MCKD +KAE+ V GDP+ Sbjct: 51 AVFTALD-GTAYLFSSDILAATEKYGADVADCVMEKARKMCKDLQPDLKAETKVESGDPR 109 Query: 142 DMICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVKPPK 193 D+ICQ E++ D+LV+GS G G IKRAFLGSVS++CA + CP++IVK PK Sbjct: 110 DVICQMVERVRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPK 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67827 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs169106187 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24372 300 6e-84 >Contig24372 Length = 148 Score = 300 bits (769), Expect = 6e-84, Method: Compositional matrix adjust. Identities = 142/148 (95%), Positives = 146/148 (98%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPY GGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPGDSPYTGGVFLVSIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKSDKAKYESTARSWTQKYAMG 148 PEIAHMYK+D+AKYE+TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRAKYEATARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2364 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67321 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67555 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3887 164 1e-42 >Contig3887 Length = 166 Score = 164 bits (414), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 95/132 (71%), Positives = 106/132 (80%), Gaps = 1/132 (0%) Query: 1 MGYWKSKVLPRIKKVFE-KNGTKKAAAAEACKSFDDSXXXXXXXXXXXXXXLQPKVVEIY 59 MGYW++KVLP+IKKVFE K TKKAAAAEACKSFD+S LQPKV+E+Y Sbjct: 1 MGYWQTKVLPKIKKVFETKTSTKKAAAAEACKSFDESKEEITKEFEEKKAELQPKVIELY 60 Query: 60 EASSAEIKTLVKDRKEDGLKKHSTAVHKLLEELVKIEFPGSKAVSEASSKFGAASVPGPV 119 EASSAEIK LVK+RKE GLKK+S AVHK LEEL KIEFPGSK VSEASSK+G+A V PV Sbjct: 61 EASSAEIKILVKERKESGLKKYSAAVHKFLEELAKIEFPGSKTVSEASSKYGSAYVSSPV 120 Query: 120 FFIFEKVSTFIV 131 FF+FEKVSTFIV Sbjct: 121 FFVFEKVSTFIV 132 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4029 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27018 61 2e-11 >Contig27018 Length = 199 Score = 60.8 bits (146), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 7/93 (7%) Query: 132 NAVLSKLKKEVYNPAPMNLAKRLSLYYRDQATNVYKEMQKQKEEDAMRCAVCLXDFEPKE 191 + +L +L+KEVY A + S + ++ K D CAVCL P E Sbjct: 112 SVLLGELQKEVYG------ANKSSSSTSGSKKFSWSKL-TWKSSDQDECAVCLERLRPGE 164 Query: 192 KVMLTPCNHMFHEDCIVPWVKSNAQCPVCXFSL 224 ++ PC H FH C+VPW+ +NA CP C + Sbjct: 165 TLVHLPCAHRFHSGCMVPWLHNNAHCPCCRMEI 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs46215 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig651 137 9e-35 >Contig651 Length = 233 Score = 137 bits (345), Expect = 9e-35, Method: Compositional matrix adjust. Identities = 71/158 (44%), Positives = 100/158 (63%), Gaps = 4/158 (2%) Query: 1 MGQISDGDIKTTAVITGYXXXXXXXXXXXXXXVTADNTSSQQVQNSNIAFRAARQVPGLV 60 +G I G+ KT+ + GY V ADN++S QNS F +R++PG + Sbjct: 80 VGHIPTGNPKTSGTLGGYSGPGSICATSCL--VNADNSTS--YQNSTATFSDSRELPGFL 135 Query: 61 SNVGDIQGSYGAKSGEVFDLGSLRNHGFMGKGNCIPSRLAVDEFESPMNNLNYGNIYLDN 120 N + QG Y KSGE+ D G LRN GF+GK CIPSR AVD+FES M+NLN G I++++ Sbjct: 136 HNTANSQGFYVDKSGEMLDQGPLRNLGFVGKETCIPSRFAVDDFESQMSNLNPGRIHVES 195 Query: 121 NANKVKEEPNLEFVENAKVGIPMYQQYAPNDLMSVFTD 158 + VK+EP+ ++V+NAK+GIP+ QY+ +D MS F D Sbjct: 196 SGTLVKQEPSEDYVDNAKLGIPILHQYSSSDFMSPFAD 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32345 (190 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17701 139 4e-35 >Contig17701 Length = 168 Score = 139 bits (349), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 63/85 (74%), Positives = 74/85 (87%) Query: 66 CQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCSRFHELSEFDETKRS 125 CQVD C ADLSD KQY+RRHKVC+VHAKA +++GG RQRFCQQCSRFH LSEFD++KRS Sbjct: 82 CQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRFCQQCSRFHSLSEFDDSKRS 141 Query: 126 CRRRLAGHNERRRKNAAESNGEGSS 150 CRRRLAGHNERRRK ++E +G G + Sbjct: 142 CRRRLAGHNERRRKTSSEYHGHGGT 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88716 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51829 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6904 151 8e-39 >Contig6904 Length = 421 Score = 151 bits (382), Expect = 8e-39, Method: Compositional matrix adjust. Identities = 84/165 (50%), Positives = 108/165 (65%), Gaps = 9/165 (5%) Query: 11 MTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFYDRPE------NL 64 MTNAPFMLNVDCDMYANNP+IVL AMCL LG K+E E AF+Q PQ FYD E N+ Sbjct: 1 MTNAPFMLNVDCDMYANNPKIVLHAMCLLLGFKHEKEGAFVQFPQMFYDTLEDDPFGSNV 60 Query: 65 CILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKK-FGNSKE 123 + I G+ GIQGP Y GTG FHRR V+YGL L +++GN+ + L K+ FGNS E Sbjct: 61 VEAVKKIWPGLAGIQGPIYAGTGCFHRRKVIYGLSL--TDNEGNLTSERLNKECFGNSPE 118 Query: 124 FIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEV 168 I+SA Q L + ++S +++ A++VA YE + WG +V Sbjct: 119 LIRSATQILLEENIDQLDDLSCAVEIAYQVAGSEYEDDTLWGKKV 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62609 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98630 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33343 (298 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91046348 90 4e-20 >91046348 Length = 220 Score = 90.1 bits (222), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 39/56 (69%), Positives = 47/56 (83%) Query: 5 TITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVR 60 TITK RE WT+EEH KFLEAL+LF R W+KIE+ VG+KT +QIRSHAQK+F KV + Sbjct: 33 TITKSRESWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQK 88 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78797 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19677 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48779 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92264 (486 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23497 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2987 (65 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13607 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21414 (61 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60808 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25354 377 e-107 >Contig25354 Length = 245 Score = 377 bits (969), Expect = e-107, Method: Compositional matrix adjust. Identities = 178/229 (77%), Positives = 198/229 (86%) Query: 15 LRSVIQRVHQAAERSSRPPDRIRIVAVSKTKPVSVIRQVYEAGHRCFGENYVQEIVEKAA 74 LRSV+ RV QAAERS R P +R+VAVSKTKPVS+IRQVY GHRCFGENYVQEI+EKA Sbjct: 14 LRSVMLRVRQAAERSGRDPALVRVVAVSKTKPVSLIRQVYNFGHRCFGENYVQEILEKAP 73 Query: 75 QLPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGRKPLKVLV 134 QLPDD+EW F+G+LQ+NK K LLAGVPNLA+VE VDNEKIA L+R V +GR PLKVLV Sbjct: 74 QLPDDIEWRFVGHLQTNKAKLLLAGVPNLALVEGVDNEKIANHLDRAVSNLGRNPLKVLV 133 Query: 135 QVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGMPDYTSTPENFKTLAKCRS 194 QVNTSGEESKSG+ PSGC+EL KHV CPNL+F GLMTIGMPDYTSTPENF+ L+KCR+ Sbjct: 134 QVNTSGEESKSGIHPSGCVELAKHVKFQCPNLQFSGLMTIGMPDYTSTPENFRMLSKCRT 193 Query: 195 EVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKK 243 EVCKAL + EE C+LSMGMSGDFE AIEMGSTNVRIGSTIFG REYPKK Sbjct: 194 EVCKALAMAEEHCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKK 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs115106187 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52491 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99541 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 158 6e-41 >Contig2543 Length = 199 Score = 158 bits (400), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 73/162 (45%), Positives = 107/162 (66%) Query: 8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQES 67 K +++GD G GK+ L+L+F +F + TIG F ++++++ IK IWDTAGQE Sbjct: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 Query: 68 FRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRR 127 + S+ YYRGAA A++VYDIT ++F W+ + ++ AN + + L GNK DL +R Sbjct: 72 YHSLAPMYYRGAAAAVVVYDITSMDSFLRAKKWVLEVQRQANPTLIMFLAGNKADLEDKR 131 Query: 128 AVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYK 169 V +EEGEQ+AKE+GL+F+E SAKTAQNV E F + A + K Sbjct: 132 KVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKLAK 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23106181 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30918 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97445 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70679 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52096 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs18552 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7125 65 2e-13 >Contig7125 Length = 102 Score = 65.1 bits (157), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 41/99 (41%), Positives = 49/99 (49%), Gaps = 9/99 (9%) Query: 1 MARSLFKAKLLLAPVADGISLSIGRRGYAAAAP--LGTISRTGIMEKNDLTPAVREDSGA 58 MARS AK L V DG S SI RRGYAA + ++ R G +++SG Sbjct: 1 MARSFSNAKFLSVLVVDGFSSSISRRGYAAGSQGVASSVVRGGGATNPRSVNITKKNSGE 60 Query: 59 SS-------AWAPDPITGYYRPENRAVEIDPAELREMLL 90 +W PDP TG Y PEN +ID AELR LL Sbjct: 61 EKVGSTFKVSWVPDPKTGVYGPENGTAKIDAAELRAALL 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52645 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34256 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7496 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10305 95 8e-22 >Contig10305 Length = 196 Score = 95.1 bits (235), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 42/60 (70%), Positives = 54/60 (90%) Query: 1 MGRKKLQLQRIENKSRCQVTFSKRRSGLIKKARELSVLCDVDLALVIFSSRGRLYEFCSA 60 MGR +++L+RIENK QVTF+KRR+GL+KKA ELSVLCD ++AL+IFSSRG+LYEFCS+ Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS 60 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23028 (80 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10305 124 4e-31 >Contig10305 Length = 196 Score = 124 bits (311), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 60/62 (96%), Positives = 61/62 (98%) Query: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS 60 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS+RGKLYEFCSS Sbjct: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS 60 Query: 61 SR 62 R Sbjct: 61 FR 62 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32673 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs17743 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42225 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs30951 (59 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4163 71 4e-15 >Contig4163 Length = 247 Score = 71.2 bits (173), Expect = 4e-15, Method: Composition-based stats. Identities = 31/48 (64%), Positives = 38/48 (79%) Query: 12 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGT 59 Q K LLQS+ LY+YILETSVYPREPE +K++R+VTA HPW +M T Sbjct: 16 QEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTT 63 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs24443 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105838 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 156 4e-40 >Contig31581 Length = 128 Score = 156 bits (394), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGM 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 156 bits (394), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 137 IQKESTLHLVLRLRGGM 153 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 150 bits (379), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 74/75 (98%), Positives = 74/75 (98%) Query: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 213 IQKGSTLHLVLRLRG 227 IQK STLHLVLRLRG Sbjct: 61 IQKESTLHLVLRLRG 75 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69806 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs14479 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51106185 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25420 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70317 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2558 121 2e-30 >Contig2558 Length = 78 Score = 121 bits (304), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 58/76 (76%), Positives = 65/76 (85%) Query: 25 VRRGRLDWPEGAASRESIKSVMKLPRLQNLIMQHVDHSAGDLTHLLQGLLRYDPTDRLTA 84 R LDWPEGA SRESIK+V+KL RLQN++MQHVDHSAGDL LLQGLL++DP+ RLTA Sbjct: 2 FRCCPLDWPEGATSRESIKAVLKLHRLQNIVMQHVDHSAGDLIDLLQGLLKFDPSSRLTA 61 Query: 85 REALRHPFFTRDHLRR 100 EALRHPFFTRDH RR Sbjct: 62 PEALRHPFFTRDHYRR 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91669 (141 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72108 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7180 351 4e-99 >Contig7180 Length = 199 Score = 351 bits (901), Expect = 4e-99, Method: Compositional matrix adjust. Identities = 171/199 (85%), Positives = 181/199 (90%), Gaps = 10/199 (5%) Query: 1 MSFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP 60 MSFIGTQQKCK CEKTVYPVE+LSADGI YHKSCFKC+HCKGTLKLSNYSSMEGVLYCKP Sbjct: 1 MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCASCSKTVYPLEK 120 HFEQLFKE+GNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQ+KCA+C KT YPLEK Sbjct: 61 HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK 120 Query: 121 VAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMK 180 V VE+QAYHK+CFKCSHGGC I+PSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSAS+K Sbjct: 121 VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK 180 Query: 181 R----------AAASVPEA 189 R AS+PEA Sbjct: 181 RTAAAAAAAAATVASIPEA 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60298 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12536 265 3e-73 >Contig12536 Length = 209 Score = 265 bits (678), Expect = 3e-73, Method: Compositional matrix adjust. Identities = 134/167 (80%), Positives = 146/167 (87%) Query: 13 LLATGLTDIEIHFLQIKFTAIGVYLDPEILSHLQQWKGKQGSSLAQDDDFFDALVSAPVE 72 LL G+TDIEIHFLQIKFTAIGVYLD EI+SHLQQWK K+ + LA+DDDFFDALVSAPVE Sbjct: 25 LLGQGITDIEIHFLQIKFTAIGVYLDAEIVSHLQQWKAKKANELAEDDDFFDALVSAPVE 84 Query: 73 KFLRIVVIKEIKGSQYGVQLESAVRDRLAGADKYXXXXXSALEKIVEFFQSKYFKKDSVI 132 KF+R+VVIKEIKGSQYGVQLESAVRDRLA DKY LEK+VEFFQSKYFKKDSVI Sbjct: 85 KFIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYEEEEEETLEKVVEFFQSKYFKKDSVI 144 Query: 133 AYHFPATSPTAEIVXTSEGKEDSKIXVENANVVEMIKKWYLGGARGV 179 +HFPATS TAEIV ++EGKE+SKI VENANVVE IKKWYLGG RGV Sbjct: 145 TFHFPATSNTAEIVFSTEGKEESKIKVENANVVENIKKWYLGGTRGV 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15458 (555 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11592 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs39821 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21491 407 e-116 >Contig21491 Length = 268 Score = 407 bits (1046), Expect = e-116, Method: Compositional matrix adjust. Identities = 213/268 (79%), Positives = 230/268 (85%), Gaps = 10/268 (3%) Query: 1 MASTQCFLHHHALSTTPARTSSSQRH--VSNI-KPTQIV-CRAQKQAV--QEDDGSAVSR 54 MAST CFLHHHAL+T + SSS V NI K Q+V CRAQKQA +E+ G+ VSR Sbjct: 1 MASTACFLHHHALTTAASARSSSSSQRQVVNINKHNQVVICRAQKQAAGQEEESGANVSR 60 Query: 55 RLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSK 114 RLALTVLIGAAA+GSKVSPADAAYGESANVFGKPK+NTDFLPY G+GFKLSIP+KWNPSK Sbjct: 61 RLALTVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGEGFKLSIPAKWNPSK 120 Query: 115 EREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTS 174 E EFPGQVLRYEDNFD NSNVSV ITPTDKKSI DYGSPEEFL+KVDYLLGKQAY GKT Sbjct: 121 EVEFPGQVLRYEDNFDSNSNVSVTITPTDKKSIADYGSPEEFLAKVDYLLGKQAYFGKTE 180 Query: 175 SEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYI 230 SEGGFDP AVATANILE+S R YY++SVLTRTADGDEGGKHQLITATVK GKLYI Sbjct: 181 SEGGFDPGAVATANILESSSRVIDGKQYYYVSVLTRTADGDEGGKHQLITATVKDGKLYI 240 Query: 231 CKAQAGEQRGFKGARKYVESTASSFSVA 258 KAQAG++R FKGARK+VESTASSFSVA Sbjct: 241 LKAQAGDKRWFKGARKFVESTASSFSVA 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs97092 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38499 (88 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13926 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4263 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30449 84 2e-18 >Contig30449 Length = 264 Score = 83.6 bits (205), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 43/130 (33%), Positives = 75/130 (57%), Gaps = 6/130 (4%) Query: 114 EEGSSWDMVSDNDLWESGNID----LDREDYVLVSEEDIVDGIACFMAAYLLSLKQAKNL 169 EE S W ++D+ + G ++ +D E YV+VSEE +VDGIA FMA ++S +A+NL Sbjct: 137 EEASWWVWITDDMI--PGKVEERSGIDNESYVVVSEEHVVDGIANFMAKCIVSNPKARNL 194 Query: 170 TPNQLQEALSKTFSVKKRKGKLRKAWDGSKVIYNVASWGATAVGIYQNPVILRAASKAFW 229 TP +LQ+ ++K + K+ W K+ Y +++WG G+Y++ +L+ A+ Sbjct: 195 TPEELQKIVAKAMGGVGKLEKVLGIWHAGKLFYTLSTWGLALTGLYRSRAVLKFAAMGLH 254 Query: 230 TSCHVISKLL 239 T+ I + + Sbjct: 255 TTSKAIMRAM 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs81333 (370 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48411817 246 3e-67 >48411817 Length = 154 Score = 246 bits (629), Expect = 3e-67, Method: Compositional matrix adjust. Identities = 118/134 (88%), Positives = 122/134 (91%) Query: 3 EITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMN 62 EITNV EYEAIAKEKLPKMV+DYYASGAEDQWTL ENRNAF+RILFRPRILIDVS+IDM Sbjct: 21 EITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDMT 80 Query: 63 TTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWSTSSVEEVASTGP 122 TTVLGFKISMPIMIAPTAMQKMAHPEGEY GTIMTLSSW+TSSVEEVASTGP Sbjct: 81 TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 140 Query: 123 GIRFFQLYVYKDRN 136 GIRFFQLYVYKDRN Sbjct: 141 GIRFFQLYVYKDRN 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36721 (287 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4826 (268 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7788 486 e-139 >Contig7788 Length = 264 Score = 486 bits (1251), Expect = e-139, Method: Compositional matrix adjust. Identities = 238/254 (93%), Positives = 245/254 (96%), Gaps = 1/254 (0%) Query: 16 LRATPFLGQSRTTA-NALKDVVPMGNAKYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEF 74 LR TPFLGQSR + N LKDVVPMG KYTMGN+LWYGPDRVKYLGPFSAQTPSYL GEF Sbjct: 11 LRTTPFLGQSRGPSFNTLKDVVPMGTGKYTMGNDLWYGPDRVKYLGPFSAQTPSYLNGEF 70 Query: 75 PGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCITPEVLEKWLRVDFKEPVWFK 134 PGDYGWDTAGLSADPEAFA+NRALEVIHGRWAMLGALGCITPEVLEKW+RVDFKEPVWFK Sbjct: 71 PGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWVRVDFKEPVWFK 130 Query: 135 AGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLPGVGEGNDLYPGG 194 AGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQV+LMGLVEGFRINGL GVGEGN+LYPGG Sbjct: 131 AGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVILMGLVEGFRINGLDGVGEGNNLYPGG 190 Query: 195 QYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLENPVA 254 QYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHL+NPVA Sbjct: 191 QYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVA 250 Query: 255 NNAWVYATKFVPGS 268 NNAWVYATKFVPGS Sbjct: 251 NNAWVYATKFVPGS 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs70492 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10848 90 2e-20 >Contig10848 Length = 160 Score = 89.7 bits (221), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 44/114 (38%), Positives = 76/114 (66%), Gaps = 2/114 (1%) Query: 40 SSPNFVSEVVNIYFHESEKLLRNLRSLLMDKEFSDYKKLGIHLNQMMGSSSSIGAKRVSN 99 ++P+FV EVV+++F ++E+L+ L L D++ DYK + ++Q+ GSSSSIGA+RV Sbjct: 48 NNPDFVVEVVSLFFQDTERLVNELAKAL-DQQCVDYKFVDKSVHQLKGSSSSIGAQRVQR 106 Query: 100 VCVAFRAASEQNNRAGCLRALELLEHEYCYLNNKFHELFQIEQQRELAAGVRYP 153 C++FR ++ N C++ L+ ++HEY + NK LF++++Q +AAG P Sbjct: 107 ACISFRNFCDEQNVEWCIKCLQQVKHEYLLVKNKLENLFELQRQV-VAAGGSLP 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54530 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2612 342 3e-96 >Contig2612 Length = 248 Score = 342 bits (878), Expect = 3e-96, Method: Compositional matrix adjust. Identities = 179/245 (73%), Positives = 193/245 (78%) Query: 3 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICH 62 IAFGRFDDSFSLGS KAYLAEFISTLLFVFAGVGSAIA+NK+T+DAALDP+GLVA+AI H Sbjct: 4 IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVAIAH 63 Query: 63 XXXXXXXXXXXXNISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVT 122 NISGGHVNPAVTFGLALGGQITILTGIFYWIAQL+G+IVA+F+LK VT Sbjct: 64 GFALFVAVSIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVAAFILKFVT 123 Query: 123 GGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA 182 GGL +P H+ TF LVYTVYATAADPKKGSLGTIAPIAIGFIVGA Sbjct: 124 GGLTIPIHSLAAGVGAIQGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA 183 Query: 183 NILAAGPFSGGSMNPARSFGPAVASGNFQDNWIYWVXXXXXXXXXXXXXXNVFMHSEHAP 242 NILAAGPFSGGSMNPARSFGPAVASG+F DNWIYWV NVF+HSEHAP Sbjct: 184 NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNVFIHSEHAP 243 Query: 243 LSYDY 247 L +Y Sbjct: 244 LVNEY 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100704 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs78778 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3389 231 5e-63 >Contig3389 Length = 278 Score = 231 bits (589), Expect = 5e-63, Method: Compositional matrix adjust. Identities = 113/153 (73%), Positives = 125/153 (81%), Gaps = 1/153 (0%) Query: 19 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRS-VSVSAAAADPNRPLWFPGSTPPEWLD 77 QK S ATKASF AT G+ S +V AAAADP+RPLWFPGSTPP WLD Sbjct: 28 QKGGSSLAATKASFFGGRKLRVRSFTATKGSSSSFTVRAAAADPDRPLWFPGSTPPPWLD 87 Query: 78 GSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWY 137 GSLPGDFGFDPLGL SDP++L+WN Q+E+VHCRWAMLGAAGIFIPE LTK+GILNTPSWY Sbjct: 88 GSLPGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWY 147 Query: 138 TAGELEYFTDTTTLFIVEMIFIGWAEGRRWADI 170 TAGE EYFTDTTTLF+VE++ IGWAEGRRWADI Sbjct: 148 TAGEQEYFTDTTTLFVVELVLIGWAEGRRWADI 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs539 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63107 (342 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8750 284 2e-78 >Contig8750 Length = 294 Score = 284 bits (726), Expect = 2e-78, Method: Compositional matrix adjust. Identities = 140/256 (54%), Positives = 173/256 (67%), Gaps = 5/256 (1%) Query: 30 FLEDFKVTWSDAHLRQIEGGRAIQLVLDQNSGCGFASKRQYLFGRVSMKIKLVPGDSAGT 89 F ++ TW+ H++ GG+ IQL LD+ +G GF SK YLFG M+IK+VPGDSAGT Sbjct: 33 FGRNYMPTWAFDHIKYFNGGKEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSAGT 92 Query: 90 VTAFYMNSNTENVRDELDFEFLGNRTGQPYTVQTNIYANGKGDREQRVNLWFDPAADYHL 149 VTA+Y++S N DE+DFEFLGNRTGQPY +QTN++ GKGDREQR+ LWFDP A YH Sbjct: 93 VTAYYLSSQN-NEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAYHS 151 Query: 150 YTILWNHHHIVFYVDDVPIRVYKNSGR--APFPMNQPMGVYSTLWEADDWATRGGLEKID 207 Y +LWN + IVF VDD+PIRV+KNS FP NQPM +YS+LW ADDWATRGGLEK D Sbjct: 152 YAVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEKTD 211 Query: 208 WSKAPFYAYYRDFDIEGCPVPGPAN-CASNPGNWWEANNYQP-SPHGNKEIQMGSSHHMI 265 WSKAPF A YR F I+GC A CA+ WW+ +Q + ++ I Sbjct: 212 WSKAPFIASYRGFHIDGCEASVEAKYCATQGKRWWDQKEFQDLDAQQWRRLRWVRKKFTI 271 Query: 266 YDYCTDKSGYPVPPTE 281 Y+YCTD+ YP P E Sbjct: 272 YNYCTDRVRYPSMPPE 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1106182 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12983 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27141 67 6e-14 >Contig27141 Length = 283 Score = 67.0 bits (162), Expect = 6e-14, Method: Composition-based stats. Identities = 30/41 (73%), Positives = 35/41 (85%) Query: 4 PGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFA 44 P SV +KVVCLTQVV+ADEL+DD EY++ILEDMR EG KF Sbjct: 176 PSSVATKVVCLTQVVTADELRDDTEYDDILEDMRLEGEKFG 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs47367 (140 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14765 84 1e-18 >Contig14765 Length = 173 Score = 84.0 bits (206), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/113 (41%), Positives = 63/113 (55%), Gaps = 2/113 (1%) Query: 2 IIAGADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCE 61 I AG D +L+PSRFEPCGL QL+AMRYGTVP+V STGGL DTV Q G Sbjct: 50 ITAGCDILLMPSRFEPCGLNQLYAMRYGTVPVVHSTGGLRDTVVNFNPYAQGGKGDGTGW 109 Query: 62 AVDPVDVAAVSTTVRRALATYGTQ--ALAEMMKNGMAQDLSWKGPAKKWEETL 112 P+ ++ ++ A T+ + +MK GM +D +W+ A K+E Sbjct: 110 TFSPLTKESMLAALKLACRTFREYKPSWEGLMKRGMERDFTWESAAIKYERVF 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104106187 (354 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22639 489 e-140 >Contig22639 Length = 298 Score = 489 bits (1260), Expect = e-140, Method: Compositional matrix adjust. Identities = 222/289 (76%), Positives = 249/289 (86%) Query: 59 NPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTHDKSLKLPKSFDARSAWPQCSTISRIL 118 NP+FSNYTV QF HLLGVKPTP+ L P+KT+ KSLKLP +FDAR+AWPQC+TI RIL Sbjct: 2 NPRFSNYTVSQFMHLLGVKPTPQKDLQSFPIKTYPKSLKLPNNFDARTAWPQCNTIGRIL 61 Query: 119 DQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVNXXXXXXXXXXXXXXXXXYPISAWRYF 178 DQGHCGSCWAF AVEALSDRFC+H+GMN+SLSVN YPI AWRYF Sbjct: 62 DQGHCGSCWAFAAVEALSDRFCVHYGMNISLSVNDLLACCGFMCGAGCNGGYPIYAWRYF 121 Query: 179 VHHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCVRKCVKKNQLWRNSKHYSISAYRINSD 238 +HHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCV+KCV NQ+W+NSK YSISAYRINSD Sbjct: 122 IHHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCVKKCVDGNQIWKNSKRYSISAYRINSD 181 Query: 239 PEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYW 298 P IMAE+Y+NGPVEV+FTVYEDFAHYKSGVYKH+ GDV+GGHAVKLIGWGT++DGEDYW Sbjct: 182 PHSIMAEVYRNGPVEVAFTVYEDFAHYKSGVYKHVKGDVLGGHAVKLIGWGTTNDGEDYW 241 Query: 299 ILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEITSAD 347 +LANQWNRSWG DGYFKI+RG+NECGIEEDVVAGLPSSKN + ++ S D Sbjct: 242 LLANQWNRSWGDDGYFKIRRGTNECGIEEDVVAGLPSSKNFISQVASVD 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10433 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22698 152 1e-39 >Contig22698 Length = 189 Score = 152 bits (383), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 70/84 (83%), Positives = 77/84 (91%) Query: 1 AGKAVPNLQLEHGLAVERVYTGSFMTSLDMAGFSISIMKADEVILKHLDATTKAPHWPVG 60 +GKAVP LQLEHGLAV+RVYTGSFMTSLDMAGFSIS+MKAD+ IL+ LDA TKAP+WPVG Sbjct: 17 SGKAVPKLQLEHGLAVDRVYTGSFMTSLDMAGFSISVMKADQTILQRLDAATKAPYWPVG 76 Query: 61 VDGNRPPAKIPVPMPPSHSMKSDE 84 VDGN PPAKIPVP+PPS SM SDE Sbjct: 77 VDGNHPPAKIPVPLPPSRSMNSDE 100 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10036 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13327 256 2e-70 >Contig13327 Length = 496 Score = 256 bits (655), Expect = 2e-70, Method: Compositional matrix adjust. Identities = 131/266 (49%), Positives = 177/266 (66%), Gaps = 6/266 (2%) Query: 1 RASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESN 60 RASRF+ANFGA V ICELPF +SSE GGVGGTCV+RGCVPKK+LVY + F E +++ Sbjct: 36 RASRFSANFGAKVGICELPFHPVSSEVIGGVGGTCVIRGCVPKKILVYGASFGGEIEDAR 95 Query: 61 GFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDV-- 118 +GW+ + +W L+ K E+ RL GIYK +L N+G+ EG GKIV P+ V+V Sbjct: 96 NYGWEVNEKVDFNWKKLLQKKTDEIVRLNGIYKRLLSNSGVKFFEGEGKIVGPNDVEVTQ 155 Query: 119 -DG-KL-YSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEF 175 DG KL YSA+HILI+ G R P IPG E I SD AL L P++ ++GGGYIA+EF Sbjct: 156 LDGTKLSYSAKHILIATGSRAQRPAIPGQELGISSDEALSLEELPKRAVVLGGGYIAVEF 215 Query: 176 AGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEESPQAILKSTDGSL 235 A I+ G+ + V +F R++ LRGFD+++R VA + RGI+ H + + ++K+ DG + Sbjct: 216 ASIWRGMGASVDLFFRKELPLRGFDDELRAVVARNLEGRGIDLHPQTNLTELVKTEDG-I 274 Query: 236 SVKTNKGTVDGFSHVMFATGRXPNTK 261 V+T+ G V+FATGR PNTK Sbjct: 275 KVRTDHGEELIADVVLFATGRSPNTK 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs69649 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs314 (386 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91270 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226790703 115 2e-28 >226790703 Length = 97 Score = 115 bits (288), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 58/72 (80%), Positives = 59/72 (81%) Query: 1 MYSGDIMTVNVNLAGLPALVLPCGFVEXXXXXXXXXXQMIGAAFDEGKLLKVGHIFEQTL 60 MY+GDIMTVNVNLAGLPALVLPCGFVE QMIGAAFDEGKLLKVGHIFEQ L Sbjct: 22 MYAGDIMTVNVNLAGLPALVLPCGFVEGGCAALPVGLQMIGAAFDEGKLLKVGHIFEQIL 81 Query: 61 QGCRFVPPLIAD 72 Q C FVPPLIAD Sbjct: 82 QNCNFVPPLIAD 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48857 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13126 214 7e-58 >Contig13126 Length = 304 Score = 214 bits (546), Expect = 7e-58, Method: Compositional matrix adjust. Identities = 106/147 (72%), Positives = 131/147 (89%) Query: 56 LSRSVLAPLIGVIGYRAVLGLAGYIVSNVAFLFAAVYFYRLSVMILKDPDAALCASLLFC 115 LSR+VLAPL+ VIG RAVLGL+GY+++N+ F+F AVY YRLSV+ILKD +AA+ ASLLFC Sbjct: 4 LSRTVLAPLVPVIGQRAVLGLSGYVINNIGFVFGAVYLYRLSVVILKDQEAAVRASLLFC 63 Query: 116 FNPASIFYTSIYSESLYALFSVGGLYYLMSGALNISVLWLAISGCARSNGVLNAGYFCFQ 175 FNPASIFY+SIYSE+L+ALFSVGGLY+L+SG I+VLW A+SG +RSNGVLNAGYFCFQ Sbjct: 64 FNPASIFYSSIYSETLFALFSVGGLYHLISGKDVIAVLWFALSGFSRSNGVLNAGYFCFQ 123 Query: 176 TMHQAYDALFLKKRHFLAMWILVCGSV 202 TMHQAYDA+FL+KR FLA+ +V G++ Sbjct: 124 TMHQAYDAVFLRKRPFLALQAVVGGAL 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs29417 (233 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs100001 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs119106187 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48389300 60 2e-11 >48389300 Length = 170 Score = 60.1 bits (144), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 42/122 (34%), Positives = 62/122 (50%), Gaps = 18/122 (14%) Query: 15 KVISSSNTERTMSDGDLEESGWTMYFDDFFNQQN------------TENXXXXXXXXXXX 62 K ++S T + ++ EESGWT YF+DF N N ++ Sbjct: 11 KAVTSKETTYSCTE---EESGWTAYFEDFSNNNNKRKEEEEKQGGGAQSFGYTSSLVSDA 67 Query: 63 XXDAAFSAANYNKVAGNEQAMGFSQEKRCDRFSFKKKKTKVVAGVDDDLEDTASSPSHSP 122 AA+ A++N + NE ++G + SFKK +TK ++G DDLEDTASSP +SP Sbjct: 68 ASGAAWKLASHNNQS-NEGSIGVPPNNFPRKLSFKKTRTKKISG--DDLEDTASSPVNSP 124 Query: 123 KV 124 K+ Sbjct: 125 KI 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs16821 (83 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85520 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84309 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27169 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21748 83 4e-18 >Contig21748 Length = 172 Score = 82.8 bits (203), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 38/67 (56%), Positives = 49/67 (73%), Gaps = 1/67 (1%) Query: 1 MHPIYRLLDPHFRYTMEINGLARQALVNADGIIESSFSPGKYSMEFSSVAYDKQWRFDHE 60 +HPI++LL PHFR M +N LARQ L+NA GI+E++ P K+SME+SS Y K W F + Sbjct: 107 LHPIHKLLHPHFRDNMNVNALARQVLINAGGILEATLFPAKFSMEWSSAMY-KNWVFPEQ 165 Query: 61 ALPKDLI 67 ALP DLI Sbjct: 166 ALPVDLI 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43484 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs99447 (171 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40532 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92894 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26557 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56622 (79 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs5901 (407 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24831 231 2e-62 >Contig24831 Length = 317 Score = 231 bits (588), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 112/276 (40%), Positives = 167/276 (60%), Gaps = 6/276 (2%) Query: 41 TRSLCSHLIRPNGYPCTEHTVQTKDGYLLALQRVSSRNGNLRVQC-----GPPVLLVHGL 95 T +C+ + GYPC E V T+DGY+L+LQR+ G+ PPVL+ HG+ Sbjct: 42 TVGICASSVVVYGYPCQEFEVTTQDGYILSLQRIPEGRGSGSSGGGGGIKKPPVLIQHGV 101 Query: 96 FMGGDAWFLDSTEESLGFILADHGFDVWVANVRGTHWSHGHVTLSEKSKGFWDWSWQDLA 155 + G W L+S + +L ILAD+GFDVW+AN RGT +S H ++ FW+WSW +L Sbjct: 102 LVDGVTWLLNSPDRNLPLILADNGFDVWIANTRGTRFSRQHTSMDPDDPKFWNWSWDELV 161 Query: 156 LYDLAEMICFINLKTSSKIFLVGHSQGTIVSLAALTQPDVVEMVEAAALLSPISYLDHIT 215 +DL + F+ K KI VGHSQGT++ LA+L++ +V+ +++AALLSPI+YL H+ Sbjct: 162 AFDLPAVFDFVYGKAGQKINYVGHSQGTLIVLASLSEGKLVDQMKSAALLSPIAYLSHMK 221 Query: 216 APLVRRMVSMHLDQMVLALGIHQLNFRSNVLIDLIDSLCD-GHLDCNDLLTAITGKNCCF 274 L + ++ G+ + N + + +D+LC +DC DLL A+TGKNCC Sbjct: 222 TALGVAAAKTFVGEITTLFGLAEFNPKGDPETQYLDALCAYPGVDCYDLLQAVTGKNCCL 281 Query: 275 NNSRVDFYLENEPHPSSAKNIHHLFQMIRQGTFSQY 310 N+S +D +LENEP +S KN+ HL Q +R G ++Y Sbjct: 282 NSSTIDLFLENEPQSTSTKNMVHLAQTVRGGKLAKY 317 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22934 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48486536 64 2e-12 >48486536 Length = 83 Score = 63.5 bits (153), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/43 (76%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Query: 38 LLAEGRFYSDLELTEKEIECMVMEVSRAEYLAGDNLKQQLGHK 80 LLAEGRFYSDLELTEKEIE MVME SR EY G KQQLG + Sbjct: 1 LLAEGRFYSDLELTEKEIERMVMEASRLEYADG-TFKQQLGRR 42 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41942 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96276 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64324 (310 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30395 286 4e-79 >Contig30395 Length = 274 Score = 286 bits (731), Expect = 4e-79, Method: Compositional matrix adjust. Identities = 134/262 (51%), Positives = 191/262 (72%), Gaps = 10/262 (3%) Query: 46 LMEKVKQLVNSHYEEYLKGGFYDSELVKSLEKENKNNIRDVDWESTFFIWHRPSSNINEI 105 L++ V ++ HY++ ++ F + K L+ + ++ I D+DWESTFF+ H PSSNI+EI Sbjct: 5 LLDTVDKMTKDHYKKTMEQRFKEMVAAKGLD-DVQSEIHDLDWESTFFLRHLPSSNISEI 63 Query: 106 RNLSEDFRNTMEDYIAQLIKLAEKLSELMCENLGLEKSYIKNAFSGEKGPSVGTKVAKYP 165 +L E++R TM+++ +L KLAEKL +L+CENLGLEK Y+K F G KGP+ GTKV+ YP Sbjct: 64 PDLEEEYRKTMKEFAVELEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYP 123 Query: 166 QCPYPELVRGLREHTDAGGIILLLQDDQVPGLEFFKDGEWVKIPPSRNNTIFVNTGDQVE 225 CP P+L++GLR H+DAGGIILL QDD+V GL+ KDGEWV +PP +++I +N GDQ+E Sbjct: 124 PCPKPDLIKGLRAHSDAGGIILLFQDDKVSGLQLLKDGEWVDVPP-MHHSIVINLGDQIE 182 Query: 226 VLSNGRYQSALHRVMPEKNGSRLSIATFYNPANDAIISPAIKLL------YPSY--YSFQ 277 V++NG+Y+S +HRV+ + +G+R+SIA+FYNP ND+ ISPA +L P+Y + F Sbjct: 183 VITNGKYKSVMHRVIAQSDGTRMSIASFYNPGNDSFISPAPAVLEKKTEDAPTYPKFVFD 242 Query: 278 DYLKLYGTTKFSDKVPRLESMK 299 DY+KLY KF K PR E+MK Sbjct: 243 DYMKLYSGLKFQAKEPRFEAMK 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs76227 (409 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42987 (124 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs132106182 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7236 95 6e-22 >Contig7236 Length = 346 Score = 95.1 bits (235), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 60/132 (45%), Positives = 80/132 (60%), Gaps = 16/132 (12%) Query: 7 KPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPRRSL 66 KPPLL RM DC+ F+SAL +F+ R+VY+NV YDH+VGW+TS IRR +EL K Sbjct: 231 KPPLLKRMIEDCDGCYFMSALRSFKRRVVYSNVGYDHIVGWKTSCIRRNSELPKWENTVD 290 Query: 67 DGYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMIRGLQRL 126 + Y H+V E+C KA +A Q EP A +EEE+++GL RL Sbjct: 291 EKYPHIVYEEHC---------------KAYDAEQCEP-ASAEDGGSGELEEELLKGLSRL 334 Query: 127 GWKKVDVSFHSA 138 W+K+DVSFHS+ Sbjct: 335 SWEKIDVSFHSS 346 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23947 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60695 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs8368 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9420 134 4e-34 >Contig9420 Length = 377 Score = 134 bits (338), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 66/125 (52%), Positives = 88/125 (70%) Query: 1 MTATIAIFFGLLFWDKGQKSSRQQDLQNLLGAMYSVCLFLGTTNAVSAIPVICVERTVYY 60 MT I + FG++FW KG K +QQDL NLLGA YS LFLG +NA + V+ VERTV+Y Sbjct: 127 MTICIGVLFGVIFWGKGDKIHKQQDLINLLGATYSAILFLGASNASAVQSVVAVERTVFY 186 Query: 61 RERAAGMFSALSYALGQVAVEIIYVTAQTVMYVLILYSMIGFKWELGKFFLFFYFMWASF 120 RERAAGM+S L YA QVA+E IYV QT +Y +L+ MIG+ +++ KF F+YF++ F Sbjct: 187 RERAAGMYSELPYAFAQVAIETIYVAIQTFVYSCLLFFMIGYNFKVEKFLYFYYFIFMCF 246 Query: 121 VIFTL 125 F++ Sbjct: 247 TYFSM 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs35513 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75740 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27289 (413 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9875 71 4e-14 >Contig9875 Length = 275 Score = 70.9 bits (172), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 51/181 (28%), Positives = 88/181 (48%), Gaps = 16/181 (8%) Query: 84 LWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQTF 143 L++G+L + +D L F G V V+VI +K TG+ G+GF+ + AE + Sbjct: 90 LFVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGFVTMSNVQEAESAARQL 149 Query: 144 NGTPMPNGEQNFRLNW---------ASFGAGEKRDDT----PDHTIFVGDLAADVTDYML 190 NG + + R+N+ +SF ++ ++VG+LA V + L Sbjct: 150 NGYELDG--RALRVNYGPPPPRTEDSSFRGARGPRGGGGYDSNNRLYVGNLAWGVDNLAL 207 Query: 191 QETFRARYPSTKGAKVVIDRLTGRTKGYGFVRFGDESEQLRAMTEMNGVFCSTRPMRIGP 250 + F + + AKVV DR +GR++G+GFV + E A+ ++GV + R +R+ Sbjct: 208 ENLFSEQGKVLE-AKVVFDRDSGRSRGFGFVTYDTADEMNSAIESLDGVDLNGRSIRVSA 266 Query: 251 A 251 A Sbjct: 267 A 267 Score = 61.2 bits (147), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 50/192 (26%), Positives = 86/192 (44%), Gaps = 22/192 (11%) Query: 171 TPDHTIFVGDLAADVTDYMLQETFRARYPSTKGAKVVIDRLTGRTKGYGFVRFGDESEQL 230 +P+ +FVG+L V L F + + + +V+ D+ TGR++G+GFV + E Sbjct: 85 SPEPKLFVGNLPFSVDSAQLAGIFESA-GNVEMVEVIYDKTTGRSRGFGFVTMSNVQEAE 143 Query: 231 RAMTEMNGVFCSTRPMRIG-----PATNKKTVSGQQQYPKASYQNSQVAQSDDDPNNTTV 285 A ++NG R +R+ P T + G + +S N + Sbjct: 144 SAARQLNGYELDGRALRVNYGPPPPRTEDSSFRGARGPRGGGGYDS----------NNRL 193 Query: 286 FVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRC------GFVQFADRSCAEEALRMLN 339 +VGNL V + L LFS+ G+++ K+ + GFV + A+ L+ Sbjct: 194 YVGNLAWGVDNLALENLFSEQGKVLEAKVVFDRDSGRSRGFGFVTYDTADEMNSAIESLD 253 Query: 340 GTQLGGQNIRLS 351 G L G++IR+S Sbjct: 254 GVDLNGRSIRVS 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11086 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226744329 169 2e-44 >226744329 Length = 119 Score = 169 bits (428), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 82/114 (71%), Positives = 96/114 (84%), Gaps = 1/114 (0%) Query: 5 QILTCVSFFVLFPVIHCWGNDGHVAVCRIAQSRLSEAAADAVKQLLPESADNDLGSVCTW 64 QI+ + +L PVIH WGNDGHV +CRIAQSRLS+AAADAVKQLLP+ A+ND S+C W Sbjct: 7 QIVIALCLLLLLPVIHGWGNDGHVTICRIAQSRLSKAAADAVKQLLPDYAENDWSSLCIW 66 Query: 65 ADHVKFHYHWSSALHFIDTPDNLCTYQYNRDCKDEDGVKGRCVAGAINNYTTQL 118 AD VKF + WSSALH+I+TP+ +C YQY+RDCKDEDG KGRCVAGAINNYTTQL Sbjct: 67 ADRVKFIFPWSSALHYINTPE-VCNYQYSRDCKDEDGEKGRCVAGAINNYTTQL 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91001 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91046348 83 2e-18 >91046348 Length = 220 Score = 83.2 bits (204), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 10/104 (9%) Query: 1 MAYPS-VNALAHGFAAWDDASMLVN--AEKMMPSQDKYTNLHAIEADDXXXXXXXXXXXX 57 +AYPS +NA+A ++ WD+ S+L N +++++ S +++TNLH EAD Sbjct: 124 IAYPSSMNAIASTYSPWDETSILTNPASDQILLSHEEFTNLHGTEADIGSKGLSRINTCS 183 Query: 58 TVGGIGSSTRTQPSTDMPKQGNQVPVLHGIPDFAEVYSFIGSVF 101 G + PS+++P QG Q P HG+PDFAEVYSFIGSVF Sbjct: 184 LSGPL-------PSSEIPNQGKQAPGHHGLPDFAEVYSFIGSVF 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55446 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41128 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs43783 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5398 306 1e-85 >Contig5398 Length = 180 Score = 306 bits (784), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 151/177 (85%), Positives = 159/177 (89%) Query: 1 MEKGKGVMGSGRRWAVDFTDNSTTPSTRDIADPPGFSRASQDQDDSTLSRQKKDAEANWK 60 MEKGKGVMG+GRRWAVD TDNST+PS+RD DPPGFSRAS +QDDST+SRQKKDAE+ WK Sbjct: 1 MEKGKGVMGAGRRWAVDLTDNSTSPSSRDFPDPPGFSRASLEQDDSTVSRQKKDAESTWK 60 Query: 61 SQKAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKD 120 +QKAWEVAQAP KNL AGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKD Sbjct: 61 AQKAWEVAQAPVKNLMMMGFMMWMAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKD 120 Query: 121 SKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGI 177 KVDL+ PKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPA EVEYSGGGI Sbjct: 121 GKVDLIAPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPAQEVEYSGGGI 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72898 (395 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67121 (60 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51284 (74 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs68684 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55601 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs4584 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs95282 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2665 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6097 (324 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs106124 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33029 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9219 (272 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59938 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64410 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226748637 226 1e-61 >226748637 Length = 132 Score = 226 bits (577), Expect = 1e-61, Method: Compositional matrix adjust. Identities = 114/139 (82%), Positives = 120/139 (86%), Gaps = 8/139 (5%) Query: 1 MEGWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA 60 MEGWDPNTKSTLTQIPLL+TKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA Sbjct: 1 MEGWDPNTKSTLTQIPLLTTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA 60 Query: 61 ANPEGTRWTGKCRYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICL 120 ANPEGTRWTGKC YV+NLLKYEFDLQFDIP+TYPATAPELELPQLDGKTQK+ G + L Sbjct: 61 ANPEGTRWTGKCWYVYNLLKYEFDLQFDIPITYPATAPELELPQLDGKTQKV--GLILIL 118 Query: 121 TVHFKPLWAKNWYFCFTFV 139 P +FCF V Sbjct: 119 RFSLFP------HFCFLIV 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs57459 (207 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65961 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 124 8e-31 >Contig2543 Length = 199 Score = 124 bits (312), Expect = 8e-31, Method: Compositional matrix adjust. Identities = 69/168 (41%), Positives = 97/168 (57%), Gaps = 4/168 (2%) Query: 16 KLLMIGDSGVGKSSLLLSFTSDNFEELS-PTIGVDFKVKYVDVGGKKLKLAIWDTAGQER 74 KL+++GD G GK+SL+L F + F E TIG F + + + +K IWDTAGQER Sbjct: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 Query: 75 FRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKES 134 + +L YYRGA ++VYD+T D+F + W E+ N I L GNK D E Sbjct: 72 YHSLAPMYYRGAAAAVVVYDITSMDSFLR-AKKWVLEVQ-RQANPTLIMFLAGNKADLED 129 Query: 135 ERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILD-TPS 181 +R V +EG +A+E G +F+E SAKT NV + F E+ K+ +PS Sbjct: 130 KRKVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKLAKASPS 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67549 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22855 184 7e-49 >Contig22855 Length = 237 Score = 184 bits (467), Expect = 7e-49, Method: Compositional matrix adjust. Identities = 102/152 (67%), Positives = 116/152 (76%), Gaps = 4/152 (2%) Query: 1 MARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRG 60 MARSYLP KVSEIVAIWRKDL KVNPKAAESLADPEEY NLFDDWQVAL+VESKAA TRG Sbjct: 80 MARSYLPGKVSEIVAIWRKDLSKVNPKAAESLADPEEYPNLFDDWQVALSVESKAAETRG 139 Query: 61 VHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAH----XXXXXXXXXXXXXXX 116 V+PPAE+YVNH DK+++TLVEAFR+MQ+EEE+ LENG+ +H Sbjct: 140 VYPPAEEYVNHVDKAHITLVEAFRNMQLEEEEPLENGEASHEVPEQNGEENGAQAAEEQD 199 Query: 117 XXXXXXXXPVVVDADSTDGAVLVNGNEAEEQW 148 VVVDADSTDGA L+NGNEA+E+W Sbjct: 200 GEEGSQEEAVVVDADSTDGAELINGNEADEEW 231 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64674 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89891 (139 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25539 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs26707 (280 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32643 64 2e-12 >Contig32643 Length = 72 Score = 64.3 bits (155), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 27/38 (71%), Positives = 32/38 (84%) Query: 91 EAQNRVVKGRKPYLHESRHAHAMNRARGSGGRFLNTKK 128 E++N+ +K RKPYLHESRH HA+ RARG GGRFLN KK Sbjct: 1 ESENKALKNRKPYLHESRHQHALRRARGCGGRFLNAKK 38 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60257 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80488 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs64873 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226801430 86 5e-19 >226801430 Length = 222 Score = 85.5 bits (210), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 45/110 (40%), Positives = 63/110 (57%), Gaps = 8/110 (7%) Query: 13 KMGQTIIFVRTKNSASALHKALKDFGYEVTTIMGATIQEERDKIVKEFKDGLTQVLISTD 72 K T++FV TK A +L L G+ TTI G Q+ER++ ++ FK G T +L++TD Sbjct: 72 KQALTLVFVETKKGADSLEHWLCMNGFPATTIHGDRSQQEREQALRSFKSGNTPILVATD 131 Query: 73 VLARGFDQQQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVV 122 V ARG D V +VN+D P D + Y+HRIGR GR G+ G+ Sbjct: 132 VAARGLDIPHVAHVVNFDLP--------NDIDDYVHRIGRTGRAGKSGLA 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs80386 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17701 119 7e-29 >Contig17701 Length = 168 Score = 119 bits (297), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 55/79 (69%), Positives = 61/79 (77%), Gaps = 1/79 (1%) Query: 91 PRCQVEGCKVDLSDAKAYYSRHKVCGMHSKSPVVTVAGLEQRFCQQCSRFH-LPEFDQGK 149 P CQV+ C DLSD K YY RHKVC +H+K+P + V G QRFCQQCSRFH L EFD K Sbjct: 80 PCCQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRFCQQCSRFHSLSEFDDSK 139 Query: 150 RSCRRRLAGHNERRRKPTS 168 RSCRRRLAGHNERRRK +S Sbjct: 140 RSCRRRLAGHNERRRKTSS 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61049 (292 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40321 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29054 64 2e-12 >Contig29054 Length = 359 Score = 63.9 bits (154), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 44/119 (36%), Positives = 62/119 (52%), Gaps = 8/119 (6%) Query: 45 AQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDG 104 A +GDV L+ AL + + +E E R TALH C YG + C Q LLE GA ++A D++ Sbjct: 243 ASVGDVEGLKAALASGADKDEEDSEGR-TALHFACGYGEVKCAQALLEAGARVDALDKNK 301 Query: 105 AIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLL 163 LH A G E V LL+ + + L+ +D G TP+ A DV++LL Sbjct: 302 NTALHYAAGYGRKECVALLLENGAAV-----TLQNMD--GKTPIDVAKLNNQNDVLKLL 353 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2551 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63985 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs73170 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102369 (56 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88495 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs90040 (59 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs53206 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59910 (135 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226766586 183 8e-49 >226766586 Length = 181 Score = 183 bits (465), Expect = 8e-49, Method: Compositional matrix adjust. Identities = 85/109 (77%), Positives = 98/109 (89%) Query: 27 INGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTI 86 ++ VYDVTKFLEDHPGGD+VL+SATGKDATDDFEDVGHS +AR+M+ +YVGEID STI Sbjct: 73 LSSMVYDVTKFLEDHPGGDDVLVSATGKDATDDFEDVGHSDNARDMLKDFYVGEIDASTI 132 Query: 87 PKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS 135 PK YTPPKQPHYNQDKTSEFI++LLQFLVP+AILGLA G+ +YTKSS Sbjct: 133 PKSTTYTPPKQPHYNQDKTSEFIVKLLQFLVPIAILGLAFGVHLYTKSS 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42822 (333 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8275 310 3e-86 >Contig8275 Length = 380 Score = 310 bits (793), Expect = 3e-86, Method: Compositional matrix adjust. Identities = 166/371 (44%), Positives = 218/371 (58%), Gaps = 49/371 (13%) Query: 10 VITCKAAVAWGAGQXXXXXXXXXXXXXXXXIRIKVVCTSLCRSDITAWETQA---IFPRI 66 VI C AAVAW AG+ +R+K+ TSLC +D+ WE + +FPRI Sbjct: 8 VIPCTAAVAWEAGKPLVMERVEVAPPQAMEVRVKIKYTSLCHTDLYFWEAKGQTPLFPRI 67 Query: 67 FGHEASGIVESVGPGVTEFNEGEHVLTVFIGECKTCRQCKSDKSNTCEVLGLER-RGVMH 125 FGHEASGIVESVG GV G+HVL VF GEC C CKS++SN C++L + RGVM Sbjct: 68 FGHEASGIVESVGEGVEGLEVGDHVLPVFTGECGDCAHCKSEESNMCDLLRINTDRGVML 127 Query: 126 SDQQTRFSIKG---------------------------------------------LGAA 140 SD++ RFSI G LGA Sbjct: 128 SDEKPRFSINGTPINHFVGTSTFSEYTVIHSGCLAKINPLAPLDIVCILSCGITTGLGAT 187 Query: 141 WNVADISKGSTVVIFGLGTVGLSVAQGAKARGASRIIGVDTNPEKCEKAKAFGVTEFLNP 200 NVA KGS+V IFGLG VGL+ A+GA+ GASRIIGVD NP++ E+AK FGV EF+NP Sbjct: 188 LNVAKPKKGSSVAIFGLGAVGLAAAEGARISGASRIIGVDRNPKRFEEAKKFGVNEFVNP 247 Query: 201 NDNNEPVQQVIKRITDGGADYSFECIGDTGMITTALQSCCDGWGLAVTLGVPKLKPEVAA 260 D+++PVQ+VI +T+GGAD S EC G+ + +A + DGWG+AV +GVP Sbjct: 248 KDHDKPVQEVIAEMTNGGADRSIECTGNINAMISAFECVHDGWGVAVLVGVPNKDAVFMT 307 Query: 261 HYGLFLSGRTLKGSLFGGWKPKTDLPSLVNRYLKKEFMVDEFITHNLLFEDINQAFNLMK 320 L+ RTLKG+ FG +KP+TDLPS+V Y+ K+ V++FITH + F +IN+AF+ M Sbjct: 308 KPINLLNERTLKGTFFGNYKPRTDLPSVVEMYMSKKLEVEKFITHRVPFSEINKAFDYMI 367 Query: 321 EGKCLRSVIHM 331 G+ LR ++ M Sbjct: 368 RGEGLRCIVSM 378 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9226 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6233 230 1e-62 >Contig6233 Length = 164 Score = 230 bits (587), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 129/164 (78%), Positives = 143/164 (87%), Gaps = 4/164 (2%) Query: 58 MCWWAFTGLTHIILEGYFAFSPEFYKDKSGFYLAEVWKEYSKGDSRYAARDAGVVAVEGI 117 M WWAFTGLT +ILEGYFA +PEFYKDK+ +Y AEVWKEYSKGDSRYAARDAGVVAVEG+ Sbjct: 1 MRWWAFTGLTDLILEGYFAIAPEFYKDKTAWYPAEVWKEYSKGDSRYAARDAGVVAVEGL 60 Query: 118 TAVLEGPASLLSVYAIATGKSYSYILQFAISLGQLYGTAVYFMTSYLEGDNFAASPYYYN 177 TAV+EGPASLL+VYAI+ GKSYSYILQFAISLGQLYGTAVYF+T+YL+GD FA S +YY Sbjct: 61 TAVIEGPASLLAVYAISKGKSYSYILQFAISLGQLYGTAVYFITAYLDGDQFATSSFYYY 120 Query: 178 LYYIGANASWVVIPSLIAIRCWKKIC----AAPQLQGQKKNKVR 217 YYI ANASWVVIP+LI+IRCWKKI A Q QGQKKNK R Sbjct: 121 AYYIAANASWVVIPTLISIRCWKKISAAVQAQGQGQGQKKNKTR 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48454 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8651 136 4e-34 >Contig8651 Length = 243 Score = 136 bits (342), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 67/151 (44%), Positives = 108/151 (71%), Gaps = 1/151 (0%) Query: 1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTD 60 +GRG++++KRIEN NRQVTF KRR+GLLKKA+E+SVLCDAEVALIVFS +G+L+EY+ + Sbjct: 17 LGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYANN 76 Query: 61 SCMERILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQKHFMGEDLADL 120 S ++ +ERY++ + + E +KL+A++ LQ + ++ MG+ L+ + Sbjct: 77 S-VKGTIERYKKASADSSNTGSVSEASTQYYQQEAAKLRAQIVKLQNDNRNMMGDALSSM 135 Query: 121 SLKELQSVEQQIDSGLKLIRSRKNQLMLQSI 151 S+K+L+S+E +++ + IRS+KN+L+ I Sbjct: 136 SVKDLKSLENKLEKAISRIRSKKNELLFAEI 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6589 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105359 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74879 (127 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83508 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79201 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67260 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60106184 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9656 144 1e-36 >Contig9656 Length = 171 Score = 144 bits (362), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 68/85 (80%), Positives = 76/85 (89%) Query: 1 MASGDVEFRCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEK 60 MAS ++EFRCFVGGLAWAT + +L AF YG+I+ESKIINDRETGRSRGFGFVTF E+ Sbjct: 1 MASAEIEFRCFVGGLAWATDNEALERAFSQYGEIIESKIINDRETGRSRGFGFVTFGSEQ 60 Query: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 +MRDAIEGMNGQNLDGRNITVNEAQ Sbjct: 61 AMRDAIEGMNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36042 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6580 107 2e-25 >Contig6580 Length = 269 Score = 107 bits (266), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 69/172 (40%), Positives = 86/172 (50%), Gaps = 35/172 (20%) Query: 3 ELPPGYRFFPTEEELVSFYLINKLE--------------------ELCGEKCQGDTEQWF 42 +LPPG+RF PT+EELV YL K EL + G+ E W+ Sbjct: 14 QLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQE-WY 72 Query: 43 FFTPRQXXXXXXXXPSRTTASGYWKATGSPSYVYSS-DNRVIGVKKTMVFYKGKAPTGRK 101 FF+PR P+R SGYWKATG+ V SS N +GVKK +VFY GK P G K Sbjct: 73 FFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPPKGTK 132 Query: 102 TKWKMHEYRAIEGASN----------PSRAVI--PKLR-HEFSLCRIYVKSE 140 T W MHEYR + + PS A P LR ++ LCRIY K++ Sbjct: 133 TNWIMHEYRLVNNTTTTINMSSSTTKPSDAANKKPSLRLDDWVLCRIYKKNK 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs2411 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56910 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38492 (284 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60524 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7608 (268 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs23153 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs27421 (478 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs22061 (228 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs12987 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25482 298 3e-83 >Contig25482 Length = 263 Score = 298 bits (764), Expect = 3e-83, Method: Compositional matrix adjust. Identities = 144/204 (70%), Positives = 160/204 (78%) Query: 1 MPLTGVVFQPFEEVKKEXXXXXXXXXXXXARQKYEDECEAAINEQINVEYNVSYVYHALY 60 + LTGVVFQPFEEVK + ARQ+Y DE EAAINEQINVEYNVSYVYHAL+ Sbjct: 59 VALTGVVFQPFEEVKNDAFVVPVSPQVSLARQRYTDESEAAINEQINVEYNVSYVYHALF 118 Query: 61 AYFDRDNIALRGLXXXXXXXXXXXXXXXXXXMEYQNLRGGKVKLHSIMQPPSEFDHAEKG 120 AYFDRDN+AL+GL MEYQN RGG+VKLHS++ P+EFDHAEKG Sbjct: 119 AYFDRDNVALKGLANFFKESSEEEREHAEKLMEYQNKRGGRVKLHSVIAAPTEFDHAEKG 178 Query: 121 DALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQVEAINKIAKYVSQ 180 DALYAMELALSLEKLTNEKLL+LH VAD+NNDPQ+ +F+ESEFL EQVEAI KIA YV+Q Sbjct: 179 DALYAMELALSLEKLTNEKLLNLHKVADQNNDPQLMDFIESEFLAEQVEAIKKIADYVTQ 238 Query: 181 LRMVGKGHGVWHFDQMLLHEGDAA 204 LR VGKGHGVWHFDQ LLHEGDAA Sbjct: 239 LRRVGKGHGVWHFDQYLLHEGDAA 262 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11106190 (174 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15287 74 2e-15 >Contig15287 Length = 147 Score = 73.6 bits (179), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 30/80 (37%), Positives = 58/80 (72%) Query: 28 QDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTIN 87 +D LP A +++I+K+ LP + ++A+DA++ + EC EFI+ I+SE+++ C RE+++TI Sbjct: 12 EDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCSREEKRTIA 71 Query: 88 GDDLLWAMATLGFEDYIDPL 107 + +L A+ LGF +Y++ + Sbjct: 72 PEHVLKALQVLGFSEYVEEV 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs167106186 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs9195 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27492 331 5e-93 >Contig27492 Length = 202 Score = 331 bits (849), Expect = 5e-93, Method: Compositional matrix adjust. Identities = 154/200 (77%), Positives = 175/200 (87%) Query: 6 NDKPLTKISESFKELAATVNSQAADVELAAFSRACSYVSPLFGCLGIAFKFAEMDYVTKV 65 +++PL KI+E+FKEL A VNS AADVE+A FS ACS VSPLFGCLGIAFKFAEMDYV KV Sbjct: 3 DERPLRKIAEAFKELEAAVNSPAADVEVAPFSHACSLVSPLFGCLGIAFKFAEMDYVAKV 62 Query: 66 DDLAEASKSILTLQSVIDRDIEGNCVRKAGSHTRNLLRVKRGLDMVRVLFEQILAAEGNS 125 DL+EAS SI TLQ ++DRDIE +CVRKAGSH+RNLLRVKRG+DMVRVLFEQI+ +GNS Sbjct: 63 HDLSEASDSISTLQVLLDRDIEADCVRKAGSHSRNLLRVKRGIDMVRVLFEQIIVTKGNS 122 Query: 126 LKDPASKAYTQVFAPHHGWAIRKAVAAGMYALPTRAQLLRKLNEDETSARIQMQDYITTS 185 LKDPASKAY QVFAPHHGW IRKAVAAGMYALPTR QL+ KLNED+ SA++QMQ YI S Sbjct: 123 LKDPASKAYAQVFAPHHGWVIRKAVAAGMYALPTREQLMNKLNEDDNSAKVQMQSYIAAS 182 Query: 186 APVILYIDKLFLSRELGIDW 205 AP+ LYIDKLF SR+LG+DW Sbjct: 183 APLSLYIDKLFHSRKLGVDW 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs45048 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33047 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14885 363 e-102 >Contig14885 Length = 269 Score = 363 bits (933), Expect = e-102, Method: Compositional matrix adjust. Identities = 171/239 (71%), Positives = 187/239 (78%), Gaps = 1/239 (0%) Query: 16 QLKAIGIK-EVVDDAVGEQREFDYFNFALQWPGTQCQHTRHCCPSNGCCRGSNAPTEFTI 74 + K +GI E+ G QREFDYFN ALQWPGT CQ TR+CC SN CCRGSN PT FTI Sbjct: 20 EAKQVGIGVEIGSRGGGGQREFDYFNLALQWPGTFCQRTRYCCSSNACCRGSNGPTVFTI 79 Query: 75 HGLWPDYNDGTWPSCCKKSKFDEKEISTLLDTLEKYWPSYRCGSTSTCYSGEGLFWAHEW 134 HGLWPDYNDGTWP+CC + FDEKEISTL D LEKYWPS CG S+C G+G FW HEW Sbjct: 80 HGLWPDYNDGTWPACCTQKTFDEKEISTLHDALEKYWPSLSCGKPSSCRGGKGSFWGHEW 139 Query: 135 EKHGTCSFPVFRDEYSYFLTTLNLYFKYNVTRVLNEAGYLPSNTEKYPLRGIVSAIQNAF 194 EKHGTCS PV DEY+YFLTTLN+YFKYNVT++LNEAGY+PSNTEKYPL GIVSAIQN F Sbjct: 140 EKHGTCSSPVVGDEYNYFLTTLNVYFKYNVTQILNEAGYVPSNTEKYPLGGIVSAIQNVF 199 Query: 195 HATPKLDCSKDAVNELHLCFYKDFKPRDCIIERSPENDKYXLSSSCPKYVSLPVYTSSG 253 ATPKL C K AV ELHLCFYKDFKPRDC++ NDK SSSCP YVS+P Y S G Sbjct: 200 RATPKLVCKKGAVEELHLCFYKDFKPRDCLVGSGNLNDKLASSSSCPNYVSIPAYASLG 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs61068 (233 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs105406 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21775 124 8e-31 >Contig21775 Length = 551 Score = 124 bits (311), Expect = 8e-31, Method: Compositional matrix adjust. Identities = 69/142 (48%), Positives = 91/142 (64%) Query: 3 LMDKLGRKALLQWSFFSMAVSMAIQVAASSSYIPGSASLYLSVGGMLMFVLTFALGAGPV 62 LMDK GRK+LL SF MA SM + + + S LSV G +++VL+F+LGAGPV Sbjct: 406 LMDKQGRKSLLLTSFGGMAASMLLLSLSFTWKALAPYSAPLSVAGTVLYVLSFSLGAGPV 465 Query: 63 PSLLLPEIFPSRIRAKAMAVCMSVHWVINFFVGXXXXXXXXXXXXXXXYSIFGTFCLMAV 122 P+LLLPEIF SRIRAKA+++ + +HW+ NF +G Y F CL+AV Sbjct: 466 PALLLPEIFASRIRAKAVSLSLGMHWISNFVIGLYFLSLVTKFGIGTVYFGFAGVCLLAV 525 Query: 123 AFVKRNVVETKGKSLQEIEIAL 144 ++ NVVETKG+SL+EIE AL Sbjct: 526 LYIAGNVVETKGRSLEEIERAL 547 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44142 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226750975 121 6e-30 >226750975 Length = 217 Score = 121 bits (304), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 57/104 (54%), Positives = 74/104 (71%) Query: 1 MISARDLLIIWSSTSAYWRWISIPEARFPEVAELIRVCWLEIRGKISTRSLSPGTLYTAY 60 MI+AR L I+W+ T YW+WISIP++RF EVAEL+ VCWLEI G+I TR LSP TLY AY Sbjct: 111 MIAARALSIVWADTPQYWKWISIPDSRFEEVAELVDVCWLEIHGRIETRMLSPSTLYKAY 170 Query: 61 LVYKLTAGSYGFEYQPVSVSVGLVNGETQTQTVYLHEERGLRQG 104 LV+K TA +YGFE++ V+V L+ + Q V+L R +G Sbjct: 171 LVFKTTAQAYGFEHRAAEVTVCLIGEQRTNQNVFLGARRVQTRG 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34035 (460 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24201 156 5e-40 >Contig24201 Length = 434 Score = 156 bits (395), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 91/173 (52%), Positives = 106/173 (61%), Gaps = 5/173 (2%) Query: 205 SLEKARHQKHLKQGPPEVKEG-THSSSSP-EGDTKPQRTGVLPAYGFSFKCDERAQKRKE 262 S+EKA+ K LK+G EG + SS SP EGD P R G LP YGFSF+CDERA+KR+E Sbjct: 184 SVEKAK-LKPLKKGSQNQAEGESQSSLSPTEGDKHP-RVGTLPNYGFSFRCDERAEKRRE 241 Query: 263 FYAKLEEKIHAREVEKTTIQAKTQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELK 322 FY KLEEKIHA+E+EK +QAK++E EAEI+M RK L FKATPMPSFY EP PPKVELK Sbjct: 242 FYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELK 301 Query: 323 KTPPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDVKLTQNRVAKGSSP 375 K P T LD K+ QN +KG SP Sbjct: 302 KIPTTRAKSPKLGRRNSLPPAVSEAKGNTNGQSSRLSLDQKVPQN-TSKGPSP 353 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50758 (335 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25555 427 e-122 >Contig25555 Length = 267 Score = 427 bits (1099), Expect = e-122, Method: Compositional matrix adjust. Identities = 207/267 (77%), Positives = 233/267 (87%), Gaps = 6/267 (2%) Query: 1 MAS-SPSHQTHIPLSSDPDGKPIDS-----VVPIHIVTNASQLPAEFLEPSSERQLVIGF 54 MAS P ++H+ LS DP KP++ + PIHIVT+ASQLPAEFLEPS+ER L+IGF Sbjct: 1 MASLPPPLESHLRLSPDPGEKPLNHETQLPMAPIHIVTHASQLPAEFLEPSAERPLIIGF 60 Query: 55 DCEGVDLCRHGSLCIMQLAFPDAIYLVDAIQGGETVVKACKPALESSYITKVIHDCKRDS 114 DCEGVDLCRHG+LCIMQLAFP+AIYLVDAIQGG ++ ACKPALES YITKVIHDCKRDS Sbjct: 61 DCEGVDLCRHGTLCIMQLAFPNAIYLVDAIQGGVMLINACKPALESPYITKVIHDCKRDS 120 Query: 115 EALYFQFGIKLHNVVDTQIAYSLIEEQEGRKRSPDDYISFVGLLADPRYCGISYQEKEEV 174 EALYFQFGIKL+NVVDTQIAYSLIEEQEG+KR DYISFVGLLADPRYCGISY EKEEV Sbjct: 121 EALYFQFGIKLNNVVDTQIAYSLIEEQEGQKRVLVDYISFVGLLADPRYCGISYLEKEEV 180 Query: 175 RVLLRQDPQFWTYRPLTELMVRAAADDVRFLPYIYHNMMKKLNQQSLWYLAVRGALYCRC 234 R LLRQDP FWTYRPL+E MVRAAADDVRFL +IY+ MM+KLNQQSLWYLA+RGALYCRC Sbjct: 181 RFLLRQDPNFWTYRPLSEQMVRAAADDVRFLLHIYYKMMEKLNQQSLWYLAIRGALYCRC 240 Query: 235 FCINENDYVDWPPLPPVPDYLIVEGDV 261 FCI++N++ DWP LPP+PD L VEG+ Sbjct: 241 FCISDNNFADWPSLPPIPDNLKVEGNA 267 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71808 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1132 416 e-118 >Contig1132 Length = 265 Score = 416 bits (1069), Expect = e-118, Method: Compositional matrix adjust. Identities = 212/269 (78%), Positives = 228/269 (84%), Gaps = 9/269 (3%) Query: 1 MATSTMALSSSFVGKAVNLAPSGNELSN-----GGRISMRKTGSKSVSSGSPWYGPDRVK 55 MATS + S+F G+ L S + GGR SMR+T KS S WYGPDR K Sbjct: 1 MATSAIQ-QSAFAGQTA-LKQSSELVRKIGGLGGGRFSMRRT-VKSAPQ-SIWYGPDRPK 56 Query: 56 YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPE 115 YLGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE Sbjct: 57 YLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE 116 Query: 116 LLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRI 175 +L+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG +EGYR+ Sbjct: 117 ILSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRV 176 Query: 176 AGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGK 235 GGPLGE DPLYPGG+FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTGK Sbjct: 177 GGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGK 236 Query: 236 GPLENLADHLADPVNNNAWAYATNFVPGK 264 GP+ENL DH+ADPV NNAWAYATNFVPGK Sbjct: 237 GPVENLFDHIADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs74474 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs6581 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98448 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8275 199 3e-53 >Contig8275 Length = 380 Score = 199 bits (507), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 118/287 (41%), Positives = 154/287 (53%), Gaps = 5/287 (1%) Query: 7 SPKAGKVIRCKAAICRIPGKPLXXXXXXXXXXKAWEVRIKILCTSLCHSDVTFWKSSTDL 66 S AG VI C AA+ GKPL +A EVR+KI TSLCH+D+ FW++ Sbjct: 2 SSTAGLVIPCTAAVAWEAGKPLVMERVEVAPPQAMEVRVKIKYTSLCHTDLYFWEAKGQT 61 Query: 67 PKLPLPVIFXXXXXXXXXXXXXXXXXXXXRDLVLPIFQRDCGECRDCKSSKSNTCSKFG- 125 P P IF D VLP+F +CG+C CKS +SN C Sbjct: 62 PLFPR--IFGHEASGIVESVGEGVEGLEVGDHVLPVFTGECGDCAHCKSEESNMCDLLRI 119 Query: 126 RGYRPNMPRDGTSRFRELKGDVIHHFLNISSFTEYTVVDITHVVKITPHIPLGIACLLTC 185 R M D RF + G I+HF+ S+F+EYTV+ + KI P PL I C+L+C Sbjct: 120 NTDRGVMLSDEKPRF-SINGTPINHFVGTSTFSEYTVIHSGCLAKINPLAPLDIVCILSC 178 Query: 186 GVSTGVGAAWKVAGVEVGSTVAIFXXXXXXXXXXXXXRLNRASKIIGVDINPEKFEIGKK 245 G++TG+GA VA + GS+VAIF R++ AS+IIGVD NP++FE KK Sbjct: 179 GITTGLGATLNVAKPKKGSSVAIFGLGAVGLAAAEGARISGASRIIGVDRNPKRFEEAKK 238 Query: 246 FGITDFINPATCGDKTVSQVIKEMTDGGADYCFECIGLASVMNDAFN 292 FG+ +F+NP DK V +VI EMT+GGAD EC G + M AF Sbjct: 239 FGVNEFVNPKD-HDKPVQEVIAEMTNGGADRSIECTGNINAMISAFE 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs11855 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48198 (223 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs54151 (64 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs59108 (60 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33591 (50 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs92485 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs67731 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88106183 (285 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88423 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs102311 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs103446 (343 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52432 (359 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23203 74 4e-15 >Contig23203 Length = 246 Score = 73.9 bits (180), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 69/262 (26%), Positives = 110/262 (41%), Gaps = 52/262 (19%) Query: 61 GYVVRIGITKKEGKIWFDDGWNEFVQYHSIGVGYFVVFQYRKNSKFQVFVFNTTTFEIQY 120 G+V +G+ K + K WF GW +F++++SI VGYF+ F++ S F V +FN T EI Y Sbjct: 1 GHVWHVGVKKVDNKFWFHSGWQDFIEHYSIRVGYFLTFRHEGRSSFTVHIFNLKTAEINY 60 Query: 121 PSRNMFPPSRQNQATVNSSKSKNGCKMQSKTYRMEELEVNDELD--------NVNDSIQD 172 N+ S G + + + EE+E +D ++ V DS++D Sbjct: 61 --------------QPNALSSTGGSVYRYQVF--EEMEDDDSVEILGSSPTSIVTDSLKD 104 Query: 173 ----------IIGTSNSEGSVH-----------------AKVHLSETQCLSVQETDLKID 205 G + + S+H +HLS+ L E I Sbjct: 105 KCFGDSANQLTPGKNCTPPSLHNLFNGSKPKNCVNWSDAGNLHLSKGDDLQAGEDIRSIK 164 Query: 206 STKFKKAKHNLKYELRADSVDQIKSIALLEDMDTYDCESRMTLEEKQEAINVARFLKPEK 265 T KK K N E + ++ I + +T EE++ AIN A+ +P Sbjct: 165 KTVRKKRKVNPNVEESSSQHEKEVEIRFRFYESASARKRTVTAEERERAINAAKTFEPVN 224 Query: 266 PSFLVFLRASNMQLNCV-YVPN 286 P V LR S + C+ Y+P+ Sbjct: 225 PFCRVVLRPSYLYRGCIMYLPS 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88680 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs72584 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs84053 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44556 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26624 172 4e-45 >Contig26624 Length = 209 Score = 172 bits (435), Expect = 4e-45, Method: Compositional matrix adjust. Identities = 107/199 (53%), Positives = 136/199 (68%), Gaps = 27/199 (13%) Query: 1 MSRATVELDFFGLENKE----NSSNKPQFKKFL-RQRSFRDIQGAISKINPEIIKSVIAS 55 MSRATVELDFFG++ + S+K QF+KFL R RS R I A+SKINPE+ KSVIAS Sbjct: 1 MSRATVELDFFGMDQHHREAASYSSKSQFQKFLHRPRSVRGIHTAMSKINPEVFKSVIAS 60 Query: 56 GSAKSSI-------SLPSTPKEEPITFPDVPLY-------RHIPKSGSENVSETAPLTIF 101 G+A SI S+PS+PK E + FP +PLY + + SE++ ET P+TIF Sbjct: 61 GNASPSIPNPRKSFSVPSSPKVEQVLFPCLPLYVTTAVSDSSVASATSESLQETTPMTIF 120 Query: 102 YNGTVAVFDVHREKAEHILKLAVEGNS-KSFESN---DANVA---SDQQQQLLETLNTGD 154 YNGTV+VF+V +KA+ ILKLA+EGNS K+ E+ D +A S+QQQQL++ L+ Sbjct: 121 YNGTVSVFNVPLDKADSILKLALEGNSRKAAEAALPVDPKLALHPSEQQQQLVDPLSEY- 179 Query: 155 LPIARRKSLQRFLEKRKER 173 LPI R KSLQRFLEKRKER Sbjct: 180 LPITRSKSLQRFLEKRKER 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20787 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs75266 (81 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs71525 (310 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12866 67 5e-13 >Contig12866 Length = 268 Score = 66.6 bits (161), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 5/72 (6%) Query: 13 LYVGRLASRTRSRDLEEIFSRYGRIRDVDMKR-----DFAFVEFSDPRDADDARYSLNGR 67 +YVG L R R++E++F +YG I D+D+K +AFVE+ DPRDADDA Y +G Sbjct: 9 IYVGNLPGDIRMREVEDLFLKYGPIVDIDLKIPPRPPGYAFVEYEDPRDADDAIYGRDGY 68 Query: 68 DVDGSRIIVEFA 79 D DG R+ VE A Sbjct: 69 DFDGFRLRVELA 80 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs52623 (281 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25932 (141 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41118 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs66150 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 186 4e-49 >Contig7384 Length = 326 Score = 186 bits (472), Expect = 4e-49, Method: Compositional matrix adjust. Identities = 101/255 (39%), Positives = 143/255 (56%), Gaps = 1/255 (0%) Query: 21 VAFVLEGSPSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDG 80 V +G S+ QL +FYS++CPNV + + + + I A+ +RL HDCFV+G Sbjct: 13 VMMFSQGKESEGQLVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEG 72 Query: 81 CDASILLDSTNTIDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERS 140 CDASI++ S N + FA + + GF+ + K AVE CP VVSCADIL +AA Sbjct: 73 CDASIIIASPNGDAEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAVAARDC 132 Query: 141 VALSGGPSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSG 200 V L+GGPS+ V LGRRD + + NLP P L++L + F L+ D++ALSG Sbjct: 133 VVLAGGPSFPVELGRRDGLISKASRVAGNLPEPTFNLNQLTTMFAKHNLS-LTDVIALSG 191 Query: 201 AHTFGRAQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDV 260 AHT G + C F RLY+F+ + DP+L+ + +QL CP + ++ D TP Sbjct: 192 AHTLGFSHCNRFSDRLYNFSPSSTVDPSLNPDYAKQLMATCPIAVDPNIVMTLDPDTPFT 251 Query: 261 FDNKYFSNLRGRKAF 275 FDN Y+ NL K Sbjct: 252 FDNAYYRNLVAGKGL 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs94106186 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18371 127 3e-32 >Contig18371 Length = 70 Score = 127 bits (320), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 59/70 (84%), Positives = 65/70 (92%) Query: 1 MVNAIKGLFISCDIPMAQFIINMNASMPQSQKFIIHILDSTHLFVQPNMAEMIRSAIAEF 60 MVNA+KGLFISCDIPMAQFIIN + S+P SQ+FIIH+LDSTHLFVQP+ AEMIRSAIAEF Sbjct: 1 MVNAVKGLFISCDIPMAQFIINYDNSLPASQRFIIHVLDSTHLFVQPHAAEMIRSAIAEF 60 Query: 61 RDQNSYEKPA 70 RDQNSYEKP Sbjct: 61 RDQNSYEKPT 70 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs62778 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21926 (123 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs63894 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs90106184 (303 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36106190 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26818 462 e-132 >Contig26818 Length = 281 Score = 462 bits (1189), Expect = e-132, Method: Compositional matrix adjust. Identities = 229/282 (81%), Positives = 246/282 (87%), Gaps = 4/282 (1%) Query: 1 MSKEVNEEGQTHRHHHGKDYVDPPPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVAT 60 M+K+V EG H KDY DPPP PL D EL WSFYRALIAEF+ATLLFLY++V T Sbjct: 1 MAKDV--EGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT 58 Query: 61 VIGHKKQS--DACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL 118 VIG+K QS D CGGVG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL Sbjct: 59 VIGYKSQSEADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL 118 Query: 119 IRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLV 178 IRAV Y++AQCLGAICGVGLVKAF K Y GGGAN +++GYNKG+ LGAEIIGTFVLV Sbjct: 119 IRAVLYIIAQCLGAICGVGLVKAFQKSYYMKYGGGANELSAGYNKGTGLGAEIIGTFVLV 178 Query: 179 YTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNND 238 YTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIYN D Sbjct: 179 YTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKD 238 Query: 239 KAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 280 KAWDD WIFW+GPF+GA AA YHQYILRA AIKALGSFRSN Sbjct: 239 KAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSN 280 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs91615 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50247 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs40516 (113 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs34089 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs25451 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs32845 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91014122 157 1e-40 >91014122 Length = 116 Score = 157 bits (397), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 80/118 (67%), Positives = 96/118 (81%), Gaps = 4/118 (3%) Query: 70 LQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDT 129 +QD + SGKNVLLEFYAPWCGHCKKLAPILDEVA SY+ D++VVIAKFDATAND+P D Sbjct: 1 IQDYI-KSGKNVLLEFYAPWCGHCKKLAPILDEVAASYEKDSEVVIAKFDATANDVPSD- 58 Query: 130 FEVQGYPTVFFRSASGKTVPY-EGDRTKEDIVDFIENNRDKAAPK-ETVKEESGKDEL 185 F+V+ YPT++F++ SGK + Y E DRTKE I FIE NRDK + E+ K+ESGKDEL Sbjct: 59 FDVKYYPTLYFKTGSGKVLSYDEEDRTKEAITAFIEKNRDKIEKQAESEKQESGKDEL 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50500 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs93945 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55022 (368 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs82297 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24131 82 4e-18 >Contig24131 Length = 311 Score = 82.4 bits (202), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 62/177 (35%), Positives = 91/177 (51%), Gaps = 24/177 (13%) Query: 1 QKRIIREFINSISAV---ESKRPSVAGWWKTVQLY---TDQTGANISRTVRLGQEKNDRF 54 QK I+ +FI+S+++ ++ +PSVA WW+T + Y T ++ S ++ LG++ D+ Sbjct: 75 QKAIVSDFISSLASSSPSKTPQPSVAAWWQTTEKYYHLTSNKKSSNSLSLSLGRQILDQS 134 Query: 55 YSHGKSLTRLSVQSVIKSHVTARSKPLPINPKGGLYLLLTSTDVYVQDFCGQVCGFHYFT 114 YS GKSLT + ++ + K + ++LTS DV V FC CG H Sbjct: 135 YSLGKSLTTKQIVALAAKG----------DQKNAINVVLTSADVAVDGFCMNRCGTHGSA 184 Query: 115 FPSI-VGYT-------LPYAWVGNSAKLCPGVCAYPFAVPQYMPGLKAVKSPNGDVG 163 S G+T Y WVGNS CPG CA+PF P Y P + +PN DVG Sbjct: 185 SGSFKTGHTKGSKNSKFAYIWVGNSETQCPGQCAWPFHQPIYGPQSPPLVAPNNDVG 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88814 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51862 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs85106183 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs1778 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs51158 (324 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs55091 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11602 198 3e-53 >Contig11602 Length = 299 Score = 198 bits (504), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 98/156 (62%), Positives = 117/156 (75%), Gaps = 5/156 (3%) Query: 1 MSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLGLFDTEV 60 MSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYL LFDTE+ Sbjct: 1 MSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLALFDTEI 60 Query: 61 EAARAYDRAAVKCNGKDAVTNFDPSLYQDEL---KASG-HGVDHNLDXXX-XXXXXXXXX 115 +AARAYD+AA+KCNGK+AVTNFDPS+Y++EL ++SG + DH+LD Sbjct: 61 DAARAYDKAAIKCNGKEAVTNFDPSIYENELNPSESSGVNAADHDLDLSLGSSNSKKNNQ 120 Query: 116 XXDFANRMQYTVMERPAPASLPNEVDWHNRGYRPKV 151 N Q +E S+ + DW ++G+RPK+ Sbjct: 121 ALGNDNNSQNGALEHQHSVSMQFDADWRSQGFRPKL 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15084 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24312 130 2e-32 >Contig24312 Length = 482 Score = 130 bits (326), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 71/189 (37%), Positives = 95/189 (50%), Gaps = 12/189 (6%) Query: 1 MGNINILDIYAPLCXXXXXXXXVL------------PFDPCSEIYVHSYLNSPQVQKSLH 48 +GNI+ IY P C L +DPC+E + Y N P+VQK+LH Sbjct: 280 LGNIDPYSIYTPSCPANVSQSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNLPEVQKALH 339 Query: 49 ANVTGIRGPWQDCSDTVLRHWKDSPLTVLPSIQELMTSGISVYIYSGDTDGTVPTISIRY 108 + W CSD V WKDSP TVL +EL+ SG+ ++++SGD D +P S RY Sbjct: 340 IDPGHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVIPITSTRY 399 Query: 109 SINKLGAKVKTAWYPCYIQGEXXXXXXXXQNLTFVTIRGAGHMVPSSQPARALAFFSSFL 168 SI+ L W Y G+ LTFV++RGAGH VP +P +AL SFL Sbjct: 400 SIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKSFL 459 Query: 169 DGKLPPAAK 177 G PA++ Sbjct: 460 SGSSMPASE 468 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42420 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10810 404 e-115 >Contig10810 Length = 250 Score = 404 bits (1038), Expect = e-115, Method: Compositional matrix adjust. Identities = 194/250 (77%), Positives = 209/250 (83%) Query: 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60 M K YPTVSE+YK A++K +RKLRG IAEKNCAPLMLRIAWHSAGTYD KTKTGGPFGTM Sbjct: 1 MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM 60 Query: 61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120 R AEQ+H ANNGLDIAVRLLEP K+QFP +SYAD YQLAGVV VE+TGGPD+PFHPGR Sbjct: 61 RCPAEQSHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRK 120 Query: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180 D EPP EGRLPDA +G DHLR VFG MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT Sbjct: 121 DAPEPPPEGRLPDATKGCDHLRDVFGKTMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180 Query: 181 RNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHL 240 NPLIFDNSYFT LL G+++GLL LPSDKALLDDPVFRPLVEK H+ Sbjct: 181 PNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHM 240 Query: 241 KLSELGFAEA 250 +LSELGFAEA Sbjct: 241 RLSELGFAEA 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs98970 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19106181 (303 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 71812892 156 4e-40 >71812892 Length = 209 Score = 156 bits (394), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/119 (63%), Positives = 90/119 (75%), Gaps = 5/119 (4%) Query: 154 QYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTXXXXXXXXXXXXIKFRGVDADINFHVDD 213 +YRGVTFYRRTGRWESHIWDCGKQVYLGGFDT IKFRGVDADINF++ D Sbjct: 37 EYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHSAARAYDRAAIKFRGVDADINFNLGD 96 Query: 214 YQDDIRIMSNFTKDEFVYSLRRQNTAAASRGTSKYRGV---TLHKCG-RWEARMGQYLG 268 Y++D++++ + K+EFV++LRRQ+T ASRG SKYRGV L KCG RWE MGQ G Sbjct: 97 YEEDMKLLGDLNKEEFVHALRRQST-GASRGNSKYRGVAAAALPKCGARWEDLMGQVPG 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs13890 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6611 352 4e-99 >Contig6611 Length = 285 Score = 352 bits (902), Expect = 4e-99, Method: Compositional matrix adjust. Identities = 167/223 (74%), Positives = 186/223 (83%) Query: 1 LGGNGFVGSHICREALDRGLTVAXXXXXXXXXXXXXWANNVIWHQGNLLSSDSWKEALDG 60 LGGNGFVGSH+CREALDRGL+VA WAN+V WHQGNLLS +S K+A +G Sbjct: 62 LGGNGFVGSHVCREALDRGLSVASLSRSGRSKLHDLWANSVTWHQGNLLSPESLKDAFNG 121 Query: 61 VTAVISCVGGFGSNSYMYKINGTANINAIRAASEKGVKRFVYISAADFGVANYLLQGYYE 120 VT+VISCVGGFGSNSYMYKINGTANINAIR A+E+GVKRFVYISAADFGVANYLLQGYYE Sbjct: 122 VTSVISCVGGFGSNSYMYKINGTANINAIRVAAEQGVKRFVYISAADFGVANYLLQGYYE 181 Query: 121 GKRAAETELLTRYPYGGVILRPGFIYGTRTVGGMKLPLGVIGSPMEMVLQHAKPLSQLPL 180 GKRAAETELLT++PYGGVILRPGFIYGTR+VG +K+PLGVIGSP+EM+ Q+ +PLSQLPL Sbjct: 182 GKRAAETELLTKFPYGGVILRPGFIYGTRSVGSLKIPLGVIGSPLEMLFQNTRPLSQLPL 241 Query: 181 VGPLFTPPXXXXXXXXXXXXXXTDPVFPPGIVDVHGILRYSQK 223 VGPLFTPP TDPVFPPGIVDV GI RY+QK Sbjct: 242 VGPLFTPPVNVTSVANVAVRAATDPVFPPGIVDVQGIQRYTQK 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7831 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs41454 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33967 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs83105 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226750975 59 9e-11 >226750975 Length = 217 Score = 58.5 bits (140), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 3/85 (3%) Query: 28 IDNKTGYKCFVLYPRSLFVTWGNR-DHWTWNCFKETSDENIEVVKLSHVCWMDVRGKFKI 86 +D +G KC+++ R+L + W + +W W ++ E EV +L VCW+++ G+ + Sbjct: 101 LDKWSGKKCYMIAARALSIVWADTPQYWKWISIPDSRFE--EVAELVDVCWLEIHGRIET 158 Query: 87 SELSPGVMYEIVYVVKLTNAAFGWE 111 LSP +Y+ V K T A+G+E Sbjct: 159 RMLSPSTLYKAYLVFKTTAQAYGFE 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs10070 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs44579 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs65208 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs21394 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs38569 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs7342 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs96097 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs36486 (413 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs20766 (390 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs42230 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22824 250 1e-68 >Contig22824 Length = 399 Score = 250 bits (639), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 124/213 (58%), Positives = 149/213 (69%), Gaps = 18/213 (8%) Query: 1 MVLCRVIMGNMEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSF 60 M+LCRVIMGNME L PG+KQFHPSS+DFDSGVD LQ+P+HYIVWNMNMNTHI+PEFVVSF Sbjct: 188 MILCRVIMGNMELLHPGSKQFHPSSKDFDSGVDGLQDPKHYIVWNMNMNTHIYPEFVVSF 247 Query: 61 KFSSNVEGHLIRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGS------ 114 K +SN EGHLI +E++ S + TS QG QG S+ D G + P+SDSG S Sbjct: 248 KITSNTEGHLIGTENKLGASGVGTSCQGPQG----SSAVDTGSETQPLSDSGKSHGNNSQ 303 Query: 115 --------QGXXXXXXXXXXXXXXXXWMPFPMLFASISNKVSPKVMEQISNQYELFRAKK 166 QG WMPFPMLF++I NKV P+ M+Q++ Y+LFR +K Sbjct: 304 MISKPGRFQGETTNTGSAPQRTPKSPWMPFPMLFSAIENKVPPEDMKQVNVHYDLFRERK 363 Query: 167 VNRDDFVKKLRLIVGDDLLRSTITALQCKIPSK 199 + RD+FVKKLRL+VGD LLRSTIT LQCKIP K Sbjct: 364 ITRDEFVKKLRLVVGDTLLRSTITELQCKIPHK 396 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs15150 (57 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs89951 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs101256 (284 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29208 156 3e-40 >Contig29208 Length = 288 Score = 156 bits (395), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 77/164 (46%), Positives = 107/164 (65%), Gaps = 2/164 (1%) Query: 106 DSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGA 165 DST GIF+ + V + ++GK I+VVS R+P +PWGD G++ V+E +G+F E A Sbjct: 1 DSTHGIFDGSISVVDNSTLEINGKEIKVVSKRDPAEIPWGDYGVEYVVESSGIFTTLEKA 60 Query: 166 GKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQK 225 H + GAKKV+I+AP D P +VVGVN + YKP+ I+SNASCTTNCLAP KV+ ++ Sbjct: 61 ALHKKGGAKKVVISAP-SADAPMFVVGVNENTYKPNMDIVSNASCTTNCLAPLAKVIHEE 119 Query: 226 FGIIKGNMTTTHSYTGDQRLLDA-SHXXXXXXXXXXXNIVPTST 268 FGI++G MTT H+ T Q+ +D S NI+P+ST Sbjct: 120 FGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGAGQNIIPSST 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs33726 (316 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs104903 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs3937 (332 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs48558 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48280500 197 7e-53 >48280500 Length = 162 Score = 197 bits (502), Expect = 7e-53, Method: Compositional matrix adjust. Identities = 102/150 (68%), Positives = 119/150 (79%), Gaps = 4/150 (2%) Query: 3 AEDQPADTDKMKEQ--PLSATNESSVSPNSSQGALTVGHTREAAVQSGSFGPVGDHSVYS 60 +E++PA+ D MKEQ P + NE SVSPN S A T+G REAA QSG FG GDH+V+ Sbjct: 13 SEEKPAEPDSMKEQVVPHVSKNERSVSPNPSPDAATIGLPREAAGQSGPFGSGGDHTVFP 72 Query: 61 SNIYAPQAQAFYYRGYDNVPGEWDEYPSYVNAEGLELGSTGVYNDNPSLVYHTGYGYSPQ 120 N+YAPQAQ FYYRGY+N GEWDEY Y+N EGLE+ S GVYN+NPSLV+H+GYGY+PQ Sbjct: 73 PNVYAPQAQPFYYRGYENGTGEWDEYSPYINTEGLEINSPGVYNENPSLVFHSGYGYNPQ 132 Query: 121 MPYGPYSPVTT--PSVGGDAHLYSPQQFPF 148 MPYGPYSPVTT PSVGGDA LYSPQQ+PF Sbjct: 133 MPYGPYSPVTTPMPSVGGDAQLYSPQQYPF 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs60186 (54 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs88787 (354 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31405 61 2e-11 >Contig31405 Length = 317 Score = 61.2 bits (147), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 83/340 (24%), Positives = 140/340 (41%), Gaps = 64/340 (18%) Query: 42 KSLVAGGVAGAVSRTAVAPLERLKILLQVQ---NP---------HSIK----YN------ 79 K V GGVA V+ + PL+ +K+ +Q+Q NP H+++ YN Sbjct: 4 KGFVEGGVASIVAGCSTHPLDLIKVRMQLQGESNPARAAAPQPIHNLRPAFAYNSHSATL 63 Query: 80 ------------GTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGIL 127 G I I++TEG + LF G V + ++ Y G+ Sbjct: 64 VAPPPPPATVRAGPISVGVKIFQTEGVKALFSG--------VSATVLRQTLYSTTRMGLY 115 Query: 128 YLYQHHTGNEDAELTPLLR-LGAGACAGIIAMSATYPMDMVRGRLTVQTEKSPYRYRGIF 186 + + + ++ PL R + AG AG + + P D+ V+ + Y+ + Sbjct: 116 EILKVKWADPNSGNLPLARKIFAGLVAGGVGAAVGNPADVA----MVRMQAGGRDYKNVI 171 Query: 187 HALSTVLREEGPRALYRGWFPSVIGVVPYVGLNFAVYESLKVWLIKTKPLGLAEDSELSV 246 A+S + R EG +L+RG +V + A Y+ +K ++ L +D + Sbjct: 172 DAISKMARSEGVLSLWRGSSLTVNRAMIVTASQLASYDQIKEAILDRH---LMKDG---L 225 Query: 247 TTRLXXXXXXXXXXXXXXYPLDVIRRRMQMVGWKEASSVVIGDGRNRAPLEYNGMIDAFR 306 T + P+DVI+ R+ ++ + GR+ Y G +D Sbjct: 226 GTHVTASFAAGFVASVASNPIDVIKTRVM--------NMKVEAGRDP---PYTGALDCAL 274 Query: 307 KTVRHEGFGALYKGLVPNSVKVVPSISLAFVTYEVVKDIL 346 KTVR EG ALYKG +P + P + FVT E ++ +L Sbjct: 275 KTVRAEGPMALYKGFIPTISRQGPFTVVLFVTLEQIRKVL 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs79931 (132 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs50927 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs19327 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Cs56792 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** Database: apple.as.orf Posted date: Mar 27, 2017 5:36 AM Number of letters in database: 349,985 Number of sequences in database: 1580 Lambda K H 0.318 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1580 Number of Hits to DB: 147,413,241 Number of extensions: 6014148 Number of successful extensions: 17545 Number of sequences better than 1.0e-10: 791 Number of HSP's gapped: 16617 Number of HSP's successfully gapped: 918 Length of database: 349,985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 6.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.7 bits) S2: 135 (56.6 bits)