BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36536 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57896440 73 8e-16 >57896440 Length = 244 Score = 73.2 bits (178), Expect = 8e-16, Method: Compositional matrix adjust. Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 3/69 (4%) Query: 9 GSCYYSVLGIRRDASSSDIRTAYRKLALKWHPDRWAKNQALAGEAKRRFQQIQEAYSVLS 68 G YY +L + + A+ +++ AYRKLA+KWHPD KN EA+ +F+QI EAY VLS Sbjct: 2 GVDYYKLLQVEKSATEDELKKAYRKLAMKWHPD---KNPTNKKEAETKFKQISEAYEVLS 58 Query: 69 DASKKSMYD 77 D K+++YD Sbjct: 59 DPQKRAIYD 67 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41993 (429 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2708 179 2e-47 >Contig2708 Length = 543 Score = 179 bits (455), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 135/381 (35%), Positives = 176/381 (46%), Gaps = 61/381 (16%) Query: 28 VFFEERFHDGWENKWVKSEWKKDENMAGEWNYTSGKWHGDPNDKGIQTSEDYRFYAISAE 87 F + F + +E +W S KDE G W ++ + H D G+ SE + YAI E Sbjct: 30 TVFYDSFDESFEGRWTVS--GKDE-YQGVWKHSKSEGH---EDFGLLVSEKAKKYAIVTE 83 Query: 88 YPE-FSNKDKTLVFQFTVKHEQKLDCGGGYMKLLSGEV---DQKKFGGDTPYSIMFGPDI 143 E S KD T+V QF + + L+CGG Y+K L + + K F ++PYSIMFGPD Sbjct: 84 VDEPVSLKDGTVVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIFDNESPYSIMFGPDK 143 Query: 144 CGYTTKKVHAILT----RDGK--NHLIKKDVPCETDQLSHVYTFILKPDATYSILIDNVE 197 CG T K VH I + G+ H + D+LSHVYT I+KPD IL+D E Sbjct: 144 CGLTNK-VHFIFKHKNPKSGEYVEHHLTTPPSVPADKLSHVYTAIIKPDNELIILVDGEE 202 Query: 198 KQTGSLYSDWDILPP----KKIKDPEAKKPEDWDEKEYIPDPEDEKPEGYD-DIPKEIXX 252 K+ + S D +PP K I DPE KKPEDWDE+ IPDP KP+ +D D P EI Sbjct: 203 KKKANFLSADDFMPPLIPTKTIPDPEDKKPEDWDERAKIPDPNAVKPDDWDEDAPMEIED 262 Query: 253 XXXXXXXX--------------------------------------XXXXXXGEWTAPTI 274 GEW P Sbjct: 263 EEAEKPERWLDDEPEEVEDPEATKPEDWDDEEDGEWEAPKIDNPKCVTAPGCGEWKRPMK 322 Query: 275 ANPEYKGPWKPKKIKNPNYKGKWKAPMIDNPEFKDDPEIYVFPDLKYVGIELWQVKSGTL 334 NP YKG W I NP+YKG WK I NP + + E F + +GIE+W ++ G L Sbjct: 323 RNPAYKGKWHAPLIDNPSYKGIWKPQEIPNPSYF-ELEKPNFEPIAAIGIEIWTMQDGIL 381 Query: 335 FDNVLICDDPEYAKQLVEETW 355 FDN+LI D + A + W Sbjct: 382 FDNILITKDEKVASSYRDTLW 402 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27855 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34062 (303 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6871 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12666265 (1221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41067 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 307 2e-86 >Contig1161 Length = 148 Score = 307 bits (786), Expect = 2e-86, Method: Compositional matrix adjust. Identities = 147/148 (99%), Positives = 148/148 (100%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRAKYETTARSWTQKYAMG 148 PEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRSKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30371 (362 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23723 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4218 213 1e-57 >Contig4218 Length = 191 Score = 213 bits (541), Expect = 1e-57, Method: Compositional matrix adjust. Identities = 100/175 (57%), Positives = 124/175 (70%), Gaps = 3/175 (1%) Query: 1 MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKP 60 MAF GT KC ACDKTVY+VD L+AD +HK CF+C HCKGTL +SNY+S +GVLYC+P Sbjct: 1 MAFAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP 60 Query: 61 HFEQLFKESGNFSKNFQTS---AKPADKLNELSRAPSKLSSMFSGTQDKCSACRKTVYPL 117 HF+QLFK +G+ K+F+ + KP ++ A SK S MF GT+DKC C+ TVYP Sbjct: 61 HFDQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAASKASGMFGGTRDKCFGCKNTVYPT 120 Query: 118 EKVTLEGESYHKSCFKCAHGGCPLTHSSYAALNGVLYCKHHFSQLFMEKGNYSHV 172 EKVT+ G YHK CFKC HGGC ++ S+Y A G LYCKHH +QL EKGN S + Sbjct: 121 EKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIREKGNLSQL 175 Score = 72.0 bits (175), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 34/76 (44%), Positives = 46/76 (60%) Query: 100 FSGTQDKCSACRKTVYPLEKVTLEGESYHKSCFKCAHGGCPLTHSSYAALNGVLYCKHHF 159 F+GT KC AC KTVY ++K+T + +HK+CF+C H L S+Y + GVLYC+ HF Sbjct: 3 FAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF 62 Query: 160 SQLFMEKGNYSHVLEA 175 QLF G+ E Sbjct: 63 DQLFKRTGSLDKSFEG 78 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33773 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47924 (371 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158379466 289 2e-80 >158379466 Length = 226 Score = 289 bits (740), Expect = 2e-80, Method: Compositional matrix adjust. Identities = 131/221 (59%), Positives = 170/221 (76%) Query: 50 TNIKKEVSQLIGKTPLVFLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMITDAENKQL 109 + I K+V++LIGKTPLV+LN + +GC A +A K EMM+P +S+KDR +MI DAE K L Sbjct: 6 SGIAKDVTELIGKTPLVYLNHIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKGL 65 Query: 110 ITPGKTVLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPT 169 ITPG++VLIEPTSGN GI +AFMAA K Y++++TMP+ S+ERR+ +RAFGA+L+LTDP Sbjct: 66 ITPGQSVLIEPTSGNTGIGLAFMAAAKQYRLIITMPASMSIERRIILRAFGAELVLTDPA 125 Query: 170 KGMGGTVKKAYELLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTRGQVDIFIMXXXX 229 KGM G V+KA E+L TP+A+MLQQF NPAN +VH+ETTGPEIWE T G++D F+ Sbjct: 126 KGMKGAVQKAEEILAKTPNAYMLQQFENPANPKVHYETTGPEIWEGTGGKIDAFVSGIGT 185 Query: 230 XXXXXXXXRYLKSQNPNVKIYGLEPTESNVLNGGKPGPHHI 270 +YLK +NP+VK+YG+EP ES VL GGKPGPH I Sbjct: 186 GGTITGAGKYLKEKNPSVKLYGVEPVESPVLTGGKPGPHKI 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11117 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13016 (651 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48719 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22278 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15561 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 114 5e-28 >Contig1666 Length = 421 Score = 114 bits (286), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 57/109 (52%), Positives = 74/109 (67%), Gaps = 5/109 (4%) Query: 2 EWFFFCPRDRKYPNGSRTNRATRAGYWKATGKDRKVVACQST-VIGYRKTLVFYRGRAPL 60 EW+FF DRKY N SRTNRAT GYWK TGKDR V C S+ +G +KTLVF+ GRAP Sbjct: 66 EWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPV--CHSSRAVGMKKTLVFHSGRAPK 123 Query: 61 GDRTDWVMHEYRLCDDPSQGSGF--QGAFALCRVVKKNDPTQKSSDFHG 107 G RT+WVMHEYRL + + +G + A+ LCR+ +K+ K+ + +G Sbjct: 124 GARTNWVMHEYRLDNQELEKAGIVEKDAYVLCRIFQKSGTGPKNGEQYG 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55076 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42061 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18597 (309 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666260 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51183 (643 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4757 584 e-169 >Contig4757 Length = 473 Score = 584 bits (1505), Expect = e-169, Method: Compositional matrix adjust. Identities = 289/411 (70%), Positives = 317/411 (77%), Gaps = 7/411 (1%) Query: 171 QCAILSPTFKVREFQVNESFPFTIALTWKG---DAQNGAADNQQNTVVFPKGNPIPSVKA 227 QCAILSPTFKVREFQVNESFPF+IAL+WKG DAQNG D Q T+VFPKGNPIPS KA Sbjct: 1 QCAILSPTFKVREFQVNESFPFSIALSWKGSGPDAQNGGPD--QTTLVFPKGNPIPSTKA 58 Query: 228 LTFYRSGTFSVDVVYADASEIQGQVKISTYTIGPFQSTKVERAKLKVKVRLNLHGIXXXX 287 LTFYRSGTFSVDV Y D ++Q KISTYTIGPFQSTK ER+K+KV+ RLN HGI Sbjct: 59 LTFYRSGTFSVDVQYTDVGDLQAPAKISTYTIGPFQSTKGERSKVKVRARLNYHGIVSVD 118 Query: 288 XXXXXXXXXXXXXXXXXXXXDATKMDTDETPGDAAAPPGTSETDANMQDAK-GDGPGVEN 346 +ATKM+TDE P D PP + D NMQDA D EN Sbjct: 119 SATLLEEEEVEVPVTKEQPKEATKMETDEAPSDVP-PPSSEAADVNMQDANSNDAASAEN 177 Query: 347 GVPESGDKSVQMETDTXXXXXXXXXXXTNIPVSELVYGTMVPADVQKAVEKEFEMALQDR 406 GVPESGDK VQMETD TNIPV ELVYG M ADVQKA+E E+EMALQDR Sbjct: 178 GVPESGDKPVQMETDAKADAPKRKVKKTNIPVVELVYGGMAAADVQKAIESEYEMALQDR 237 Query: 407 VMEETKDKKNAVEAYVYDMRNKLHDKYQDFVTSSERDEFTAKLQEVEDWLYEDGEDETKG 466 VMEETKDKKNAVEAYVYDMRNKL DK Q+FVT SER+ F KLQE EDWLYEDGEDETKG Sbjct: 238 VMEETKDKKNAVEAYVYDMRNKLSDKLQEFVTDSEREAFITKLQETEDWLYEDGEDETKG 297 Query: 467 VYIAKLEELKKQGDPIEERYKEYSERGTVVDQLVYCINSYREAAMSNDPKFEHIDVSEKQ 526 VY+AKLEELKKQGD IEER KE++ERG+V+DQL YC+NSYREAA S+DPKF+HID +EK+ Sbjct: 298 VYVAKLEELKKQGDAIEERCKEHTERGSVIDQLAYCVNSYREAAASSDPKFDHIDFAEKE 357 Query: 527 KVLSECVEAEAWLREKKQQQDSLPKHATPVLLSADVRRKAEAVDRACRPIM 577 KVL ECVEAEAWLREKKQQQDSLPKHA PVLLSADV+RK EA+DR CRP+M Sbjct: 358 KVLKECVEAEAWLREKKQQQDSLPKHANPVLLSADVKRKTEALDRFCRPVM 408 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20266261 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6911 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46936 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58456 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 120 3e-30 >Contig4694 Length = 351 Score = 120 bits (302), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 70/172 (40%), Positives = 103/172 (59%), Gaps = 10/172 (5%) Query: 1 MAKNLKVDPGQLMNMFEKGRQQIRMNYYPPCVHASKVIGVTPHSDICGLTLLAQVNEVQG 60 +A +L + + F+ IR+N+YPPC +GV H D LT+LAQ +EV G Sbjct: 179 IALSLGLPEDRFKGYFKDQTSFIRLNHYPPCPSPELALGVGRHKDGGALTVLAQ-DEVGG 237 Query: 61 LQIKK--NGKWIPIRPVPGAFIVNIGDILEIMSNGEYKSIEHRAVVNPETERLSIAAFHS 118 L++K+ +G+WI +RP P A+I+N+GD++++ SN EY+S+EHR +VN E ER S+ F + Sbjct: 238 LEVKRKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHRVMVNSEKERFSVLFFLN 297 Query: 119 PSVETIIGPLPELV-KENGAIYKSVSREEYYKFAFSRKLDGKSIISHMKLEN 169 P+ T + PL EL K+N A Y S + KF RKL S +K EN Sbjct: 298 PAHYTEVKPLEELTNKQNPAKYTPYS---WGKFLTLRKL---SNFKKLKAEN 343 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25326 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13566256 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54613 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38743 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14266265 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2922 203 6e-55 >Contig2922 Length = 223 Score = 203 bits (516), Expect = 6e-55, Method: Compositional matrix adjust. Identities = 101/194 (52%), Positives = 137/194 (70%), Gaps = 4/194 (2%) Query: 4 ELKLFRTWSSVFALRIVWALKIKGVQYETIFED-LSNKSPSLLQYNPVHKKVPVLVHNGK 62 ++ + WSS + R++WALK+KGV YE + ED L NKS LL+YNPVHKKVPVLVH GK Sbjct: 3 QVTVLGAWSSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAGK 62 Query: 63 PIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDNKVLTSIVWGVFFKERKEQE 122 PIAES VILEYI+ETW + PLLP+DP++RA+ARFW KFG++K ++G F E ++Q Sbjct: 63 PIAESAVILEYIEETWPQNPLLPKDPHQRALARFWIKFGEDKF--GALFGFFMTEGEQQV 120 Query: 123 EAMLEAMEHLQFLEDE-LNGKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVDEDKF 181 +A E E L LE++ L K+FFGG+ +G DL GWLA + + E+AG+K ++ + F Sbjct: 121 KATKERQEQLTILEEQGLGDKKFFGGDELGMADLEFGWLAWWMDVMSELAGVKGIEAETF 180 Query: 182 PLLAAWMQEYADSP 195 P L AW+Q + D P Sbjct: 181 PRLHAWIQRFKDIP 194 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57098 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38863 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48983 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4947 (441 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2437 338 4e-95 >Contig2437 Length = 408 Score = 338 bits (867), Expect = 4e-95, Method: Compositional matrix adjust. Identities = 174/406 (42%), Positives = 243/406 (59%), Gaps = 11/406 (2%) Query: 36 ISKLGFGAYRFSISWSRIFPDG-LGTKVNDEGIAYYNNLINALLDKGIEPYVTLYHWDLP 94 + K+G +R SISW+R+ P G LG VN G+ +YNN+ N LL GI+P+VTL H+D P Sbjct: 1 MKKIGLDTFRMSISWTRVLPKGKLGGGVNPLGVKFYNNVFNELLANGIKPFVTLLHYDPP 60 Query: 95 LYLHESMGGWLNEQIVKYFAIYAETCFASFGDRVKNWITLNEPLQTAVNGYGVGIFAPGR 154 L + GG+L+ I+ + Y + CF +FGDRVK+W+T+NEP A++GYG G FAPGR Sbjct: 61 QALEDLYGGFLSPNIINDYGDYVDFCFKTFGDRVKHWVTMNEPNGFAISGYGGGTFAPGR 120 Query: 155 ---------QEHSSTEPYXXXXXXXXXXXXXXSIYRNKYKDKQGGQIGL-VVDCEWAEAF 204 +S+TE Y IY++KY+ Q GQIG+ VV W + Sbjct: 121 CSNYEGNCTSGNSATESYTVAHHLLLAHSAAVKIYKDKYQASQKGQIGITVVTHWWKPKY 180 Query: 205 SDKIEDKVAAARRLDFQLGWFLDPIYFGDYPEVMHEKLGDRLPKFSEEQIALLTNSVDFV 264 ++ + A R LDF GWF +PI GDYPEVM +G+RLPKF+E + + S+DF+ Sbjct: 181 PAQLASRTATLRSLDFMFGWFANPIVHGDYPEVMRSMVGNRLPKFTEAESKQIKGSLDFL 240 Query: 265 GLNHYTSRFIAHNESSVEHDFYKDQKLERIAEWDGGEVIGEKAASPWLYVVPWGIRKVLN 324 GLN+YTS + +S H + D+++ G +IG WLYV P GIR VL Sbjct: 241 GLNYYTSYYTEDGPASSNHSWTSDRQVTASTTDKAGVLIGAATDLDWLYVYPKGIRDVLL 300 Query: 325 YIAQRYNSPPIYVTENGMDDEDNDTSPLHEMLDDKLRVFYFKGYLASVAQAIKDGVDVRG 384 YI ++YN+P I++TENG N ++P+ E D LR+ Y +L + +AIKDGV V+G Sbjct: 301 YIKEKYNNPNIFITENGYAYGYNASTPIEEARKDNLRIRYHHDHLWYLLKAIKDGVQVKG 360 Query: 385 YFAWSLLDNFEWSQGYTKRFGLVYVDYRNDLSRHPKSSALWFLRFL 430 Y+AWS D+FEW GYT FGL VD +++L R+ K SA W+ FL Sbjct: 361 YYAWSFFDDFEWDAGYTVGFGLTLVDVKDNLKRYLKYSAYWYKMFL 406 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2422 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24203 (439 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11070 (295 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15700 (307 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17841 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44799 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25307 (113 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40056 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6059 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38831 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3514 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57270 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158360899 192 1e-51 >158360899 Length = 246 Score = 192 bits (488), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 87/220 (39%), Positives = 135/220 (61%), Gaps = 3/220 (1%) Query: 31 SRATYYGSPDCLGTPTGACGFGEYGRSVNGGNVGA-VSRLYRNGTGCGACYQVRCKVPNL 89 ++A Y+ L +GACG+G ++GG++ A V +Y++G GCG+C+Q+RCK L Sbjct: 12 TKAAYFSKAPAL--SSGACGYGSLALGLSGGHLAAAVPSIYKDGAGCGSCFQIRCKNATL 69 Query: 90 CADNGMKVVVTDHGEGDYTDFILSPRGFSMLARPNMAADLFAYGVVGIEYRRVPCQYPGS 149 C G KV+ +D + TDF+LS R F +A+ + D+ +G+V +EY+RVPC+Y Sbjct: 70 CTKQGTKVITSDLNHNNQTDFVLSSRAFMAMAQKGLGQDILKHGIVDVEYKRVPCEYKNQ 129 Query: 150 NIFFKVHEHSRFPDYLAIVMLYQAGLSDITAVDIWQEDCQEWKGMRKSYGAVWDMANPPK 209 N+ +V E S+ P YLA+ +LYQ G ++I A+D+ Q W + ++YGAVWD + P Sbjct: 130 NLALRVEESSQKPHYLAVKVLYQGGQTEIVAIDVAQVGSSNWSFLTRNYGAVWDTSRVPA 189 Query: 210 GPVGLRFQVSGRGGQKWVQLMNVIPSDWKAGVAYDSAFQL 249 G + RF V+G K V NV+P+DWK G+ YD+ Q+ Sbjct: 190 GALQFRFVVTGGFDGKMVWAKNVLPADWKPGMVYDTKVQI 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49087 (362 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3108 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56909 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48703 (273 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28997 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77982401 95 3e-22 >77982401 Length = 185 Score = 94.7 bits (234), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 54/169 (31%), Positives = 96/169 (56%), Gaps = 4/169 (2%) Query: 17 KQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQPR 76 ++E+ + ++GL N+GKT++V + G + + PT+GFN++ +T T+ +WD+GGQ Sbjct: 14 EKEIRILMVGLDNSGKTTIV-LRINGEDTSVVSPTLGFNIKTLTYQKYTLNIWDVGGQKT 72 Query: 77 FRTMWERYCRAVSAIVYVVDAADPDNIGISKSELHDLLSKPSLNGIPLLVLGNKIDKPGA 136 R+ W Y +V+VVD++D + K EL +LL + L+G LL+L NK D GA Sbjct: 73 IRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGSSLLILANKQDIKGA 132 Query: 137 LSKHALTEEMGLKSITDREVCCFMISCKNST--NIDSVIDWLVKHSKSK 183 L+ + + + L+++ D+ ++ C T + DWLV+ S+ Sbjct: 133 LTPEEIAKVLNLQAM-DKTRHWNIVGCSAYTGEGLLEGFDWLVQDIASR 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14352 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41345 (44 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31026 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5776 186 2e-49 >Contig5776 Length = 289 Score = 186 bits (471), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 101/266 (37%), Positives = 150/266 (56%), Gaps = 12/266 (4%) Query: 18 PLGNALSSNYYDKTCPDVESTVTNAVRQAVMADKKVAAALLRMHFHDCFIRGCDASVLLN 77 P+ LS ++YD +CP ++S V +++ D AA LLR+HFHDCF++GCD SVLL+ Sbjct: 31 PVVKGLSWSFYDSSCPKLDSIVRKQLKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLD 90 Query: 78 SVNKNTAEKDGPANGSLH--AFFVIDNAKKALEALCPGVVSCXXXXXXXXXXXXXXXGGP 135 +E+ P N SL AF +I++ ++ + + C VVSC GGP Sbjct: 91 GSASGPSEQQAPPNLSLRAKAFQIINDLREIVHSKCGRVVSCADLTALAARDAVFLSGGP 150 Query: 136 TWEVPKGRKDGR--ISRASETSQLPSPTFNISQLKQSFSQRGLSLDDLVALSGGHTLGFS 193 +EVP GRKDG +R + LP+PT N ++L +++ L D+VALSGGHT+G Sbjct: 151 EYEVPLGRKDGLNFATRNETLANLPAPTSNTTKLLTDLAKKNLDATDVVALSGGHTIGLG 210 Query: 194 HCSSFQSRIRNFNATHDIDPTMHPSLAASLRSVCPKKNNVKNAGATMD-PSPTTFDNTYY 252 HC+SF R+ D +M + A L+ VCP + NA +D SP TFDN YY Sbjct: 211 HCTSFTGRLYPTQ-----DASMDKTFANDLKQVCPAADT--NATTVLDIRSPDTFDNKYY 263 Query: 253 KLILQGRSLFSSDEALLTFPKTKNLV 278 ++ + LF+SD+ L T +T+++V Sbjct: 264 VDLMNRQCLFTSDQDLYTDKRTRDIV 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1415 (55 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41190 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19558 (341 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3762 159 2e-41 >Contig3762 Length = 261 Score = 159 bits (402), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 83/206 (40%), Positives = 125/206 (60%), Gaps = 6/206 (2%) Query: 30 SVISFDQGYTHLFGEGNLVRSSDGRSVRLLLDRYTGSGFISANLYNHGFFSANIKLPSEY 89 S +F+Q + +G+G ++ + + L LD+ +GSGF S N Y G IKL Sbjct: 20 SAGNFNQDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKSRNQYLFGKIDMQIKLVPGN 79 Query: 90 TAGVVVAFYTSNGDVFEKTHDELDFEFLGNVKGKPWRFQTNVYGNGSTSRGREERYRLWF 149 +AG V ++Y S+ HDE+DFEFLGN+ G P+ TNV+ G +R E+++ LWF Sbjct: 80 SAGTVTSYYLSS---LGSAHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNR--EQQFYLWF 134 Query: 150 DPSKEFHRYSILWTAKNIIFYVDEVPIREVIRNEAMGGDYP-SKPMALYATIWDASNWAT 208 DP+K+FH YSILW ++IIF VD PIRE E+ G +P ++ M +Y+++W+A +WAT Sbjct: 135 DPTKDFHTYSILWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAMWIYSSLWNADDWAT 194 Query: 209 SGGKYKVDYNYAPFVSEFSDFVLDGC 234 GG K D++ APF + + +F C Sbjct: 195 RGGLVKTDWSKAPFTASYRNFNAQAC 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59307 (344 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 141 5e-36 >Contig3037 Length = 313 Score = 141 bits (356), Expect = 5e-36, Method: Compositional matrix adjust. Identities = 69/117 (58%), Positives = 89/117 (76%), Gaps = 4/117 (3%) Query: 8 KGAWTQEEDVLLRKCIEKYGEGKWHLVPLRAGLNRCRKSCRLRWLNYLKPDIKRGEFALD 67 KGAWT+EED L I +GEG W +P +AGL RC KSCRLRW+NYL+PD+KRG F + Sbjct: 14 KGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTEE 73 Query: 68 EVDLMIRLHNLLGNRWSLIAGRLPGRTANDVKNYWHGHHLKKKVQFQEEGRKKPQTH 124 E +L+I+LH+LLGN+WSLIAGRLPGRT N++KNYW+ H+K+K+ + PQTH Sbjct: 74 EDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWN-THIKRKLLTRG---LDPQTH 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57632 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56933 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29283 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56715 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17952 (330 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19419 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36008 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58213 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14854 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59214 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 70 1e-14 >89552756 Length = 189 Score = 69.7 bits (169), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 44/112 (39%), Positives = 66/112 (58%), Gaps = 13/112 (11%) Query: 2 RVQIALDAARGIEYIHEHTKTHYVHRDIKTSNILLD----GAFRAKISDFGLAKLVGKTG 57 R+ IA+DAA G+EY+H + VH D+K N+L++ KI D GL+K+ +T Sbjct: 22 RLIIAMDAAFGMEYLH---GKNIVHFDLKCENLLVNMRDPQRPVCKIGDLGLSKVKQQT- 77 Query: 58 EGEASATRVVGTFGYLAPEYLS--DGLATTKSDVYAFGIVLFEIISGKEAVT 107 + V GT ++APE LS + T K DVY+FGIV++E+++G E T Sbjct: 78 ---LVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLTGDEPYT 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27259 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25240 (605 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57878 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15372 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26411 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12908 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40104 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4966260 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54718 (350 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59883 (485 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53234 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50196 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14166257 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4605 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51506 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158371956 157 8e-41 >158371956 Length = 208 Score = 157 bits (396), Expect = 8e-41, Method: Compositional matrix adjust. Identities = 76/150 (50%), Positives = 108/150 (72%) Query: 52 VESKKLWYLAGPAIFTSLCQYSLGAITQVFAGHVGTLELAAVSVENSVIAGFSFGVMLGM 111 VE K L+ LA PA+ L + TQ++ GH+G LELAA S+ N+ I F++G+MLGM Sbjct: 50 VELKILFRLAAPAVVVYLLNNVISMSTQIYCGHLGNLELAASSLGNTGIQVFAYGLMLGM 109 Query: 112 GSALETLCGQAFGAGQLDMLGVYMQRSWVILTSTAVLLSFLYIFSARLLKLIGQTEAISK 171 GSA+ETLCGQA+GA + +MLG+Y+QRS ++L +T + + F+YIFS LL +G++ I+ Sbjct: 110 GSAVETLCGQAYGAHKYEMLGIYLQRSTILLMATGIPVMFIYIFSKPLLLALGESSTIAS 169 Query: 172 EAGMFAVWMLPQLFAYAVNFPLAKFLQAQS 201 A +F ++PQ+FAYA NFP+ KFLQAQS Sbjct: 170 AAAIFVYGLIPQIFAYACNFPIQKFLQAQS 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9366262 (335 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16926 (379 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 412 e-117 >Contig3804 Length = 391 Score = 412 bits (1060), Expect = e-117, Method: Compositional matrix adjust. Identities = 224/393 (56%), Positives = 266/393 (67%), Gaps = 16/393 (4%) Query: 1 MCGGAIISDFIPASRCRRVDEDYF-PALKKRTSGNHCS---KSLWSXXXXXXXXXXXXXX 56 MCGGAIIS FIP +R RRV D+ P LKK +SG S + L S Sbjct: 1 MCGGAIISGFIPPTRSRRVTADFLWPDLKKSSSGKRFSSGGRPLRSEIFGLDDDFEADFQ 60 Query: 57 XLGFKXXXXXXXXXI--KPSAFSAAKP----HGYTGIKSVEFNGQAEKSAKRKRKNQYRG 110 + KP AFSA KP G +KSVE N QAEKSAKRKRKNQYRG Sbjct: 61 EFKDDSDVDDDEDMLDSKPFAFSAGKPSPAARGPKTVKSVECNSQAEKSAKRKRKNQYRG 120 Query: 111 IRQRPWGKWAAEIRDPRKGVRVWLGTFNTXXXXXXXXXXXXXXIRGKKAKVNFPDETPLT 170 IRQRPWGKWAAEIRDPRKGVRVWLGTFNT IRGKKAKVNFP+E P Sbjct: 121 IRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEEAPRA 180 Query: 171 APKRTIKANAQKLIPKGSPNSSHSNLNQSFNFMNNSDQEYYSSL--MDEKPSTNQYGYPD 228 + KR +KAN QK++PK + ++ SNLNQ+ NF+N SDQEYY+S+ ++EKP TN +GY D Sbjct: 181 STKRAVKANPQKVLPKTNLDNMQSNLNQNVNFVNGSDQEYYNSMSFLEEKPQTNNFGYMD 240 Query: 229 SFPANGEVGLKSLAPSENGRMYFNSDQGSNSFDCSDLGWGEQGAKTPEISSVLSATLEGD 288 S NG+ G+KS ++ +YF+SDQGSNSFDCSD GWGEQG++TPEISSVLS+ LE Sbjct: 241 SVLTNGDFGMKSSTVADPAALYFSSDQGSNSFDCSDFGWGEQGSRTPEISSVLSSVLEES 300 Query: 289 E-SQFIEDANPKKKLKSNSQNAVPVEENT-PNGLSEDLSAFESQMKYFQIPYLDGNWEAS 346 E S F+EDANP KKLK+N + VP E N P LSE+LSAFE MKY Q PYL+G+W+ S Sbjct: 301 ENSLFLEDANPTKKLKANPEGLVPAENNVAPKTLSEELSAFE--MKYCQTPYLEGSWDTS 358 Query: 347 MDALLSGDAAQDGGNPMDLWSFDDLPTVVGGVF 379 +D L+GD QDG NP+DLWSFDDLP++ GGVF Sbjct: 359 IDTFLNGDMTQDGCNPVDLWSFDDLPSMAGGVF 391 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65924 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17361 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45838 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57566 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3257 68 5e-14 >Contig3257 Length = 185 Score = 68.2 bits (165), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 9/67 (13%) Query: 222 LGSELPIARRNSLHRFLEKRKDRVNSKAPYQVNNPSR--PSPKPEEDTNPKLNKDEGQSS 279 + S+LPI RR SLH+FL KRK+RV + APYQVN+ + SPK EE GQSS Sbjct: 126 IASDLPIMRRASLHKFLAKRKERVVAVAPYQVNHSQQRATSPKAEEQV-------AGQSS 178 Query: 280 KQLDLRL 286 KQL+LRL Sbjct: 179 KQLELRL 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58784 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41509 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30393 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158358373 64 4e-13 >158358373 Length = 147 Score = 63.9 bits (154), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 5/107 (4%) Query: 53 IMDTPKEYLFYMDVPGLCKSDIQVTVEDDNTLVIRSHXXXXXXXXXXXXCKYVRLERRAP 112 I +TP+ ++F D+PGL +++V +EDD L I + R+ER + Sbjct: 44 ISETPEAHVFKADIPGLKNEEVKVEIEDDRVLQISGERKIEKEDKNDT---WHRVER-SS 99 Query: 113 QKLMRKFRLPENANTSAISAKCENGALTVVIEK-HPPPPKSKTVEVT 158 K R+FRLPENA I A ENG L+V + K P K++E++ Sbjct: 100 GKFSRRFRLPENAKVDEIKAAMENGVLSVTVPKVDVKKPDVKSIEIS 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13185 (413 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19104 (398 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3999 729 0.0 >Contig3999 Length = 397 Score = 729 bits (1883), Expect = 0.0, Method: Compositional matrix adjust. Identities = 357/387 (92%), Positives = 374/387 (96%), Gaps = 3/387 (0%) Query: 14 VLDKSDWVKGQTL-RQSSVS-VIRCLPTAPSGLTIRAGSYADELVKTAKTIASPGRGILA 71 VLDKS+WVKGQTL RQ SVS V+RC P+A SGLTIRA SYADELVKTAKT+ASPGRGILA Sbjct: 12 VLDKSEWVKGQTLLRQPSVSSVVRCHPSATSGLTIRA-SYADELVKTAKTVASPGRGILA 70 Query: 72 MDESNATCGKRLASIGLENTEANRQAYRTLLVTVPGLGNHISGAILFEETLYQSTTDGKK 131 MDESNATCGKRLASIGLENTEANRQAYRTLLVTVPGLGN++SGAILFEETLYQST DGKK Sbjct: 71 MDESNATCGKRLASIGLENTEANRQAYRTLLVTVPGLGNYVSGAILFEETLYQSTVDGKK 130 Query: 132 MVDVLVEQKIVPGIKVDKGLVPLVGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVS 191 +VDVLVEQ IVPGIKVDKGLVPL GSNDESWCQGLDGLASR+AAYYQQGARFAKWRTVVS Sbjct: 131 IVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVS 190 Query: 192 IPNGPSALALKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIERTFEVAQKVWAEVF 251 IPNGPSALA+KEAAWGLARYAAISQD+GLVPIVEPEILLDGEHGI+RTFEVAQ VWAEVF Sbjct: 191 IPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHGIDRTFEVAQAVWAEVF 250 Query: 252 FYLAENNVMFEGILLKPSMVTPGAECKDRATPEQVADYTLKLLKRRIPPAVPGIMFLSGG 311 FYLA+NNV+FEGILLKPSMVTPGAECK+RATPEQVADYTLKLL+RRIPPAVPGIMFLSGG Sbjct: 251 FYLAQNNVLFEGILLKPSMVTPGAECKERATPEQVADYTLKLLQRRIPPAVPGIMFLSGG 310 Query: 312 QSEVEATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGRPESVKEAQEALLIRAKANS 371 QSEVEATLNLNAMNQ PNPWHVSFSYARALQNTCLKTWGGRPE+VK AQEALLIRAKANS Sbjct: 311 QSEVEATLNLNAMNQSPNPWHVSFSYARALQNTCLKTWGGRPENVKAAQEALLIRAKANS 370 Query: 372 LAQLGKYTGEGESEEAKKGMFVKGYVY 398 LAQLGKYTGEGESEEAKK +FVKGYVY Sbjct: 371 LAQLGKYTGEGESEEAKKELFVKGYVY 397 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64951 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49738 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49284 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36137 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12366263 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41528 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77981379 124 1e-31 >77981379 Length = 204 Score = 124 bits (311), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 62/89 (69%), Positives = 66/89 (74%) Query: 16 ESIYGAKFEDENFIKKHTGPGILSMANAGPGTNGSQFFICTDKTEWLDGRHVVFGQVVEG 75 ESIYG KF DENF KHTGPG+LSMANAGP TNGSQFFI T T WLDGRHVVFG+V+ G Sbjct: 114 ESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTTWLDGRHVVFGKVLSG 173 Query: 76 MDVVKAVEKVGSGSGRTAKTVKIEDCGQL 104 MDVV VE GS SG V I D G+L Sbjct: 174 MDVVYKVEAEGSQSGTPKSKVAIVDSGEL 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15164 (302 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24787 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23931 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 264 3e-73 >Contig3037 Length = 313 Score = 264 bits (675), Expect = 3e-73, Method: Compositional matrix adjust. Identities = 122/131 (93%), Positives = 125/131 (95%) Query: 1 MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY 60 MGRSPCCEKAHTNKGAWTKEED RLI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY Sbjct: 1 MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINY 60 Query: 61 LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG 120 LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHI+RKLL RG Sbjct: 61 LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRG 120 Query: 121 IDPSTHRPINE 131 +DP THRP+NE Sbjct: 121 LDPQTHRPLNE 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5051 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64486 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18866260 (386 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2047 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158360899 235 8e-65 >158360899 Length = 246 Score = 235 bits (600), Expect = 8e-65, Method: Compositional matrix adjust. Identities = 110/147 (74%), Positives = 122/147 (82%) Query: 1 MANKGMGQQILKLGLVDVEYKRVLCNYNKQNLAIRVEEMSQKPHYLAIKVLYQGGQTEIV 60 MA KG+GQ ILK G+VDVEYKRV C Y QNLA+RVEE SQKPHYLA+KVLYQGGQTEIV Sbjct: 100 MAQKGLGQDILKHGIVDVEYKRVPCEYKNQNLALRVEESSQKPHYLAVKVLYQGGQTEIV 159 Query: 61 GMDVAQVDSSRWTYMTRNYGAIWDTSNVPSGPLQLRFVVTGGYDGKWVWAKKVLPADWKV 120 +DVAQV SS W+++TRNYGA+WDTS VP+G LQ RFVVTGG+DGK VWAK VLPADWK Sbjct: 160 AIDVAQVGSSNWSFLTRNYGAVWDTSRVPAGALQFRFVVTGGFDGKMVWAKNVLPADWKP 219 Query: 121 GETYDAGVQISDIAQEPCYPCDNENWK 147 G YD VQISDIAQE C PCD+ WK Sbjct: 220 GMVYDTKVQISDIAQEGCSPCDDGIWK 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19544 (354 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41361 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19697 (335 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35496 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50341 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 61 4e-12 >89552756 Length = 189 Score = 61.2 bits (147), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 40/104 (38%), Positives = 58/104 (55%), Gaps = 12/104 (11%) Query: 1 LDCARALEFLHEHAVPSIIHRDFKPSNILLD----QNFRAKVSDFGLAKTSSDKINSQIP 56 +D A +E+LH +I+H D K N+L++ Q K+ D GL+K K + + Sbjct: 27 MDAAFGMEYLHGK---NIVHFDLKCENLLVNMRDPQRPVCKIGDLGLSKV---KQQTLVS 80 Query: 57 TRVIGTTGYLAPEYAS--SGKLTTKSDVYSYGVVLLELLTGRVP 98 V GT ++APE S S +T K DVYS+G+V+ ELLTG P Sbjct: 81 GGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLTGDEP 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46672 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19217 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9908 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6720 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14589 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31134 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21166264 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56209 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5225 121 1e-30 >Contig5225 Length = 321 Score = 121 bits (304), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 55/79 (69%), Positives = 67/79 (84%) Query: 74 GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPS 133 GG AWEK+VR S+ + NG+SVLVTGAAGF+G+H S ALK+RGDGV+GLDNFN YYDPS Sbjct: 88 GGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNSYYDPS 147 Query: 134 LKRARQALLERTGVFIVEG 152 LKRARQA+L++ +FIVE Sbjct: 148 LKRARQAMLKKHEIFIVEA 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6137 (314 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2398 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27467 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1166261 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13800 (57 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14448 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27445 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv146 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28408 (382 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158379466 343 1e-96 >158379466 Length = 226 Score = 343 bits (879), Expect = 1e-96, Method: Compositional matrix adjust. Identities = 163/224 (72%), Positives = 190/224 (84%) Query: 60 VEGLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIADAEQ 119 VE IA+DVT+LIGKTP+VYLN+IV G VA IAAKLE+MEPC SVKDRIGYSMIADAE Sbjct: 3 VEKSGIAKDVTELIGKTPLVYLNHIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEA 62 Query: 120 RGAITPGKSTLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLLKAFGAELVLT 179 +G ITPG+S L+EPTSGNTGIGLAF+AA+K Y+LI+TMPASMS+ERR++L+AFGAELVLT Sbjct: 63 KGLITPGQSVLIEPTSGNTGIGLAFMAAAKQYRLIITMPASMSIERRIILRAFGAELVLT 122 Query: 180 DPAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYQTTGPEIWEDTRGKVDXXXXX 239 DPAKGMKGAVQKAEEIL TPNAYMLQQF+NPANPKVHY+TTGPEIWE T GK+D Sbjct: 123 DPAKGMKGAVQKAEEILAKTPNAYMLQQFENPANPKVHYETTGPEIWEGTGGKIDAFVSG 182 Query: 240 XXXXXXXXXXXKFLKKQNPNIKAIGVEPLESNILSGGKPGPHKI 283 K+LK++NP++K GVEP+ES +L+GGKPGPHKI Sbjct: 183 IGTGGTITGAGKYLKEKNPSVKLYGVEPVESPVLTGGKPGPHKI 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17966265 (389 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5766256 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6567 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27615 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10166263 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39122 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22123 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65230 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3762 331 3e-93 >Contig3762 Length = 261 Score = 331 bits (848), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 160/234 (68%), Positives = 180/234 (76%), Gaps = 10/234 (4%) Query: 29 QDFDLTWGDNRAKIFNGGQLLSLSLDQASGSGFQSKKEYLFGRIDMQLKLVAGNSAGTVT 88 QDFD+TWGD RAKI N QLL+L+LD+ SGSGF+S+ +YLFG+IDMQ+KLV GNSAGTVT Sbjct: 26 QDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKSRNQYLFGKIDMQIKLVPGNSAGTVT 85 Query: 89 AYYLSSQGSTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFHTYSI 148 +YYLSS GS HDEIDFEFLGNLSGDPY LHTNVFTQGKGNREQQFYLWFDPT++FHTYSI Sbjct: 86 SYYLSSLGSAHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQQFYLWFDPTKDFHTYSI 145 Query: 149 IWTARHIIFLVDNVPIRLFKNAESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWSK 208 +W + IIF VD PIR FKN ES G+PFPKNQ M IYSSLWNADDWATRGGLVKTDWSK Sbjct: 146 LWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAMWIYSSLWNADDWATRGGLVKTDWSK 205 Query: 209 APFTAYYRNFRANX----------XXXXXXXXXXXXXXXELDSYSRRRLRWVQK 252 APFTA YRNF A LD+ + R++WVQ+ Sbjct: 206 APFTASYRNFNAQACIWSSGSSSCSSSPSGSSKEAWFTQSLDATGKGRMKWVQR 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37201 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21621 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36319 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77980463 210 7e-57 >77980463 Length = 260 Score = 210 bits (534), Expect = 7e-57, Method: Compositional matrix adjust. Identities = 109/257 (42%), Positives = 155/257 (60%), Gaps = 9/257 (3%) Query: 1 MLVGDGKGKTVIVGHKSYAGGSSTYDSATVGVMGDGFIARDITIVNDAGPGKGQAVALRV 60 M +GDG KT I G K++A G+ + +ATV V+GD FIA+D+ N AG QA+ALRV Sbjct: 5 MFIGDGPTKTKITGDKNFADGTHPFRTATVVVIGDYFIAKDMGFENSAGAKGHQAMALRV 64 Query: 61 GSDRSVVFRCSIIGYQDTLYTLSKRQFYRETDIYGTVDFIFGNSAVVFQSCNLNARKNSN 120 SD+S+ + C + GYQ+TL+T + RQFYR+ I G VD IFG++AVVFQ+C + RK Sbjct: 65 QSDQSIFYNCQMDGYQNTLFTQTYRQFYRDCTISGAVDIIFGDAAVVFQNCKMIIRKPEG 124 Query: 121 NN--FVTAQGREDPNQNTGISIHNCKITTE----GSTTYLGRPWKKYSRTVIMQSYLGGS 174 ++ VTAQ R D Q T I N I+ + T +LGRP YSRTV+MQS + Sbjct: 125 DDKATVTAQERSDKRQPTAIVFQNSTISADKEYKDKTAFLGRPAHTYSRTVVMQSQIDDV 184 Query: 175 IPPSGWYPWSGSFALSTLFYGEYMNGGPGASTSGRVKWGGYQGELTASEAQEFTVGEFIS 234 I P GW PW+G ++GE+ N G G++T+ RV W + +A EF+ + Sbjct: 185 ISPEGWTPWTGQSNTEECWFGEFSNRGSGSATNKRVSWFKM---VARDQADEFSASSLLF 241 Query: 235 GNAWLPSTGVSFDSGLI 251 G W+ +GV +++GL+ Sbjct: 242 GENWIKPSGVPYEAGLM 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24025 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5225 64 3e-13 >Contig5225 Length = 321 Score = 64.3 bits (155), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Query: 110 YKPSTDLATGLRRFVKWYVSYYGIQTRVKKETLK--RSDQLEES 151 YKP+TDLA+GLR+FVKWYVSYYGI++RVK E+ K S Q EES Sbjct: 277 YKPTTDLASGLRKFVKWYVSYYGIESRVKTESKKMMMSQQPEES 320 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32139 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35079 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2204 462 e-133 >Contig2204 Length = 342 Score = 462 bits (1190), Expect = e-133, Method: Compositional matrix adjust. Identities = 218/262 (83%), Positives = 240/262 (91%) Query: 6 EVELASKFGIIYADGKRDVRGDPAYVRAACEASLKRLEVDCIDLYYQHRIDTRVPIEVTI 65 +VELA+KFGI +AD KR+VRGDPAYVRAACEASLKRL ++CIDLYYQHRIDTR+PIEVT+ Sbjct: 80 KVELATKFGISFADNKREVRGDPAYVRAACEASLKRLGLNCIDLYYQHRIDTRLPIEVTV 139 Query: 66 GELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELG 125 GELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLW+RDVEE+I+PTCRELG Sbjct: 140 GELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELG 199 Query: 126 IGIVAYSPLGRGFFSSGTKLVENLSNNDFRKNLPRFQPENLGHNKILYERVSEIATRKGC 185 IGIVAYSPLGRGF SSG K VENL+N+DFRK LPRFQ ENL HNK ++ERVS++ATRKGC Sbjct: 200 IGIVAYSPLGRGFLSSGAKFVENLANDDFRKFLPRFQGENLEHNKSIFERVSDLATRKGC 259 Query: 186 TPSQLALAWVHHQGNDVCPIPGTTKIENLKQNIGALSVKLTPEETAELESIASADGVKGD 245 T SQLALAWVHHQGNDVCPIPGTTKIEN QNIGALSVKLTPEE AELES A+AD VKGD Sbjct: 260 TSSQLALAWVHHQGNDVCPIPGTTKIENFNQNIGALSVKLTPEEKAELESFATADAVKGD 319 Query: 246 RYESTAFTWKTAHTPPLDSWKA 267 RY++ TWK + TPPL SWK+ Sbjct: 320 RYQNDFSTWKNSETPPLSSWKS 341 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv91 (337 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23428 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28566264 (336 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34229 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52489 (331 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33766 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21066261 (516 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52807 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36576 (514 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16354 (432 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12724 (298 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 96 4e-22 >158372667 Length = 230 Score = 95.5 bits (236), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 72/217 (33%), Positives = 102/217 (47%), Gaps = 18/217 (8%) Query: 72 RKLGAEFVGTFILIFAATAGPIVNQKYSGVETLIG--NAACAGLAVMIVILSTGHISGAH 129 R L EFV TF+ IFA + K G +T + A V+ V++S GHISG H Sbjct: 19 RALIVEFVTTFLFIFAGVGSAMATDKL-GADTTVALFFIAITHALVVAVMISAGHISGGH 77 Query: 130 LNPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKAVFHPFMSGGVTVP------S 183 LNP++T+ A H + Y Q+ A+ + + LK +++GG+T P Sbjct: 78 LNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLK-----YLTGGLTTPIHSLASG 132 Query: 184 VSIGQAFALEFLITFNLLFXXXXXXXXXXXXGELAGIA---VGATVMLNILVAGPSSGGS 240 V Q E ++TF+LLF G L G+ G V NIL G SG S Sbjct: 133 VGFSQGVIWEIILTFSLLFTVYATMVDPKK-GSLDGLGPTLTGFVVGANILAGGAFSGAS 191 Query: 241 MNPVRTLGPAVAAGNYRAIWIYLVAPTLGAVAGAAIY 277 MNP R+ GPA+ + ++ W+Y V P +G IY Sbjct: 192 MNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIY 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26150 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44338 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4666256 (369 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3467 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 92 3e-21 >158372667 Length = 230 Score = 91.7 bits (226), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 62/180 (34%), Positives = 92/180 (51%), Gaps = 13/180 (7%) Query: 39 MIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAIFYIIMQCLGAICGAGVVKGFEGS 98 ++ A++ ISGGH+NPAVT GLL ++L R++ Y I Q L A ++K G Sbjct: 62 LVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLKYLTGG 121 Query: 99 QSYEVLGGGANVVNSGYTKGDGLGAEIVGTFVLVYTVFSA-TDAKRNARDSHVPILAPLP 157 + + + + SG G+ EI+ TF L++TV++ D K+ + D L P Sbjct: 122 LTTPI-----HSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDG----LGPTL 172 Query: 158 IGFAVFLVHLATIPITGTGINPARSLGAAIIFNREHAWDDMWIFWVGPFIGAALAAMYQQ 217 GF V LA +G +NPARS G A++ W D W++WVGP IG LA + Sbjct: 173 TGFVVGANILAGGAFSGASMNPARSFGPALV---SWDWTDHWVYWVGPLIGGGLAGFIYE 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv273 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61701 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig198 96 5e-23 >Contig198 Length = 160 Score = 95.5 bits (236), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 47/92 (51%), Positives = 64/92 (69%), Gaps = 1/92 (1%) Query: 1 MTHRVDAIDKEKFSFCYTVIDGDVLTDGVESICHELTVVPAPGGGSIYKNTSKYHTKG-A 59 + H++ +IDKE ++ Y++I+GD L+D +E I +E +V AP GG++ K TSKYHTKG Sbjct: 68 VKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHTKGDV 127 Query: 60 EVCEEHVKGGKEDALATFKAIEGYVLAHPDGY 91 E+ EEHVK GKE A FK IEGY+ HP Y Sbjct: 128 EIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17363 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17305 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5117 (304 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10510 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31695 (388 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14550 (68 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14766260 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2098 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45298 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13235 (522 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14277 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40892 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21866262 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31766264 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31166264 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31266263 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61660 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17266259 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52645 (464 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38923 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57457 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3484 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11600 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8908 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18590 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29575 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89555746 103 3e-25 >89555746 Length = 130 Score = 103 bits (258), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 51/93 (54%), Positives = 67/93 (72%), Gaps = 1/93 (1%) Query: 15 NYGQIANNLPSPDDVVPLVRSIGASRVKLYDADPKVLRAFANTGVEFIVGLGNEYLSKMR 74 NYG+IA+N+PSPD V L+R+ V++YDAD VL+AF+ TG++ +VGL N Y+ M Sbjct: 35 NYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTGLDLVVGLPNGYVKDMS 94 Query: 75 -DPDKALAWVKANVQAHLPDTNITCITVGNEIL 106 + D AL WVK NVQA LPDT+I I VGNE+L Sbjct: 95 ANQDHALDWVKENVQAFLPDTHIRGIAVGNEVL 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30088 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14266263 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61491 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30966264 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158362365 184 3e-49 >158362365 Length = 156 Score = 184 bits (466), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 86/96 (89%), Positives = 90/96 (93%) Query: 70 PNTPSPIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYP 129 P + IMR+GPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYP Sbjct: 61 PTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYP 120 Query: 130 EKVNPGRQGVGVNFRSIGKNVNPIEVKFTGKQAYDL 165 EKVNPGRQGVG NFRSIGKNV+PIEVKFTGKQ YD+ Sbjct: 121 EKVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQVYDI 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47574 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4398 177 5e-47 >Contig4398 Length = 192 Score = 177 bits (448), Expect = 5e-47, Method: Compositional matrix adjust. Identities = 84/171 (49%), Positives = 112/171 (65%), Gaps = 17/171 (9%) Query: 25 DDYHSFVHGRLPYELIKPDSQLRSLLRSIALRKIILTNSDRNHAIKVLDRLGLQDCFDQI 84 DD+HSFVHGRLPY L+KPD LR LL S+ +RK+I TNSD+NH I VL RLG++DCF+ I Sbjct: 1 DDFHSFVHGRLPYNLLKPDHVLRGLLLSLPVRKVIFTNSDKNHTITVLKRLGIEDCFESI 60 Query: 85 ICFETMNPNLPKSTRLD----EF-------------PVILNPSLDAMKIALDAANVNPPR 127 ICFET+NP D +F PVI P +A A AN+NP R Sbjct: 61 ICFETLNPTNSADGSADAEETDFVQQPNTDAVTPRSPVICKPFENAYVEAFKIANINPQR 120 Query: 128 TLFLDDNVRNIAAGKALGLRTVLVGKTMKTKEADYVLETVHNLAQVIPEIW 178 TLF DD++RN+ K +GL+TV VG + +TK+ D+ LE++HN+ + +PE+W Sbjct: 121 TLFFDDSIRNLETAKQVGLQTVWVGTSHRTKDVDHALESIHNMREALPELW 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27366263 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11258 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57770 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8254 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13666262 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21866260 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22666258 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31266265 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33910 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77981379 93 1e-21 >77981379 Length = 204 Score = 92.8 bits (229), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 58/130 (44%), Positives = 75/130 (57%), Gaps = 12/130 (9%) Query: 21 VSKTAENFLALCA-------SG---YYDGTIFHRNIKGFMIQXXX-XXXXXXXXXSIWGK 69 V KTAENF ALC SG +Y G+ FHR I FM+Q SI+G+ Sbjct: 60 VPKTAENFRALCTGEKGIGKSGKPLHYKGSKFHRIIPSFMLQGGDFTLGDGRGGESIYGE 119 Query: 70 KFNDEIRESLKHNARGILSMANSGPNTNGSQFFITYAKQPHLNGLYTVFGRVIHGFEVLD 129 KF DE LKH G+LSMAN+GP+TNGSQFFIT L+G + VFG+V+ G +V+ Sbjct: 120 KFADE-NFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTTWLDGRHVVFGKVLSGMDVVY 178 Query: 130 IMEKTQTGAG 139 +E + +G Sbjct: 179 KVEAEGSQSG 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55468 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49783 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59326 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58826 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29881 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4871 112 1e-27 >Contig4871 Length = 585 Score = 112 bits (279), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 62/129 (48%), Positives = 85/129 (65%), Gaps = 1/129 (0%) Query: 1 LRVEDALNATKAAXXXXXXXXXXCTLLRLASKVDAIKDTLDNGEEKVGADIVKRALSYPL 60 LR+EDA NAT AA L+ L++ V AIKD L++ +EK+GADIV++AL P Sbjct: 437 LRIEDAKNATFAAIEEGIVPGGGAALVHLSTCVPAIKDKLEDADEKLGADIVQKALVAPA 496 Query: 61 KLIAKNAGVNGSVVSEKVLSSDNPKYGFNAATGKYEDLMAAGIIDPTKVVRCCLEHASSV 120 LIA+NAG+ G VV EK+ S+ + G+NA T YE+L+ AG+IDP KV RC L++A+SV Sbjct: 497 ALIAQNAGIEGEVVVEKLKESE-WEVGYNAMTDTYENLVDAGVIDPAKVTRCALQNAASV 555 Query: 121 AKTFLMSDC 129 A L + Sbjct: 556 AGMVLTTQA 564 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25941 (117 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14651 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig119 372 e-105 >Contig119 Length = 300 Score = 372 bits (955), Expect = e-105, Method: Compositional matrix adjust. Identities = 178/229 (77%), Positives = 199/229 (86%) Query: 1 MPQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE 60 + QI S++I+GD+VLASAYSHELP YGL VGLTNYAA+YCTGLLLARR LK LEMD EYE Sbjct: 61 VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE 120 Query: 61 GNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFXXXXXXXXXXXXIPHSDKRFA 120 GN+EATGED+SVEP +SRRPFRALLDVGLVRTTTGNRVF +PHS+KRFA Sbjct: 121 GNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFA 180 Query: 121 GFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYK 180 GFSKDSK LDAE HRKYIYGGHV+AYMGTLIEDEPEKYQ+HFSEYIKKG+E + IEE+YK Sbjct: 181 GFSKDSKSLDAETHRKYIYGGHVAAYMGTLIEDEPEKYQTHFSEYIKKGIEAEGIEELYK 240 Query: 181 KVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS 229 KVHAAIRA+P++KK K PK+HKR+NLKKLTYEERK KLIERLNA NS Sbjct: 241 KVHAAIRADPLEKKTAKPEPKQHKRFNLKKLTYEERKNKLIERLNAFNS 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20866257 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10885 (306 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21879 (355 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 117 9e-29 >Contig4694 Length = 351 Score = 117 bits (293), Expect = 9e-29, Method: Compositional matrix adjust. Identities = 77/281 (27%), Positives = 126/281 (44%), Gaps = 26/281 (9%) Query: 45 EGPQVPTIDLKDIXXXXXXXXXXXXXXLKK----AAMEWGVMHLVNHGISDDLINRVKVA 100 E VP IDL + L + A WG ++NHG+ ++ +V+ Sbjct: 22 EADGVPLIDLSPLTSADSISDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETT 81 Query: 101 GETFFNLPMEEKEKYANDQASGKIAGYGSKLANNASGQLEWEDYFFHLIF---------- 150 FF P+EEK K D+ + GY + +W++ + L+ Sbjct: 82 ARKFFAQPLEEKRKIRRDEKC--VVGYYD--TEHTKNVRDWKEVYDFLVEEPTLVPSSTE 137 Query: 151 PEDKRD---MTIWPKTPSDYVPATCEYSVKLRSLATKIXXXXXXXXXXXXXXXXXXXXXM 207 P+DK + WP+ P + +YS ++ L+ K+ Sbjct: 138 PDDKEETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQ 197 Query: 208 EELLLQKKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFY--EGKWVTAKCV 265 + ++N+YP CP PELALGV H D ALT + + V GL++ +G+W+ + Sbjct: 198 TSFI---RLNHYPPCPSPELALGVGRHKDGGALTVLAQDEVGGLEVKRKTDGEWIRVRPT 254 Query: 266 PNSIIMHIGDTIEILSNGKYKSILHRGLVNKEKVRISWAVF 306 PN+ I+++GD I++ SN +Y+S+ HR +VN EK R S F Sbjct: 255 PNAYIINVGDVIQVWSNDEYESVEHRVMVNSEKERFSVLFF 295 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48314 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34770 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5788 200 4e-54 >Contig5788 Length = 224 Score = 200 bits (509), Expect = 4e-54, Method: Compositional matrix adjust. Identities = 117/210 (55%), Positives = 145/210 (69%), Gaps = 28/210 (13%) Query: 15 LFTKLVSPIR----VASASRSFNTNAQVADYNDGEDRR-----TVSRP--RYSPSNLFSD 63 LF+KL +P+R S SRSFNTNAQ + Y+D + T P R P D Sbjct: 18 LFSKLFNPLRSVSVAPSVSRSFNTNAQRSSYDDDDRSVSVDRSTSGSPYRRRDPI----D 73 Query: 64 VFDPF---SRT---------RSLSQVLNLMDQFMENPLVAASRGMGAV-SRRGWDVKEEK 110 VFDPF SR+ RSLSQVLNLMDQFMENP +AA RG+GA SRRGWDVKE + Sbjct: 74 VFDPFYDESRSIARSLNQVPRSLSQVLNLMDQFMENPYLAAYRGLGAGGSRRGWDVKETE 133 Query: 111 DALFVRMDMPGLGKEDVKVSVEQNTLIIKGEGGKELENDETGRKYTSRIDLPANLYKFDE 170 D+L +RMDMPGL KEDVK+SVEQ TL +KGEG ++ GR++++R+DLPA +Y+ + Sbjct: 134 DSLLLRMDMPGLNKEDVKISVEQGTLTVKGEGKDPEGEEDGGRRFSTRLDLPAKIYELNS 193 Query: 171 IKAEMKNGVLKVVVPKVKEDGKKDAFQVNI 200 IKAEMKNGVLK+VVPKVKE+ KK+ F+V I Sbjct: 194 IKAEMKNGVLKLVVPKVKEEEKKNVFEVKI 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45203 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29966 (256 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5193 223 6e-61 >Contig5193 Length = 545 Score = 223 bits (569), Expect = 6e-61, Method: Compositional matrix adjust. Identities = 109/220 (49%), Positives = 151/220 (68%), Gaps = 2/220 (0%) Query: 1 MNQARSIRWNVSASGARPNPQGSFRYGSINVTDVYVLKNKPPVTIDGKMRTTLSGISFVN 60 +NQARSIR N++ASG RPNPQGS+ YG IN+T Y+L + ++GK R ++ +SFV Sbjct: 320 LNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYILASAAG-QVNGKQRYGINSVSFVP 378 Query: 61 PTTPIRLADQFKVKGVYKL-DFPKTPLTGSPRMETSVINGTYRGFMEVILQNNDTKMQSY 119 TP++LAD FK+ GV+++ P G+ ++TSV+ YR F+E++ QN++ +QSY Sbjct: 379 ADTPLKLADYFKISGVFRVGSVSDRPTGGNLYLDTSVLGADYRTFVEIVFQNDEDIVQSY 438 Query: 120 HMNGYAFFVVGMDYGEWTENSRGTYNKWDGIARSTTQVFPGAWTAILISLDNVGVWNLRA 179 H++GY FFVVGMD G+WT SR YN D +ARSTTQV+P +WTAI +SLDNVG+WNLR Sbjct: 439 HLDGYQFFVVGMDGGKWTTASRNGYNLRDAVARSTTQVYPFSWTAIYLSLDNVGMWNLRT 498 Query: 180 ENLDSWHLGQETYVRVVNPEATNKTELPMPDNALFCGALS 219 E +LGQ+ Y+RV + + E P+P NA CG S Sbjct: 499 EFWARQYLGQQLYLRVYTSSTSIRDEYPIPRNARLCGRAS 538 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51062 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18416 (340 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59103 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24317 (608 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10347 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24788 (318 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66003 (440 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11566258 (537 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3715 120 2e-29 >Contig3715 Length = 362 Score = 120 bits (300), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 2/79 (2%) Query: 136 QTRKPYTITKQRERWTEEEHNRFLEALKLYGRAWQRIEEHIGTKTAVQIRSHAQKFFSKL 195 + RKPYTITKQRE+WTEEEH +FLEALKLYGR W++IEEH+GTKTAVQIRSHAQKFFSK+ Sbjct: 49 KVRKPYTITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKV 108 Query: 196 EKEALVKGVPIGQAIDIEI 214 KE + G G IEI Sbjct: 109 AKE--LPGTGEGSLKPIEI 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28035 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6753 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv318 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30007 (8 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17326 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3309 (273 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2099 195 3e-52 >Contig2099 Length = 263 Score = 195 bits (495), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 110/219 (50%), Positives = 136/219 (62%), Gaps = 9/219 (4%) Query: 45 VSPADEELAKWYGPDRRIFLPEGLLDRSEIPAYLTGEVPGDYGYDPFGLSKKPEDFAKYQ 104 V A + WYGPDR +L E P+YLTGE PGDYG+D GLS PE FAK + Sbjct: 37 VGKAVSSGSPWYGPDRVKYLGP---FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNR 93 Query: 105 AYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPIN- 163 E+IH+RWAMLGA G + PE + G G EAVWFK GA + L+Y G ++ Sbjct: 94 ELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHA 152 Query: 164 --LIFXXXXXXXXXXXXXYYRIINGL--DLEDKLHPGGPFDPLGLANDPDQAALLKVKEI 219 ++ YRI G ++ED L+PGG FDPLGLA+DP+ A LKVKE+ Sbjct: 153 QSILAIWATQVVLMGAVEGYRIAGGPLGEVEDPLYPGGSFDPLGLADDPEAFAELKVKEL 212 Query: 220 KNGRLAMFAMLGFFIQAYVTGEGPVENLAAHLSDPFGNN 258 KNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP NN Sbjct: 213 KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54730 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54691 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59349 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4621 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36823 (337 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41756 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3999 198 2e-53 >Contig3999 Length = 397 Score = 198 bits (503), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 100/178 (56%), Positives = 120/178 (67%), Gaps = 1/178 (0%) Query: 5 KGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEGNRRALRELLFCTPG 64 + Y DEL+ A + +PG+GILA DES T GKRLASI +EN E NR+A R LL PG Sbjct: 47 RASYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTVPG 106 Query: 65 ALQYLSGVILFEETLYQKTASGKPFVDVMKEGGVLPGIKVDKGTVVLTGTDGETTTQGLD 124 Y+SG ILFEETLYQ T GK VDV+ E ++PGIKVDKG V L G++ E+ QGLD Sbjct: 107 LGNYVSGAILFEETLYQSTVDGKKIVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLD 166 Query: 125 GLGERWAKYYAAGARFAKWRAVLKIGPTEPSELAIHENAYGLARYAMICPEMALSPLL 182 GL R A YY GARFAKWR V+ I P PS LA+ E A+GLARYA I + L P++ Sbjct: 167 GLASRTAAYYQQGARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAISQDSGLVPIV 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19566262 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14466256 (321 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48995 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 150 5e-39 >Contig1666 Length = 421 Score = 150 bits (380), Expect = 5e-39, Method: Compositional matrix adjust. Identities = 83/172 (48%), Positives = 105/172 (61%), Gaps = 16/172 (9%) Query: 14 LPPGFRFHPTDEELVVQYLKRKAYSCPLPASIIPEVDVCKADPWDLPG-----DLEQERY 68 L PGFRFHPTDEELV YLKRK I VD+ K +PWDLPG + E Y Sbjct: 9 LAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLKSRDTEWY 68 Query: 69 FFSTREAKYPNGNRSNRATVSGYWKATGIDKQIVASKGNQVVGMKKTLVFYRGKPPHGSR 128 FFS + KY N +R+NRAT GYWK TG D+ + S ++ VGMKKTLVF+ G+ P G+R Sbjct: 69 FFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHS--SRAVGMKKTLVFHSGRAPKGAR 126 Query: 129 TDWIMHEYRLVGAETTPQRKSSTTQSSMAQAENWVLCRIFLKK-RGTKNDEE 179 T+W+MHEYRL E ++ + + + +VLCRIF K G KN E+ Sbjct: 127 TNWVMHEYRLDNQE--------LEKAGIVEKDAYVLCRIFQKSGTGPKNGEQ 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54266 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62107 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22814 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11397 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16567 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33921 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40396 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv511 (309 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32044 (601 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32531 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12766262 (668 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20757 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34244 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55636 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12663 (314 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50868 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44349 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56723 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5751 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17283 (403 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2603 680 0.0 >Contig2603 Length = 401 Score = 680 bits (1755), Expect = 0.0, Method: Compositional matrix adjust. Identities = 349/402 (86%), Positives = 367/402 (91%), Gaps = 5/402 (1%) Query: 6 MALVKPISKF-STSTP---NPRAPYSKVFRISMSATSQPSTGKRPSKKAAKTAIKETLLT 61 MALVKP++ F + +TP N R+ S + +M S S+ + K A K AIKETLL Sbjct: 1 MALVKPMTNFGNVTTPKFGNTRSSSSGKWS-TMIRMSSSSSTTKKGKGAPKKAIKETLLA 59 Query: 62 PRFYTTDFDEMETLFNTEINKNLNQTEFEALLQEFKTDYNQTHFVRNKEFKEAADKIQGP 121 PRFYTTDFDEMETLFNTEIN NLNQ EFEALLQEFKTDYNQTHFVRNKEFKEAAD +QGP Sbjct: 60 PRFYTTDFDEMETLFNTEINNNLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADNLQGP 119 Query: 122 LRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLS 181 LRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLS Sbjct: 120 LRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLS 179 Query: 182 DFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKENPEYQLYPIFK 241 DFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLK NPEYQ YPIFK Sbjct: 180 DFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKANPEYQCYPIFK 239 Query: 242 YFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLNDCQRTDFYEG 301 YFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLW RFFCLSVYVTMYLNDCQRT FYEG Sbjct: 240 YFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWCRFFCLSVYVTMYLNDCQRTAFYEG 299 Query: 302 IGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINQQLIAVGESDDIPV 361 IGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINQ+LIAVGESDDIP+ Sbjct: 300 IGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINQKLIAVGESDDIPL 359 Query: 362 VKNLKKIPLIAGLASEILAAYLMPPVESGSVDFAEFEPQLVY 403 VKNL +IP++A LASE+LAAYLMPP+ESGSVDFAEFEPQ+VY Sbjct: 360 VKNLNRIPIVAALASELLAAYLMPPIESGSVDFAEFEPQVVY 401 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26959 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23746 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 103 6e-25 >Contig1161 Length = 148 Score = 103 bits (258), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 52/144 (36%), Positives = 80/144 (55%) Query: 13 KQLAKELKNLDETPPEGIKVVVNDDDFSTIFADVEGPAGTPYENGVFRMKLLLSHDFPHS 72 K++ KELK+L + PP +D A + GP +PY GVF + + D+P Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFK 63 Query: 73 PPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLIEPFPESALNEQA 132 PPK F TK+FHPNI +NG IC++ LK+ W+P+L + VL+ + LL +P P+ L + Sbjct: 64 PPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 123 Query: 133 GKMLLENYEEYARHARIYTGIHAL 156 M + +Y AR +T +A+ Sbjct: 124 AHMYKTDRSKYETTARSWTQKYAM 147 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46022 (288 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 82 4e-18 >89540794 Length = 177 Score = 81.6 bits (200), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 38/77 (49%), Positives = 57/77 (74%) Query: 205 RIYVGNLSWGVDDLALETLFSEQGKVTEARVIYDRETGRSRGFGFVTYNSAEEVNRAIES 264 R +VG L+W D+ ALE F+ G++ E+++I DRETGRSRGFGFVT+++ + + AIE Sbjct: 9 RCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEKAMRDAIEG 68 Query: 265 LDGVDLNGRSIRVTMAE 281 ++G DL+GR+I V A+ Sbjct: 69 MNGQDLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16682 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5689 (447 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4544 897 0.0 >Contig4544 Length = 447 Score = 897 bits (2317), Expect = 0.0, Method: Compositional matrix adjust. Identities = 432/447 (96%), Positives = 441/447 (98%) Query: 1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDAT+PKYSK+RYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIHEPKRPSDKPLRLPLQD 240 +GYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI+EPKRPSDKPLRLPLQD Sbjct: 181 IGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHESLVEGLPGDNVGFNV 300 VYKIGGIGTVPVGRVETGIIKPGMVVTF P+GLTTEVKSVEMHHE+L E LPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRG+VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 AEITTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 EI TKIDRRSGKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 GEILTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKSVEKKDPSGAKVTKSAAKKK 447 VAVGVIK+VEKKDPSGAKVTKSAAKKK Sbjct: 421 VAVGVIKAVEKKDPSGAKVTKSAAKKK 447 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17848 (307 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61068 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56585 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61022 (296 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65006 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25533 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35266258 (339 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3406 266 1e-73 >Contig3406 Length = 450 Score = 266 bits (679), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 155/339 (45%), Positives = 217/339 (64%), Gaps = 9/339 (2%) Query: 6 KIKIGINGFGRIGRLVARV--ALQSNDVELVAVNDPFITTDYMTYMFKYDSVHGHWKHHD 63 K+K+ INGFGRIGR R + + +E++ VND + +++ KYDS+ G +K D Sbjct: 83 KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKN-ASHLLKYDSMLGTFKA-D 140 Query: 64 VKVKDSKTLLFGEKSVTVFGVRNPEEIPWAETGADYVVESTGVFTXXXXXXXXXXXXXXX 123 +K+ D++T+ K + V R+P ++PWAE G D V+E TGVF Sbjct: 141 IKIVDNETISVDGKPIKVVSNRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKHIQAGAKK 200 Query: 124 VIISAPSK--DAPMFVMGVNEKEYKPDI-DIVSNASCTTNCLAPLAKVINDRFGIVEGLM 180 VII+AP+K D P +V+GVNEK+Y + DIVSNASCTTNCLAP KV+++ FGIV+G M Sbjct: 201 VIITAPAKGADIPTYVVGVNEKDYGHSVADIVSNASCTTNCLAPFVKVLDEEFGIVKGTM 260 Query: 181 TTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRV 240 TT H+ T Q+ +D S +D R RAA+ NI+P+STGAAKAV VLP L GKL G++ RV Sbjct: 261 TTTHSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV 319 Query: 241 PTVDVSVVDLTVRLEKSA-TYDEVKAAIKEESEGKLKGILGYTEDDVVSTDFIGDSRSSI 299 PT +VSVVDL + + K T ++V A ++ ++G LKGIL + +VS DF SS Sbjct: 320 PTPNVSVVDLVINVAKKGITAEDVNGAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSST 379 Query: 300 FDAKAGIALNANFLKLVSWYDNEWGYSSRVIDLIRHMAS 338 D+ + + + +K+V+WYDNEWGYS RV+DL +AS Sbjct: 380 IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAS 418 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34696 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1033 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20220 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31684 (312 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32143 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43458 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5896 249 7e-69 >Contig5896 Length = 167 Score = 249 bits (635), Expect = 7e-69, Method: Compositional matrix adjust. Identities = 125/166 (75%), Positives = 140/166 (84%) Query: 3 STTQACLLLQKQLRDLCKRPVDGFSAGLVDESNVFEWSVSIIGPPDTLYDGGFFNAIMSF 62 + +QA LLLQKQL+DLCK PVDGFSAGLVDE+N+FEWSV+IIGPPDTLY+GGFFNAIMSF Sbjct: 2 AASQASLLLQKQLKDLCKNPVDGFSAGLVDENNIFEWSVTIIGPPDTLYEGGFFNAIMSF 61 Query: 63 XXXXXXXXXXVRFTSDMWHPNVYPDGRVCISILHPPGEDPNGYELASERWTPVHTVEXXX 122 V+FTS++WHPNVYPDGRVCISILHPPG+DPNGYELASERWTPVHTVE Sbjct: 62 PSNYPNSPPTVKFTSELWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVESIV 121 Query: 123 XXXXXXXXXPNDESPANIEAAKEWREKRDEFKKKVSRCVRKSQEML 168 PNDESPAN+EAAKEWR++RD+FKKKV RCVRKSQEML Sbjct: 122 LSIISMLSSPNDESPANVEAAKEWRDRRDDFKKKVGRCVRKSQEML 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28772 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6978 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19272 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49699 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28507 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12502 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3203 133 1e-33 >Contig3203 Length = 204 Score = 133 bits (334), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 65/93 (69%), Positives = 76/93 (81%), Gaps = 4/93 (4%) Query: 76 DFEGCF----HRPEKKRRLTAGQVQFLERNFEVENKLEPERKNQLAKELGLQPRQVAIWF 131 D EGC H EKKRRL+ QV+ LE+NFEVENKLEPERK +LA+ELGLQPRQVA+WF Sbjct: 45 DEEGCVEESGHVAEKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWF 104 Query: 132 QNRRARFKTKQLEKDYDSLKASYDSLKADYDCI 164 QNRRAR+KTKQLE+DY LKA+YDSLK +D + Sbjct: 105 QNRRARWKTKQLERDYGVLKANYDSLKISFDSL 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16856 (370 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21187 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16315 (306 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59233 (448 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53882 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66069 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30334 (435 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 88 1e-19 >89552756 Length = 189 Score = 87.8 bits (216), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 63/188 (33%), Positives = 93/188 (49%), Gaps = 16/188 (8%) Query: 240 GDLHQYLKEKG-SLSPSTAITFAMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNTGADH- 297 G L Q+L++K ++ + AMD A GM YLH + I+H DLK N LLVN Sbjct: 4 GSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKN--IVHFDLKCEN-LLVNMRDPQR 60 Query: 298 --LKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRKY--DKKVDVFSFAMIL 353 K+GD GLSK+ G G+ +MAPE+ + + +K+DV+SF +++ Sbjct: 61 PVCKIGDLGLSKV-----KQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVM 115 Query: 354 YEMLEGDPPLSNYEPYE-AAKYVAEGQRPMFRAKGYITELKELTEQCWAADMNHRPSFLE 412 +E+L GD P ++ V RP E K L E CW ++ RPSF E Sbjct: 116 WELLTGDEPYTDMHCASIIGGIVNNTLRPQI-PTWCDPEWKSLMESCWGSEPAQRPSFSE 174 Query: 413 ILKRLEKI 420 I ++L + Sbjct: 175 ISQKLRNM 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16895 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35116 (336 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2549 474 e-136 >Contig2549 Length = 341 Score = 474 bits (1220), Expect = e-136, Method: Compositional matrix adjust. Identities = 226/306 (73%), Positives = 250/306 (81%), Gaps = 6/306 (1%) Query: 1 MAPGVPADVFTAGGKVSTLNAGYSKGAYVTFLAGNGDYVKGVVGLAKGLRKVKSAYPLVV 60 + P VP TA + +TL + AYVTFLAGNGDYVKGVVGLAKGLRKV +AYPLVV Sbjct: 5 LVPAVPKS--TALTRPATL----PRRAYVTFLAGNGDYVKGVVGLAKGLRKVNTAYPLVV 58 Query: 61 AMLPDVPEEHREILKSQGCXXXXXXXXXXXXNQIQFAMAYYVINYSKLRIWNFEEYSKMV 120 A+LPDVPE+HR IL+SQGC NQ QFAMAYYVINYSKLRIW F EY KM+ Sbjct: 59 AVLPDVPEDHRRILESQGCIVREIEPVYPPENQTQFAMAYYVINYSKLRIWEFVEYDKMI 118 Query: 121 YLDADIQVYDNIDHLMDAPDGYFYAVMDCFCEKTWSHTPQYSVGYCQQCPDKVTWPAEMG 180 YLD DIQVYDNIDHL D PDG FYAVMDCFCEKTWSHTPQY +GYCQQCP++V W E+G Sbjct: 119 YLDGDIQVYDNIDHLFDLPDGNFYAVMDCFCEKTWSHTPQYKIGYCQQCPERVKWDFELG 178 Query: 181 SPPPLYFNAGMFVFEPSRLTYESLLHTLRITPPTAFAEQDFLNMFFQHMYKPIPLVYNLV 240 PP LYFNAGMFVFEPS LTY+ LL TLR+ P T FAEQDFLNM+F+ +YKPIP VYNLV Sbjct: 179 PPPSLYFNAGMFVFEPSVLTYQDLLKTLRVAPTTPFAEQDFLNMYFRDIYKPIPNVYNLV 238 Query: 241 LAMLWRHPENVELDQVKVVHYCAAGSKPWRYTGKEANMEREDIKMLVAKWWDIYNDKSLD 300 LAMLWRHPENV+L++VKVVHYCAAGSKPWRYTGKE NMEREDIKMLV KWW+IYND+SLD Sbjct: 239 LAMLWRHPENVQLEKVKVVHYCAAGSKPWRYTGKEENMEREDIKMLVQKWWEIYNDESLD 298 Query: 301 FKAEDS 306 +K S Sbjct: 299 YKKPQS 304 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17966258 (411 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65606 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35611 (383 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59005 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5666259 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11099 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5844 246 5e-68 >Contig5844 Length = 161 Score = 246 bits (628), Expect = 5e-68, Method: Compositional matrix adjust. Identities = 119/158 (75%), Positives = 136/158 (86%) Query: 1 MPGDRKIGVAMDFSSSSKLALQWAIDNLADKGDLLYIIHIKSSSGDESRDVLWTTHGSPL 60 M DR+IGVAMDFS SSK ALQWAIDNL DKGD L+IIHI ++ DESR+VLW GSPL Sbjct: 1 MVKDRRIGVAMDFSKSSKNALQWAIDNLVDKGDTLHIIHINNNKHDESRNVLWAKSGSPL 60 Query: 61 IPLTEFRQPEIMKKYGVKTDIEVLDTLDTASRQKEVKIVTKLYWGDARDKLCEAVEDLKL 120 IPL+EFR+ E+MKKYGV TD+EVLD LDT SRQKEV I+TK+YWGDAR+KL +AVEDLKL Sbjct: 61 IPLSEFRELEVMKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYWGDAREKLLQAVEDLKL 120 Query: 121 DSLVMGSRGLSTIRRILLGSVTNYVMTNATCPVTIVKD 158 DSLVMGSRGL T++RI+LGSV+NYVMT A PVTIVKD Sbjct: 121 DSLVMGSRGLGTLKRIVLGSVSNYVMTQAPIPVTIVKD 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57523 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34185 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48014 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26028 (531 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23825 (355 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8261 (113 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51672 (301 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3110 (348 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50427 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49875 (448 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65601 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10366265 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27828 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30991 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13648 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4985 475 e-136 >Contig4985 Length = 517 Score = 475 bits (1222), Expect = e-136, Method: Compositional matrix adjust. Identities = 240/300 (80%), Positives = 259/300 (86%), Gaps = 4/300 (1%) Query: 1 MDIEEEIRSLQLDSSEDNNGVVNPEAAKLEQIEESDKMDV--DLNNEAHKESQSVHVEPS 58 MDIEEEIRSLQLDS+EDN G VNPEAA L+ + DKM+ D E + + V+P Sbjct: 1 MDIEEEIRSLQLDSAEDN-GDVNPEAANLDVEKSDDKMEEGDDKMEEGDGKMEEDSVDPV 59 Query: 59 KVKEISAPEDIEGPEDAEGYKKRHLNVVFIGHVDAGKSTTGGQILFLSGQVDDRTIQKYE 118 E E E ++ E KKRHLNVVFIGHVDAGKSTTGGQILFLSGQVDDRTIQKYE Sbjct: 60 -AHEPKVKEKEEQHDEDEINKKRHLNVVFIGHVDAGKSTTGGQILFLSGQVDDRTIQKYE 118 Query: 119 KEAKDKSRESWYMAYIMDTNEEERVKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMI 178 KEAKDKSRESWYMAYIMDTNEEER+KGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMI Sbjct: 119 KEAKDKSRESWYMAYIMDTNEEERLKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMI 178 Query: 179 SGASQADIGVLVISARKGEFETGYERGGQTREHVQLAKTLGVSKLLVVVNKMDDPTVNWS 238 SGASQADIGVLVISARKGEFETGYERGGQTREHVQLAKTLGVSKLLVVVNKMDDPTVNWS Sbjct: 179 SGASQADIGVLVISARKGEFETGYERGGQTREHVQLAKTLGVSKLLVVVNKMDDPTVNWS 238 Query: 239 KERYDEIESKMIPFLRSSGYNVKKDVHFLPLSGLVGLNMXTRVDXSLCSWWNGPCLFEPL 298 KERYDEIESKM+PFL++SGYNVKKDV FLP+SGL+G NM TR++ +CSWW+GPCLFE L Sbjct: 239 KERYDEIESKMVPFLKTSGYNVKKDVQFLPISGLMGTNMKTRLNKEICSWWDGPCLFEAL 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37289 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5564 (54 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44816 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40410 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2468 192 1e-51 >Contig2468 Length = 191 Score = 192 bits (488), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 112/211 (53%), Positives = 140/211 (66%), Gaps = 25/211 (11%) Query: 1 MSLTIAGTAVARGGVGL----TTTSPSTHLPIRRHFLLPSLPFTVIXXXXXXXXXXXHIV 56 M+LTIA + GG +TT P T+L +RH L P L H+V Sbjct: 1 MALTIANSGTTNGGARALYRSSTTHPYTNLSSQRHVLFPRL----------SPRRTLHVV 50 Query: 57 FAKKLSSRTGRFDSKN-RRSGTTTKEGQQEQREEAKIKEIGSTENVGVAXXXXXXXXYFL 115 AK+ +SRTGR D+ N +RS TTTK+ +Q+QR A+I+ + + EN+ YFL Sbjct: 51 SAKRFTSRTGRLDNNNNKRSNTTTKDQEQDQRT-AEIESLAA-ENIDDG--------YFL 100 Query: 116 PELPGDKPDFWEGPQWDALGFFVQYLWAFGIVFALIACGIAVVTYNEGATDFKKTPVYQE 175 P+LPGD+PDFWEG QWD LGFFV+YLWAFG FALIA AV T+NEGATDFK+TP Y++ Sbjct: 101 PKLPGDEPDFWEGEQWDGLGFFVEYLWAFGFGFALIAAIAAVATFNEGATDFKETPTYKD 160 Query: 176 SVQSRDLLEEPETSNSDVFESNPTEEAPSLE 206 ++QSR+LLEEPE S DVFESNPTE APSLE Sbjct: 161 AIQSRELLEEPEGSGPDVFESNPTEVAPSLE 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25362 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47251 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61192 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1888 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45736 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42552 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4218 278 1e-77 >Contig4218 Length = 191 Score = 278 bits (712), Expect = 1e-77, Method: Compositional matrix adjust. Identities = 131/174 (75%), Positives = 148/174 (85%), Gaps = 4/174 (2%) Query: 4 FAGTTQKCKACEKTVYLVDELTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHF 63 FAGTTQKC AC+KTVYLVD+LTADN+++HKACFRCHHCKGTLKLSNY+SFEGVLYC+PHF Sbjct: 3 FAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF 62 Query: 64 DQLFKMTGSLDKSFEGAPKTV---RSVD-QGQTNSKVSSMFAGTQEKCVACKKTVYPIEK 119 DQLFK TGSLDKSFEG PK V R +D + SK S MF GT++KC CK TVYP EK Sbjct: 63 DQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAASKASGMFGGTRDKCFGCKNTVYPTEK 122 Query: 120 VGVDGTSYHKACFRCTHGGCTISPSNYIAHEHRLYCRHHHSQLFKEKGNFSQLD 173 V V+GT YHK CF+CTHGGCTISPSNYIAHE RLYC+HHH+QL +EKGN SQL+ Sbjct: 123 VTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIREKGNLSQLE 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58338 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666265 (378 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1866265 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv966258 (356 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4460 608 e-176 >Contig4460 Length = 431 Score = 608 bits (1569), Expect = e-176, Method: Compositional matrix adjust. Identities = 283/353 (80%), Positives = 316/353 (89%) Query: 4 LSDLINLNLSETTEKVIVEYIWVGGSGMDLRSKARTLSGPVSDPAKLPKWNYDGSSTGQA 63 + DL+NL+++ T+K+I EYIW+GGSG+D+RSK+RT+S PV P++LPKWNYDGSSTGQA Sbjct: 63 VEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQA 122 Query: 64 PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRCNAAKIFSHPDVAAEV 123 PG+DSEVILYPQAIFKDPFR GNNILV+CD+YTP GEPIPTNKR AA++FS+ V EV Sbjct: 123 PGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAQVFSNQKVIDEV 182 Query: 124 PWYGIEQEYTLLQKEVKWPIGWPVGGFPGPQGPYYCGIGADKAWGRDIVDAHYKACLYAG 183 PWYGIEQEYTLLQ VKWP+GWPVGG+PGPQGPYYCG GADK++GRDI DAHYKACLYAG Sbjct: 183 PWYGIEQEYTLLQSSVKWPLGWPVGGYPGPQGPYYCGAGADKSFGRDISDAHYKACLYAG 242 Query: 184 INISGINGEVMPGQWEYQVGPSVGISAGDELWVSRYILERITEIAGVVLSFDPKPIQGDW 243 INISG NGEVMPGQWEYQVGPSVGI AGD +W SRYILERITE AGVVLS DPKPI+GDW Sbjct: 243 INISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDW 302 Query: 244 NGAGAHTNYSTKSMRNDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINT 303 NGAG HTNYSTKSMR +GGFEVIKKAI L LRHKEHI+AYGEGNERRLTG HET +IN Sbjct: 303 NGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGLHETQNINK 362 Query: 304 FLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 356 F WGVANRGASIRVGRDTEK GKGY EDRRPASNMDPY VT+++AETTILW+P Sbjct: 363 FSWGVANRGASIRVGRDTEKEGKGYLEDRRPASNMDPYTVTALLAETTILWEP 415 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55845 (484 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39691 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550843 143 1e-36 >89550843 Length = 144 Score = 143 bits (360), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 64/77 (83%), Positives = 71/77 (92%) Query: 111 QAVWVWTVSLPVTIVNASGRDPSLQAADIIGWIMWSVGITIEASADQQKLSFKNSPENRG 170 +AVWVWTVSLPVT+VN+S + PSLQAAD IGWIMWSVG +EA+ADQQKL FKNSPENRG Sbjct: 26 EAVWVWTVSLPVTVVNSSNKTPSLQAADFIGWIMWSVGFLVEATADQQKLVFKNSPENRG 85 Query: 171 KWCNVGVWKYTRHPNYF 187 KWCNVG+WKYTRHPNYF Sbjct: 86 KWCNVGLWKYTRHPNYF 102 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37887 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 220 4e-60 >Contig3037 Length = 313 Score = 220 bits (560), Expect = 4e-60, Method: Compositional matrix adjust. Identities = 96/124 (77%), Positives = 113/124 (91%) Query: 2 RKPCCEKKDTNKGAWSKEEDQKLIDYIQKHGEGSWRSLPQAAGLLRCGKSCRLRWLNYLR 61 R PCCEK TNKGAW+KEEDQ+LIDYI+ HGEG WRSLP+ AGLLRCGKSCRLRW+NYLR Sbjct: 3 RSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLR 62 Query: 62 PDLKRGNFAEDEEDLIVKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLKRKLIRMGIN 121 PDLKRGNF E+E++LI+KLH+LLGN+WSLIAGRLPGRTDNE+KNYWN+H+KRKL+ G++ Sbjct: 63 PDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRGLD 122 Query: 122 PDKH 125 P H Sbjct: 123 PQTH 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2500 (455 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63497 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158370739 271 2e-75 >158370739 Length = 180 Score = 271 bits (692), Expect = 2e-75, Method: Compositional matrix adjust. Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 2/180 (1%) Query: 1 MASSMLSSATVATINRXTPDQANMVAPSTGLKSLSTFPGTRKANTDITSVASNGGRVRCM 60 MASSM+SSATVA++NR P QA+MVAP GLKS S FP TRKAN DIT++ASNGGRV+CM Sbjct: 1 MASSMMSSATVASVNR-APVQASMVAPFNGLKSASAFPVTRKAN-DITTLASNGGRVQCM 58 Query: 61 KVWPTEGVMKFETLSYLPPLNDEQLCKEVDYLLRMNWVPCLEFTKLYPYPHREHNRSPGY 120 +VWP G+ KFETLSYLPPL+ E L KEV+YLLR WVPCLEF + + +REH SPGY Sbjct: 59 QVWPPVGLKKFETLSYLPPLSVESLAKEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGY 118 Query: 121 YDGRYWTMWKLPMFGCTDSAQVIKEVQEARTAYPNAHIRIIGFDNTRQVQCIAFIAYKPS 180 YDGRYWTMWKLPMFGCTD++QVI E++EA+ YP A IRIIGFDN RQVQC++FIAYKP+ Sbjct: 119 YDGRYWTMWKLPMFGCTDASQVIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKPA 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63497 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158370739 271 2e-75 >158370739 Length = 180 Score = 271 bits (692), Expect = 2e-75, Method: Compositional matrix adjust. Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 2/180 (1%) Query: 1 MASSMLSSATVATINRXTPDQANMVAPSTGLKSLSTFPGTRKANTDITSVASNGGRVRCM 60 MASSM+SSATVA++NR P QA+MVAP GLKS S FP TRKAN DIT++ASNGGRV+CM Sbjct: 1 MASSMMSSATVASVNR-APVQASMVAPFNGLKSASAFPVTRKAN-DITTLASNGGRVQCM 58 Query: 61 KVWPTEGVMKFETLSYLPPLNDEQLCKEVDYLLRMNWVPCLEFTKLYPYPHREHNRSPGY 120 +VWP G+ KFETLSYLPPL+ E L KEV+YLLR WVPCLEF + + +REH SPGY Sbjct: 59 QVWPPVGLKKFETLSYLPPLSVESLAKEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGY 118 Query: 121 YDGRYWTMWKLPMFGCTDSAQVIKEVQEARTAYPNAHIRIIGFDNTRQVQCIAFIAYKPS 180 YDGRYWTMWKLPMFGCTD++QVI E++EA+ YP A IRIIGFDN RQVQC++FIAYKP+ Sbjct: 119 YDGRYWTMWKLPMFGCTDASQVIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKPA 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49941 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6838 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43779 (588 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24280 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9168 (319 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3293 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4726 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30474 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45661 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20666261 (190 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41328 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66022 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49361 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2427 278 2e-77 >Contig2427 Length = 260 Score = 278 bits (710), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 137/247 (55%), Positives = 163/247 (65%), Gaps = 2/247 (0%) Query: 2 TLVGLFLVGFLSMVSSVHGQGWINAHATFYXXXXXXXXXXXXXXYGNLYSEGYGTNTAAL 61 +L L +V + G W AHATFY YGNLYS+GYG NTAAL Sbjct: 13 SLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAAL 72 Query: 62 STALFNNGLSCGSCYEIKCVNDGKWCLPG--SIVITATNFCXXXXXXXXXXGGWCNPPLH 119 STALFNNGLSCG+C+EIKC +D +WC G SI +TATNFC GGWCNPP Sbjct: 73 STALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRT 132 Query: 120 HFDLSQPVFQHIAQYRAGIVPVSYXXXXXXXXXXXXFTINGHSYFNLVLITNVGGAGDVH 179 HFDL+ P+F IA+Y+AGIVPVSY FTINGH YFNLVL+TNV GAGD+ Sbjct: 133 HFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAGAGDIV 192 Query: 180 AVAIKGSRTGWQSMSRNWGQNWQSNTYLNGQSLSFKVTTSDGHTIVSYNCVPAHWSFGQT 239 +V++KG+ TGW MSRNWGQNWQSN+ L GQ+LSF+V SD + +YN PA+W FGQT Sbjct: 193 SVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQFGQT 252 Query: 240 FSGAQFR 246 +SG FR Sbjct: 253 YSGKNFR 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40999 (448 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44944 (311 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18644 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13466261 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4687 (358 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23541 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64843 (312 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43225 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62388 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4695 337 2e-95 >Contig4695 Length = 382 Score = 337 bits (865), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 169/171 (98%), Positives = 170/171 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEAEA 171 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+ Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES 171 Score = 337 bits (865), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 169/171 (98%), Positives = 170/171 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 137 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 196 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEAEA 171 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+ Sbjct: 197 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES 247 Score = 337 bits (865), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 169/171 (98%), Positives = 170/171 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 213 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 272 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEAEA 171 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+ Sbjct: 273 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES 323 Score = 305 bits (781), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 289 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 348 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 152 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 349 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9909 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60148 (613 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17974 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8552 (68 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6843 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27166260 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3566262 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64198 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3070 85 3e-19 >Contig3070 Length = 218 Score = 85.1 bits (209), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 43/61 (70%), Positives = 47/61 (77%) Query: 1 MITEAIVALKERTGSSQYAITKFIEEKHKKLPSNFRXXXXXXXXXXXASEKLVKVKNSYK 60 MITEAIVALKERTGSSQYAITKF+EEKHK+LP +FR AS KLVKVK S+K Sbjct: 23 MITEAIVALKERTGSSQYAITKFVEEKHKQLPQSFRKLLLLNLKKLVASGKLVKVKASFK 82 Query: 61 L 61 L Sbjct: 83 L 83 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17666257 (357 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26451 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10638 (428 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28330 (238 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig258 305 2e-85 >Contig258 Length = 254 Score = 305 bits (780), Expect = 2e-85, Method: Compositional matrix adjust. Identities = 165/250 (66%), Positives = 178/250 (71%), Gaps = 17/250 (6%) Query: 2 ASIVCAERDKFNLNYEETEXXXXXXXXXXXXXXXDVSKSSGKRGFSETVDLKLNL----- 56 + +R+ +N+EETE S SSGKRGFSETVDLKLN Sbjct: 9 GGVTVEDRNYSLINFEETELRLGLPGALKDGDQGVKSCSSGKRGFSETVDLKLNFSSEND 68 Query: 57 -LSKDSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVRSFRKNILTVQKNXX---- 111 +S+ Q E KEK A S PA P AKAQVVGWPPVRSFRKNI+ VQK Sbjct: 69 DVSRSGRDGQVEIKKEKDA---SAAPA-PRAKAQVVGWPPVRSFRKNIVAVQKKSTDQDQ 124 Query: 112 ---XXXXXXXXXXFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGM 168 FVKVSMDGAPYLRKVDLK+Y+SYQELS ALGKMFSSFTIGNCGSQGM Sbjct: 125 AAEKSGSTSTSAAFVKVSMDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGM 184 Query: 169 KDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAP 228 KDFMNESKLIDLLNGS+YVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAP Sbjct: 185 KDFMNESKLIDLLNGSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP 244 Query: 229 RAVEKCKNRS 238 RAVEK KNRS Sbjct: 245 RAVEKFKNRS 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58440 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47769 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4978 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158379466 100 7e-24 >158379466 Length = 226 Score = 100 bits (248), Expect = 7e-24, Method: Compositional matrix adjust. Identities = 44/72 (61%), Positives = 54/72 (75%) Query: 1 ANPRIHYETTGPEIWEGSGGKVDALVXXXXXXXXXXXXXKFLKEKSPEIKVYGVEPVESA 60 ANP++HYETTGPEIWEG+GGK+DA V K+LKEK+P +K+YGVEPVES Sbjct: 155 ANPKVHYETTGPEIWEGTGGKIDAFVSGIGTGGTITGAGKYLKEKNPSVKLYGVEPVESP 214 Query: 61 VLSGGEHAPHKI 72 VL+GG+ PHKI Sbjct: 215 VLTGGKPGPHKI 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33375 (346 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58092 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 156 9e-41 >Contig3037 Length = 313 Score = 156 bits (395), Expect = 9e-41, Method: Compositional matrix adjust. Identities = 67/103 (65%), Positives = 88/103 (85%) Query: 9 KGLWTKEEDRILLDYIQVHGRGRWNRISKITGLKRCGKSCRLRWMNYLSPSVKHGEFTEQ 68 KG WTKEED+ L+DYI++HG G W + K GL RCGKSCRLRW+NYL P +K G FTE+ Sbjct: 14 KGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTEE 73 Query: 69 EEDLIIRLHNLLGNRWSLIAGRVPGRTDNQVKNHWNSHLCKRL 111 E++LII+LH+LLGN+WSLIAGR+PGRTDN++KN+WN+H+ ++L Sbjct: 74 EDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKL 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27451 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53631 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38009 (327 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42304 (364 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 62 5e-12 >89552756 Length = 189 Score = 62.0 bits (149), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 11/108 (10%) Query: 186 RLKIIRGVADGLSYLHNLDTPIIHRDIKASNVLLDSEFEPH-----IADFGLARRIEWSH 240 RL I A G+ YLH + I+H D+K N+L++ +P I D GL++ + Sbjct: 22 RLIIAMDAAFGMEYLHGKN--IVHFDLKCENLLVNMR-DPQRPVCKIGDLGLSKVKQ--Q 76 Query: 241 SHVSTQVAGTMGYMPPEYREGVT-VATVKADVYSFGILMIEIATGRRP 287 + VS V GT+ +M PE G + + T K DVYSFGI+M E+ TG P Sbjct: 77 TLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLTGDEP 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65345 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35660 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20516 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40618 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22866265 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46547 (389 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4725 703 0.0 >Contig4725 Length = 393 Score = 703 bits (1814), Expect = 0.0, Method: Compositional matrix adjust. Identities = 335/387 (86%), Positives = 358/387 (92%) Query: 1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCSKTNMVMVFGEITTK 60 M+TFLFTSESVNEGHPDKLCDQ+SDA+LDACLEQDP+SKVACETC+KTNMVMVFGEITTK Sbjct: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTK 60 Query: 61 AKVDYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA 120 A VDYEKIVRDTCR IGFVS DVGLDADNCKVLVNIEQQSPDIAQGVHGH +K+PEEIGA Sbjct: 61 ANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGA 120 Query: 121 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNEG 180 GDQGHMFGYATDETPELMPL+HVLATKLGAKLTEVRKN TC WLRPDGKTQVTVEY NEG Sbjct: 121 GDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTVEYHNEG 180 Query: 181 GAMVPIRVHTVLISTQHDETVTNDQIAKELREHVIKPVIPSKFMDDKTIFHLNPSGRFVI 240 GAMVP+RVHTVLISTQHDETVTND+IA +L+EHVIKPV+P K++D+KTIFHLNPSGRFVI Sbjct: 181 GAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVVPEKYLDEKTIFHLNPSGRFVI 240 Query: 241 GGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPTKVDRSGAYIVRQAAKSVVASGLAR 300 GGPHGDAGLTGRKIIIDTY KDPTKVDRSGAYIVRQAAKS+VA+GLAR Sbjct: 241 GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 Query: 301 RCLVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILELIKENFDFRPGMIAINLDLKRGGNF 360 R LVQVSYAIGVPEPLSVFV+TY TGKIPDK+IL+++KENFDFRPGMI INLDLKRGGN Sbjct: 301 RALVQVSYAIGVPEPLSVFVETYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNK 360 Query: 361 RFQKTAAYGHFGRDDPDFTWETVKLLK 387 RF KTAAYGHFGRDDPDFTWE VK LK Sbjct: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLK 387 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41556 (339 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31412 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12750 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23855 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64516 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 155 1e-40 >Contig2950 Length = 216 Score = 155 bits (393), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 89/214 (41%), Positives = 116/214 (54%), Gaps = 13/214 (6%) Query: 11 DYDYLVKLLLIGDSGVGKSCLLLRXXXXXXXXXXXXXXXXXXKIRTIELDGKRIKLQIWD 70 DYDYL K++LIGDSGVGKS LL R R+I +D K +K QIWD Sbjct: 8 DYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWD 67 Query: 71 TAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKA 130 TAGQER+R IT+AYYRGA+G LLVYDVT +F N+ W++ + H N+ +LVGNKA Sbjct: 68 TAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKA 127 Query: 131 DMDESKRAVPTSQGQALADEYGIKFFETSAKTNFNVEQVFFSIARDIKQRIAES------ 184 D+ RAV +A A+ F ETSA + NVE F + I Q ++ Sbjct: 128 DL-RHLRAVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEVGD 186 Query: 185 DSKAEP--LTIKISKPDPAIGSATAQEKSACCGS 216 D A P TI + D +A +K+ CC + Sbjct: 187 DPAAVPKGQTINVGGKDD----VSAIKKAGCCSA 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566259 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41417 (595 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55034 (302 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158357520 62 3e-12 >158357520 Length = 260 Score = 62.4 bits (150), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 54/190 (28%), Positives = 82/190 (43%), Gaps = 23/190 (12%) Query: 1 MLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDRTKVYEASGRHHFRTEASYSFIFEE 60 L + R + F+GDSLNRNM+ +L C L+ V K + G A F F + Sbjct: 80 FLHMYRNTSIGFIGDSLNRNMFVALFCSLKR-VSSEVKKWRPFG-------ADRGFTFLQ 131 Query: 61 YHCSVEFFVSPFLVQ--EWEMPDKNG-----SKKETLRLD-KIP--TSSDKYKTADIIIF 110 Y+ ++ + + L + W G KE R+D IP T ++ DI+IF Sbjct: 132 YNVTLAYHRTNLLARYGRWSANANGGVLESLGYKEGYRVDVDIPADTWAESLSFHDILIF 191 Query: 111 NTGHWW----THDKTSKGKDYYQEGSHVYGELNVMEAFRKALTTWARWVDANVNPAKSLV 166 NTGHWW D + +++ G V + F L +V+ + P ++ Sbjct: 192 NTGHWWWAPAKFDPINSPLLFFENGQPVVPPVLPDVGFDMVLKHMVMFVEKRMKPG-AIK 250 Query: 167 FFRGYSSSHF 176 FFR S HF Sbjct: 251 FFRTQSPRHF 260 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7415 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22024 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17016 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32536 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48636 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31428 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19111 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33600 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11466261 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14329 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27821 (418 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47598 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24808 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53186 (276 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 149 1e-38 >Contig2005 Length = 422 Score = 149 bits (377), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 95/243 (39%), Positives = 132/243 (54%), Gaps = 28/243 (11%) Query: 29 YGYSSFKGKRPSMEDFYETRI------SEVDGHMVAFFGVFDGHGGSRTAEYLKNNLF-- 80 +G +S G+R MED S+ DG F+GV+DGHG S A K+ L Sbjct: 125 FGSTSVCGRRRDMEDAVSIHPKLFNDGSDSDG--CHFYGVYDGHGCSHVALKCKDRLHEI 182 Query: 81 --KNLSSHPDFIKDTKSAIAEVFRKTDADY-------------LNEEKGQARDAGSTAST 125 ++L S + K + F K D + + Q GSTA Sbjct: 183 VKQDLESQ--RVVQWKDTMERSFSKMDEEVQAGNRALQNPNCRCELQTPQCDAVGSTAVV 240 Query: 126 AVLVGDRLLVANVGDSRVVACRAGSAIPLSTDHKPDRSDERQRIEDAGGFVIWAGTWRVG 185 AV+ ++++V+N GDSR V CR G+A+PLS+DHKPDR DE RIE AGG VI+ RV Sbjct: 241 AVVTPEKIIVSNCGDSRAVLCRKGAAVPLSSDHKPDRPDELLRIEAAGGRVIYWDGPRVL 300 Query: 186 GVLAVSRAFGDKLLKAYVVADPEIQEEEIDGVD-FIIIASDGLWNVLSNKEAVAIVQDIM 244 GVLA+SRA GD LK YV+++PE+ + D +I+ASDGLW+V+SN A +V+ + Sbjct: 301 GVLAMSRAIGDNYLKPYVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTACGVVRMCL 360 Query: 245 DAE 247 A+ Sbjct: 361 RAQ 363 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22163 (460 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41546 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 157 4e-41 >Contig2950 Length = 216 Score = 157 bits (397), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 82/176 (46%), Positives = 114/176 (64%), Gaps = 3/176 (1%) Query: 8 SQPEFDYLFKLLLIGDSGVGKSTLLLSFTSNTFE-DLSPTIGVDFKVKHVNIGGKKLKLA 66 S ++DYLFK++LIGDSGVGKS LL FT N F + TIGV+F + +++ K +K Sbjct: 5 SDDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQ 64 Query: 67 IWDTAGQERFRTLTSSYYRGAQGVIMVYDVTRRETFTNLSDIWAKEIDLYSTNQDCIKML 126 IWDTAGQER+R +TS+YYRGA G ++VYDVTR TF N+ + W KE+ + T+ + + ML Sbjct: 65 IWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENV-ERWLKELRDH-TDSNIVIML 122 Query: 127 VGNKVDKESERVVTKKEGIDFAREYGCLFLECSAKTRVNVEQCFEELVLKILETPS 182 VGNK D R V+ ++ FA F+E SA +NVE F E++ +I + S Sbjct: 123 VGNKADLRHLRAVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVS 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22330 (69 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31274 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42037 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7436 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31645 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41061 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54952 (573 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11929 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3266259 (431 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18366261 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28359 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13048 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2466261 (322 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7237 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57840 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28266264 (325 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10126 (433 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig914 471 e-135 >Contig914 Length = 300 Score = 471 bits (1212), Expect = e-135, Method: Compositional matrix adjust. Identities = 223/300 (74%), Positives = 252/300 (84%) Query: 134 QPRVEAPMVNARIRKTVQATHAKVGYIGPATDFNYDHQHLGTGPQTLLEIAEGRHPFCSA 193 QPRVEA +VNARIRKTV + AKVGY+GP D NY+HQHLGTGP TLLE+AE RHPF S Sbjct: 1 QPRVEAAIVNARIRKTVLSNQAKVGYVGPEADLNYEHQHLGTGPDTLLELAERRHPFSSV 60 Query: 194 ILNAKNPAIVVGAGLFERGDKDAIFAAVETIAKLGKVIRPDWNXXXXXXXXXXXXXXXXX 253 +LNAKNPAI+VGAGLFER DKDAIF+A+ETIAK K +RPDWN Sbjct: 61 LLNAKNPAIIVGAGLFERKDKDAIFSALETIAKYAKAVRPDWNGFNVLLLKAAQAAALDL 120 Query: 254 XXXPESSKSIESAKFLYLMGADDVNLEKVPDDAFVVYQGHHGDQSVYRANVILPAAAFSE 313 PES SIESAKF+YLMGADDV+L++VP DAFVVYQGHHGD+ VYRANVILPAAAFSE Sbjct: 121 GLVPESENSIESAKFVYLMGADDVSLDRVPSDAFVVYQGHHGDRGVYRANVILPAAAFSE 180 Query: 314 KEGTYENTEGCTQQTLPAVPTVGDSRDDWKIIRALSEVAGVQLPYDTLGAIRSRIKTVAP 373 KEGTY NTEGC+QQT+PAVPTVGD+RDDWKI+RALSEVAGV+LPYD++GAIRSRIKTVAP Sbjct: 181 KEGTYVNTEGCSQQTMPAVPTVGDARDDWKILRALSEVAGVKLPYDSVGAIRSRIKTVAP 240 Query: 374 NLYNMDEREAATFSTSLKPELSEKMSLSAFGSAVENFYMTDSITRASKIMAQCSATLLKK 433 N+ N+DERE ATFS S+KPE ++KM + FG+AVENFYMTDSITRASKIMAQCSA LLKK Sbjct: 241 NILNVDEREPATFSFSIKPETTQKMDSTPFGTAVENFYMTDSITRASKIMAQCSALLLKK 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7888 (525 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31365 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14913 (381 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57483 (423 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58529 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 200 5e-54 >Contig2950 Length = 216 Score = 200 bits (509), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 94/207 (45%), Positives = 131/207 (63%) Query: 3 YDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGRPIKLQIWDT 62 YDYLFK ++IGD+GVGKS LL +FT F TIGVEF R + +D + +K QIWDT Sbjct: 9 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDT 68 Query: 63 AGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANPNMTIMLIGNKCD 122 AGQE +R+IT +YYRGA GALLVYD+TR TF ++ WL++ R H + N+ IML+GNK D Sbjct: 69 AGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKAD 128 Query: 123 LAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAARILQNIQEGVFDLSNES 182 L H RAVS E+ + FA+ F+E SA + NVE AF + +I Q + ++ ++ Sbjct: 129 LRHLRAVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEVGDDP 188 Query: 183 SGIKVGYGRPQGPSGDGTVSQRGGCCN 209 + + G G D + ++ GCC+ Sbjct: 189 AAVPKGQTINVGGKDDVSAIKKAGCCS 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43587 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4306 368 e-104 >Contig4306 Length = 275 Score = 368 bits (945), Expect = e-104, Method: Compositional matrix adjust. Identities = 171/263 (65%), Positives = 219/263 (83%), Gaps = 5/263 (1%) Query: 62 TWREDMGNGSYDEAVEGLRKLLREKANLEPVAAAKIDQITAQLKSSDGSSSPFDPVERMK 121 T EDM +Y++A+ GL KLL EKA+LE VAAAKI Q+TA+L+ + S+ FDPVE++K Sbjct: 18 TKEEDM---AYEDAIAGLSKLLSEKADLEGVAAAKIKQLTAELE--EAGSNQFDPVEKLK 72 Query: 122 TGFIYFKKEKYDKNPALHAELAKGQSPKFMVFACSDSRVCPSHVLDFQPGDAFVVRNVAN 181 +GF++F+ EK++K+ L+ +LA GQSPKFMVFACSDSRVCPSH+L+FQPG+AFVVRN+AN Sbjct: 73 SGFVHFRTEKFEKDVDLYGKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVRNIAN 132 Query: 182 MVPAYDKIRYSGVGSAVEYAVLHLKVEHIVVIGHSSCGGIKGLMSFPFDGTSSTDFIEDW 241 MVP +D ++SGVG+A+EYAVLHLKVE+IVVIGHS CGGIKGLMS P DGT+++DFIE+W Sbjct: 133 MVPPFDTTKHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDFIENW 192 Query: 242 VKIGLPAKSKVVAECGDLPFPEQCAYCEKEAVNVSLGNLLSYPFVREGLVKKTLTLKGGY 301 V+I PAK+K+ + CGDL F +QC EKEAVNVSLGNLL+YPFVRE +V TL LKGG+ Sbjct: 193 VQICAPAKNKIKSSCGDLSFADQCTSLEKEAVNVSLGNLLTYPFVREAVVNNTLALKGGH 252 Query: 302 YDFVKGTFELWGLDFGLSPSFSV 324 YDFV G FELW LDF ++P+ ++ Sbjct: 253 YDFVGGGFELWDLDFNITPNLTL 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9852 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58192 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53269 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158358249 72 3e-15 >158358249 Length = 174 Score = 71.6 bits (174), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 51/178 (28%), Positives = 85/178 (47%), Gaps = 42/178 (23%) Query: 7 RIMIAVNESSIKGYPHPSISSKRAFEWTLQKIVRSNTSAFKLLFLHVHVP---------- 56 RI++AV+E Y A W L +V S + L+ ++V P Sbjct: 10 RILVAVDEGEESMY---------ALSWCLGNVVSSKDT---LILVYVKPPKAVYMPLDGT 57 Query: 57 ----DEDGFDDMDSIYASPEDFKN------LER-RDKARGLQLLEHFVKSSHEFGVSCGA 105 G+ +YA+ E++ N +E+ ++K R + L E VK Sbjct: 58 GRSQSSSGYMFSSDLYATMENYSNEVANSVIEKAKNKCRDV-LQEQDVKVETR------- 109 Query: 106 WIKKGDPKEVICHEVKRIQPDLLVVGCRGLGPFQRVFVGTVSEFCVKHAECPVITIKR 163 I+ GDP++VICH V+++ +LV+G RG G +R F+G+VS C ++ CPV+ +K+ Sbjct: 110 -IENGDPRDVICHLVEQLGAHILVMGSRGYGLIKRAFLGSVSNHCAQNVNCPVLIVKK 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41657 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25841 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15952 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3581 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41871 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47361 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26604 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41076 (296 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65342 (482 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47781 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50988 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9726 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26166260 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55385 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18017 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49949 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50683 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35043 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55149 (523 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1866260 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1663 174 2e-46 >Contig1663 Length = 176 Score = 174 bits (442), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 97/182 (53%), Positives = 120/182 (65%), Gaps = 9/182 (4%) Query: 1 MVGQWTVTKPGRSDEVLEADQQQRITAQIRAHFDSITPKRPAKXXXXXXXXXXXXXXHAA 60 MVGQ TVTKP RSD VL+AD+Q RI+ QI+A F+S PKRP K Sbjct: 1 MVGQSTVTKPSRSDHVLDADEQLRISTQIKAQFESAAPKRPMKPNRSEPDSPTPALSIVD 60 Query: 61 NGTIPELHKFRTLQSQSQSESHAMISTDGSG-MLQEEFVETHYYKELGSIDKQHHTTGTG 119 IPELHK RTLQSQS H +IS +G+ ++Q+EFV+T YYKEL SIDKQHH TGTG Sbjct: 61 QPNIPELHKLRTLQSQS----HVIISDEGANSLVQDEFVDTQYYKELNSIDKQHHMTGTG 116 Query: 120 FIKVERRGVEDGYGLQLQ--RRENREMMLRGFKSNPATNDWIPSLEEDEVGYVSSKPSRS 177 FI+VER E +QL + ++ GF+SNPATNDWIP +ED V ++SSKP+RS Sbjct: 117 FIRVEREE-EGSNDIQLTGIHGGSNGIVRAGFRSNPATNDWIPKTDEDLV-FISSKPNRS 174 Query: 178 ES 179 E+ Sbjct: 175 EN 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41723 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10798 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24196 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58110 (313 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 102 3e-24 >Contig3037 Length = 313 Score = 102 bits (253), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 52/102 (50%), Positives = 66/102 (64%), Gaps = 1/102 (0%) Query: 12 KGPWSPEEDEALQRLVQKHGPRNW-SLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPE 70 KG W+ EED+ L ++ HG W SL ++ R GKSCRLRW N L P ++ FT E Sbjct: 14 KGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTEE 73 Query: 71 EDATIIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKRK 112 ED II+ H+ GNKW+ IA L GRTDN IKN+WN+ +KRK Sbjct: 74 EDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRK 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1466263 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158373278 198 2e-53 >158373278 Length = 103 Score = 198 bits (503), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 93/102 (91%), Positives = 98/102 (96%) Query: 59 FPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ 118 +PLTL FSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQ Sbjct: 2 YPLTLQFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQ 61 Query: 119 DLLDQPNPADPAQTDGYQLFIQEPAEYKRRVRQQAKQYPPLV 160 DLLDQPN ADPAQT+GYQLFIQEPAEYKRRV+QQAKQYP ++ Sbjct: 62 DLLDQPNAADPAQTEGYQLFIQEPAEYKRRVKQQAKQYPSVI 103 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1537 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2643 (319 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10361 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26779 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35348 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8594 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56813 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8891 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36844 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30587 (355 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10612 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2827 473 e-136 >Contig2827 Length = 245 Score = 473 bits (1216), Expect = e-136, Method: Compositional matrix adjust. Identities = 228/245 (93%), Positives = 234/245 (95%) Query: 1 MATRLQFENSCEVGVFSKLTNAYCLVAIGGSESFYSVFESELADVIPVVKTSIGGTRIIG 60 MATRLQFENSCEVGVFSKLTNAYCLVAIGGSESFYS FE+ELADVIPVVKTSIGGTRIIG Sbjct: 1 MATRLQFENSCEVGVFSKLTNAYCLVAIGGSESFYSTFEAELADVIPVVKTSIGGTRIIG 60 Query: 61 RLCAGNKKGLLLPHTTTDQELQHLRNSLPDQVVVQRIEEKLSALGNCIACNDHVALAHTD 120 RLCAGNK GLLLPHTTTDQELQHLRNSLPDQVVVQRIEE+LSALGNCI CNDHVAL H D Sbjct: 61 RLCAGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCITCNDHVALTHPD 120 Query: 121 LDRETEEMVADVLGVEVFRQTIAGNILVGSYCTFSNRGGLVHPHTSIEDLDELSTLLQVP 180 LDRETEEMV DVLGVEVFR TIA N+LVGS+C SNRGGLVHPHTS+EDLDELSTLLQVP Sbjct: 121 LDRETEEMVTDVLGVEVFRNTIATNVLVGSFCALSNRGGLVHPHTSVEDLDELSTLLQVP 180 Query: 181 LVAGTVNRGSEVIAAGMTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 240 LVAGTVNRGSEVIAAGM VNDWTAFCGSDTTATE+SVIESVFKLREAQPSAIVDEMRKSL Sbjct: 181 LVAGTVNRGSEVIAAGMIVNDWTAFCGSDTTATEVSVIESVFKLREAQPSAIVDEMRKSL 240 Query: 241 IDSYV 245 IDSYV Sbjct: 241 IDSYV 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27588 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53808 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3566 96 8e-23 >Contig3566 Length = 175 Score = 96.3 bits (238), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 58/151 (38%), Positives = 78/151 (51%), Gaps = 17/151 (11%) Query: 3 ALRWALDNIKLRSPPSHAEAGSFVILHVQSPPSIATGLNPGAIPFGG------PTDLEVP 56 AL W +DN+K S +I Q PP+ A P G PT P Sbjct: 31 ALMWVIDNLK----ESINTNSPLLIFMAQPPPANNITF---AAPLGSARMYCPPT----P 79 Query: 57 AFTAAIEAHQRRITEAILDHALKICSDKNVNVKTDVVIGDPKEKICEAAVNLHADLLVMG 116 FT ++ + R++T A+L+ A IC+ V KT IGD K IC A + + LLV+G Sbjct: 80 EFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEIGDAKTAICAAVLKHNVKLLVLG 139 Query: 117 SRAFGPIRRMFLGSVSNYCTNHAQCPVMIVK 147 R G I+R LGSVSNYC +A+CPV++VK Sbjct: 140 ERGLGKIKRAILGSVSNYCVLNAKCPVLVVK 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25430 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34451 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4016 (349 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19963 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 61 4e-12 >Contig4694 Length = 351 Score = 60.8 bits (146), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 45/158 (28%), Positives = 69/158 (43%), Gaps = 29/158 (18%) Query: 25 LNDLEVEEVPTVDFSQLTAGTPDERSKAIQV----IGKACREWGFFMVINHSMPRRLMDE 80 L+ +E + VP +D S LT+ KAI+V IG AC+ WGFF VINH +P + ++ Sbjct: 18 LSIIEADGVPLIDLSPLTSADSISDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREK 77 Query: 81 MLNVGERFFDLAEEEKQDHAGKELFDPIRCGTGFNNG--LGNVFLWR---DYL------- 128 + +FF EEK+ E +C G+ + NV W+ D+L Sbjct: 78 VETTARKFFAQPLEEKRKIRRDE-----KCVVGYYDTEHTKNVRDWKEVYDFLVEEPTLV 132 Query: 129 --------KVHVHPHFHAPHKPADFRETSEEYCKKSSR 158 K P P + RE E+Y ++ + Sbjct: 133 PSSTEPDDKEETQWFNQWPENPPELREVMEDYSQEVEK 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4834 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20699 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53333 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158373278 194 3e-52 >158373278 Length = 103 Score = 194 bits (492), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 91/102 (89%), Positives = 96/102 (94%) Query: 59 FPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ 118 +PLTL FSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQ Sbjct: 2 YPLTLQFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQ 61 Query: 119 DLLDQPNPADPAQTEGYHLFIQDAAEYKRRVRQQAKQYPPLV 160 DLLDQPN ADPAQTEGY LFIQ+ AEYKRRV+QQAKQYP ++ Sbjct: 62 DLLDQPNAADPAQTEGYQLFIQEPAEYKRRVKQQAKQYPSVI 103 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59348 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8654 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34046 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21039 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7372 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6035 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77980463 102 1e-24 >77980463 Length = 260 Score = 102 bits (253), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 51/134 (38%), Positives = 76/134 (56%), Gaps = 6/134 (4%) Query: 10 VTAQSRDTPDEDTGISIQNCSISATDDLYSNRGSVKSYLGRPWKVYARTVYLESYIDDFI 69 VTAQ R + T I QN +ISA D Y ++ ++LGRP Y+RTV ++S IDD I Sbjct: 130 VTAQERSDKRQPTAIVFQNSTISA-DKEYKDK---TAFLGRPAHTYSRTVVMQSQIDDVI 185 Query: 70 DPSGWTEWNGNEGLDTLYYGEYDNNGPGSGTENRVTWQGYHVMEDNDAYNFTVSEFITGD 129 P GWT W G + ++GE+ N G GS T RV+W + ++ + A F+ S + G+ Sbjct: 186 SPEGWTPWTGQSNTEECWFGEFSNRGSGSATNKRVSW--FKMVARDQADEFSASSLLFGE 243 Query: 130 EWLDSTYFPYDDGI 143 W+ + PY+ G+ Sbjct: 244 NWIKPSGVPYEAGL 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25403 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4758 (383 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4900 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32131 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5776 132 1e-33 >Contig5776 Length = 289 Score = 132 bits (332), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 81/205 (39%), Positives = 114/205 (55%), Gaps = 15/205 (7%) Query: 26 SILIDGSST---EKTAGPNRLLRG--YDVIDDAKTQLEAACPGVVSCADILALAARDSVV 80 S+L+DGS++ E+ A PN LR + +I+D + + + C VVSCAD+ ALAARD+V Sbjct: 86 SVLLDGSASGPSEQQAPPNLSLRAKAFQIINDLREIVHSKCGRVVSCADLTALAARDAVF 145 Query: 81 LTKGLMWKVPTGRRDGR--VSLASDVNNLPGPRDSVEVQKQKFADKGLNDQDLVTLVGGH 138 L+ G ++VP GR+DG + + NLP P + A K L+ D+V L GGH Sbjct: 146 LSGGPEYEVPLGRKDGLNFATRNETLANLPAPTSNTTKLLTDLAKKNLDATDVVALSGGH 205 Query: 139 TIGTSACQAFRYRLYNFSTTTANGADPTMDATFVTQLQALCPADGDASRRIALDTGSSDT 198 TIG C +F RLY D +MD TF L+ +CPA D + LD S DT Sbjct: 206 TIGLGHCTSFTGRLY-------PTQDASMDKTFANDLKQVCPA-ADTNATTVLDIRSPDT 257 Query: 199 FDASFFTNLKNGRGVLESDQKLWTD 223 FD ++ +L N + + SDQ L+TD Sbjct: 258 FDNKYYVDLMNRQCLFTSDQDLYTD 282 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51078 (367 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14966265 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63997 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2685 80 5e-18 >Contig2685 Length = 116 Score = 79.7 bits (195), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 36/92 (39%), Positives = 55/92 (59%) Query: 25 AVTCGQVETSLAPCMPYLTGGGNPAAPCCNGVQNLKLLIPPPTDRRDACRCVKAAASKFQ 84 A+TCGQV ++APC Y+ GG A CCNG+++L DR+ C C+K+AA + Sbjct: 25 AITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSLNSAAKTTADRKQTCNCLKSAAGSIK 84 Query: 85 NIKEDAASALPTKCGVQIGIPISMTPNCDQIQ 116 + + A+ LP KCGV + IS + NC+ ++ Sbjct: 85 GLNANLAAGLPGKCGVNVPYKISTSTNCNNVK 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9437 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53065 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31627 (419 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34712 (680 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26296 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31808 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22165 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16346 (377 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6095 (117 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12666257 (327 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15994 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41823 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46147 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31072 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6446 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40843 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4708 (471 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89555746 93 3e-21 >89555746 Length = 130 Score = 92.8 bits (229), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 46/109 (42%), Positives = 68/109 (62%) Query: 11 LVISIFAFADAGSIGVNYGRIANNLPSAVKVVQLLKSQGIERVKVFDTDPAVLKALGESG 70 L+ ++ A G+ G+NYGRIA+N+PS KV LL++ I+ V+++D D +VLKA +G Sbjct: 19 LIATVTVQAFTGAYGINYGRIADNIPSPDKVATLLRAAKIKNVRIYDADHSVLKAFSGTG 78 Query: 71 IKVTVDLPNELLISAAKRQSFANTWVQKNVADYFPATKIEAIAVGNEVF 119 + + V LPN + + Q A WV++NV + P T I IAVGNEV Sbjct: 79 LDLVVGLPNGYVKDMSANQDHALDWVKENVQAFLPDTHIRGIAVGNEVL 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15567 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18905 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17804 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20929 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3257 86 3e-19 >Contig3257 Length = 185 Score = 85.5 bits (210), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 74/242 (30%), Positives = 105/242 (43%), Gaps = 65/242 (26%) Query: 24 EKSSFSQTCSLLSQYIKEKGTFGDLSLGMTCSLEGNGTPESLRQTATTTTMNLFPMTERS 83 E+S+F+QTC+LLSQY+KEK + L+G+ S Sbjct: 3 ERSNFAQTCNLLSQYLKEK---------RSQYLQGD-----------------------S 30 Query: 84 AGVSGIPARNMNLKSMNLFPQQAGFGSSVSKDDAPKIVNSSVKKSGNVEPQTAQMTIFYG 143 GV +P MNL + + AP MTIFYG Sbjct: 31 FGVKPVPPATMNLLNAMEASPAPPAANPDQPRSAP-------------------MTIFYG 71 Query: 144 GQVIVFNDFPADKAKEVMRLAGMGSSPVPSTTVKNPIDAGGMAPSTPNVVPNFANSLIQE 203 GQV+VF+D +KAKE+M LA GS V S+ + + P + P A Sbjct: 72 GQVLVFSDLSPEKAKEIMGLATQGSPVVSSSESNVVVKPQQVKPQQQQLQPPPA------ 125 Query: 204 RIQRPAQPVACELPIARKASLHRFLEKRKDRITARAPYNISNSPAGPHKPAESKSWLGLA 263 +A +LPI R+ASLH+FL KRK+R+ A APY +++S P + G + Sbjct: 126 --------IASDLPIMRRASLHKFLAKRKERVVAVAPYQVNHSQQRATSPKAEEQVAGQS 177 Query: 264 AK 265 +K Sbjct: 178 SK 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61002 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21566256 (806 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55748 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25564 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49623 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9712 (308 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50785 (306 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34902 (353 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3157 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89551566 376 e-107 >89551566 Length = 208 Score = 376 bits (966), Expect = e-107, Method: Compositional matrix adjust. Identities = 178/181 (98%), Positives = 178/181 (98%) Query: 24 TGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY 83 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY Sbjct: 8 AGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY 67 Query: 84 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 143 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR Sbjct: 68 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 127 Query: 144 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDMAAQQQHEAE 203 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDMA Q QHEAE Sbjct: 128 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDMATQLQHEAE 187 Query: 204 L 204 L Sbjct: 188 L 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46425 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43604 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19349 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2691 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25017 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43776 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33167 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46391 (343 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65548 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26384 (450 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7615 (367 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63082 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40503 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3908 179 9e-48 >Contig3908 Length = 246 Score = 179 bits (455), Expect = 9e-48, Method: Compositional matrix adjust. Identities = 85/246 (34%), Positives = 140/246 (56%), Gaps = 1/246 (0%) Query: 1 MPEGITAEKLLNNIMETISDNAQXXXXXXXXXXXXXXXXTSQFKRLFGREKPVYNLLGAG 60 M E + AE L+ I + I + F R+FGRE+PV+++ G G Sbjct: 1 MAEEVKAESLMEKIEDKILGHHDSPAPEVVHHDSPRSMQDKVF-RIFGRERPVHHVFGGG 59 Query: 61 KSADLMLWRNKKISASFITGATLIWVLFEWLNYHFLTLLCFAVVLGMIAQFVWSNASGVF 120 K AD+ LWR+KK+S + GAT++W+LFE L YH LTL+ ++ + F+WSN G Sbjct: 60 KLADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWSNGLGFI 119 Query: 121 SRSSSEVPRIVLPDELFQNIGVAVGVQVNQALGFLQDVACGGNLKQFXXXXXXXXXXXXI 180 ++S ++P I +P++ I ++ ++N+AL ++D+A G +LKQF + Sbjct: 120 NKSPPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDIASGKDLKQFLSVIAGLWVVSIL 179 Query: 181 GSWCNFLTVLYVGFIAAHTLPVLYERYEDQVDGFVYQVLGQLQHNYRKLDSGFLSKIPKG 240 G CNFLT+LY+ + ++PV YE+Y+ ++D + + +++ Y D+ LSKIP+G Sbjct: 180 GKSCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKAMFEIKKQYAVFDAKVLSKIPRG 239 Query: 241 SLKGKK 246 +LK KK Sbjct: 240 ALKAKK 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41607 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47664 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 82 2e-18 >Contig2950 Length = 216 Score = 82.4 bits (202), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 53/167 (31%), Positives = 81/167 (48%), Gaps = 14/167 (8%) Query: 6 FIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQ 64 K V +GD VGK+ +L +T N F + T+ F+ + VD V +WDTAGQ Sbjct: 12 LFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQ 71 Query: 65 EDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELR-HYAPTVPIVLVGTKLDLR 123 E Y + YRGA LL + + ++EN+ ++W+ ELR H + I+LVG K DLR Sbjct: 72 ERYRAITSAYYRGAVGALLVYDVTRHVTFENV-ERWLKELRDHTDSNIVIMLVGNKADLR 130 Query: 124 EDKQFLIDHPGATPITTAQGEDLKKMIGAAVYIECSSXTQQNVKAVF 170 H A + A+ ++ ++E S+ NV+ F Sbjct: 131 --------HLRAVSVEDAKAFAERE---NTFFMETSALESMNVENAF 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10197 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13602 (406 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7362 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 152 7e-40 >Contig1161 Length = 148 Score = 152 bits (385), Expect = 7e-40, Method: Compositional matrix adjust. Identities = 72/145 (49%), Positives = 97/145 (66%) Query: 8 RRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMA 67 +RI+KE + L +P SA P E+M ++ I+GP SPY GGVF + + P +YP Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFK 63 Query: 68 APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENI 127 PKV F TK++HPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDDPL I Sbjct: 64 PPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 123 Query: 128 AKHWKSNEAEAVETAKEWTRLYASG 152 A +K++ ++ TA+ WT+ YA G Sbjct: 124 AHMYKTDRSKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58882 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38939 (77 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17366258 (339 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv994 (390 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19744 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51896 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49116 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25066257 (565 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59929 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9404 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30823 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4628 137 9e-35 >Contig4628 Length = 524 Score = 137 bits (344), Expect = 9e-35, Method: Compositional matrix adjust. Identities = 79/241 (32%), Positives = 133/241 (55%), Gaps = 8/241 (3%) Query: 42 LQSTLSGGAPLSKEVIEGFAEKYPSVKILQGYGLTESTGIGASTDSLEESRRYGTAGLLS 101 L+ S A L+ ++ E + +L+ Y +TE+T + S + L E + + Sbjct: 282 LRFIRSCSASLAPSILARLEESF-GAPVLEAYAMTEATHLMCS-NPLPEDGAHKPGSVGK 339 Query: 102 PSMEAKIVDPGSGKALTVNQTGELWLRGPTIMKGYFSNPEATTSTLDSSGWLRTGDLCYI 161 P + + +G + +GE+ +RGP + KGY +NPEA + + GW TGD+ ++ Sbjct: 340 PVGQELAILNENGVVQPSDVSGEVCIRGPNVTKGYKNNPEANKAAF-TFGWFHTGDVGFL 398 Query: 162 DDDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPFPDKEVGQYPMAYIN 221 D DG++ +V R+KELI G ++ P E++A+LL+HPEI A PD + G+ I Sbjct: 399 DSDGYLHLVGRIKELINRGGEKISPIEVDAVLLSHPEICQAVCFGVPDDKYGEEINCAII 458 Query: 222 RKAGSNLSESAVMDFIAKQVAPYKRIRRVAFVDSIPKNASGKILRKD-----LIQLATSK 276 + GS++ E+ VM F K +A +K ++V DS+PK A+GKI R+ L Q++T+K Sbjct: 459 PREGSSIDEAEVMRFCKKNLAAFKVPKKVFITDSVPKTATGKIQRRIVAEHFLAQISTAK 518 Query: 277 L 277 + Sbjct: 519 V 519 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22092 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35159 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3666261 (382 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3626 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17666265 (256 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2427 306 1e-85 >Contig2427 Length = 260 Score = 306 bits (783), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 145/228 (63%), Positives = 175/228 (76%), Gaps = 3/228 (1%) Query: 25 FTASGWTKAHATFYGGSDASGTMGGACGYGNLYSTGYGTRTAALSTALFNDGASCGQCYK 84 +T W +AHATFYGGSDASGTMGGACGYGNLYS GYG TAALSTALFN+G SCG C++ Sbjct: 29 YTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFE 88 Query: 85 IICDYQSDSQWCKKG-ASVTITATNFCPPNYALPSNNGGWCNPPLQHFDMAQPAWEKIGI 143 I C D +WC G S+ +TATNFCPPN+A PS+NGGWCNPP HFD+A P + KI Sbjct: 89 IKCG--DDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMFLKIAE 146 Query: 144 YRGGIVPVLFQRVPCKKHGGVRFSVNGRDYFELVLISNVAGAGSIQSVSIKGSRTSWMAM 203 Y+ GIVPV ++RVPC K GG+RF++NG YF LVL++NVAGAG I SVS+KG+ T WM M Sbjct: 147 YKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAGAGDIVSVSVKGTNTGWMPM 206 Query: 204 SRNWGANWQSNAYLNGQSLSFKVTTTDGVTQEFDNVVPSDWGFGQTFS 251 SRNWG NWQSN+ L GQ+LSF+V +D + NV P++W FGQT+S Sbjct: 207 SRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQFGQTYS 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65609 (32 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30762 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5037 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46466 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22949 (317 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22951 (302 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42193 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59520 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16366257 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33969 (256 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50709 (306 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34517 (488 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23708 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666258 (377 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15739 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48981 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55037 (444 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9863 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 142 4e-36 >Contig4694 Length = 351 Score = 142 bits (357), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 102/334 (30%), Positives = 154/334 (46%), Gaps = 33/334 (9%) Query: 15 LNELPAKFIRPAHERPENTKPLEGVSVPVISLA-----------ESHDVLVKEIYKACSE 63 + E+ FI+ RP+ +E VP+I L+ ++ +VLV+EI AC Sbjct: 1 MGEVDPAFIQDPEHRPK-LSIIEADGVPLIDLSPLTSADSISDPKAIEVLVREIGNACKN 59 Query: 64 WGFFLLKDHGISPGLIEKLQEVGIXXXXXXXXXXXXYANDPSTGKFEGYGTKMTKNLDEK 123 WGFF + +HG+ + EK++ D Y T+ TKN+ Sbjct: 60 WGFFQVINHGVPLEMREKVETTARKFFAQPLEEKRKIRRDEKC-VVGYYDTEHTKNVR-- 116 Query: 124 VEWVDYFFHLMSPPSNVNHQI-------------WPQTPSSYREVTEVYNXXXXXXXXXX 170 +W + + L+ P+ V WP+ P REV E Y+ Sbjct: 117 -DWKEVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREVMEDYSQEVEKLSLKL 175 Query: 171 XXXXXXXXXXXXKVLKSHVGGDEIELEMKINMYPPCPQPQLALGVEPHTDMSALTLLVPN 230 K + D+ +++N YPPCP P+LALGV H D ALT+L + Sbjct: 176 MGLIALSLGLPEDRFKGYF-KDQTSF-IRLNHYPPCPSPELALGVGRHKDGGALTVLAQD 233 Query: 231 DVPGLQVWK--DDYWVAVDYLPNALFVHVGDQIEVLSNGKYKSVLHRSTVNKERTRMSWA 288 +V GL+V + D W+ V PNA ++VGD I+V SN +Y+SV HR VN E+ R S Sbjct: 234 EVGGLEVKRKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHRVMVNSEKERFSVL 293 Query: 289 VFCAPPHKAMIGPLPELVDEPNPAKYSTKTFAEY 322 F P H + PL EL ++ NPAKY+ ++ ++ Sbjct: 294 FFLNPAHYTEVKPLEELTNKQNPAKYTPYSWGKF 327 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53740 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47995 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3305 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158362347 59 2e-11 >158362347 Length = 220 Score = 59.3 bits (142), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 53/220 (24%), Positives = 102/220 (46%), Gaps = 24/220 (10%) Query: 1 MASQVANHLEPWQDLEGKVVMVTGASSGLGSEFCLNLAKAGCKIVAAARRVDRLKSLCDE 60 +ASQ AN G+ V++TG S GLG + LAK G ++ +R D+L SL E Sbjct: 4 VASQAAN--------GGRTVLITGVSKGLGRALAVELAKRGHTVIGCSRSQDKLTSLQSE 55 Query: 61 INNLTHSNLPPNADPPLRAVAVELDVTSDGSSIGASVQKAWEAFGRIDALLNNAGIRGNV 120 +++ H + + DV+S+ SSI + E G D ++NNAG+ + Sbjct: 56 LSSDNH-------------LFLAADVSSN-SSIQELARIVMEKKGVPDIIVNNAGVINSN 101 Query: 121 NSPLDISEEEWNNTLKTNLTG-SWLVSKYVGMRMRDAKXXXXXXXXXXXAALNRGQLPGG 179 N ++ +E++ + TN+ G + ++ ++ + ++ + R Sbjct: 102 NKLWEVPADEFDGVIDTNVKGVANVLRHFIPLMLKRDPAPATGIIVNMSSGWGRSGAAHV 161 Query: 180 VAYVSSKSGLSAMTKVMALELGAYNIRANAIAPGLFKSEI 219 Y +SK + +T+ +A EL ++ A+ PG+ +++ Sbjct: 162 APYCASKWAVEGLTRSVAKEL-PKDMAIVALNPGVIHTDM 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17959 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1663 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22751 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23666259 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2794 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3762 399 e-113 >Contig3762 Length = 261 Score = 399 bits (1025), Expect = e-113, Method: Compositional matrix adjust. Identities = 195/269 (72%), Positives = 218/269 (81%), Gaps = 10/269 (3%) Query: 1 MAPIYSSSSAVSTALLISVVVSFLMAASAGNFYQDFGITWGDGRAKILDNGEFLTLSLDK 60 MA IY AL + + L+AASAGNF QDF ITWGDGRAKIL+N + LTL+LDK Sbjct: 1 MAKIY--------ALALVMFFKILVAASAGNFNQDFDITWGDGRAKILNNAQLLTLALDK 52 Query: 61 TSGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPY 120 TSGSGF+S+N+YLFGKIDMQ+KLVPGNSAGTVT+YYLSS G HDEIDFEFLGNLSGDPY Sbjct: 53 TSGSGFKSRNQYLFGKIDMQIKLVPGNSAGTVTSYYLSSLGSAHDEIDFEFLGNLSGDPY 112 Query: 121 ILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGV 180 LHTNVF+QGKGNREQQFYLWFDPT DFHTYSILWNPQ IIFSVDGTPIREFKN ES G+ Sbjct: 113 TLHTNVFTQGKGNREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIREFKNLESRGI 172 Query: 181 PYPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNADACIWFFGAXXXXXX 240 P+PKNQ M IYSSLWNADDWATRGGL+KTDW++APFTASYRNFNA ACIW G+ Sbjct: 173 PFPKNQAMWIYSSLWNADDWATRGGLVKTDWSKAPFTASYRNFNAQACIWSSGSSSCSSS 232 Query: 241 XXXXXXXXXDWYSQELDSTSQERMKWVQK 269 W++Q LD+T + RMKWVQ+ Sbjct: 233 PSGSSKEA--WFTQSLDATGKGRMKWVQR 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45320 (458 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2467 365 e-103 >Contig2467 Length = 274 Score = 365 bits (936), Expect = e-103, Method: Compositional matrix adjust. Identities = 189/266 (71%), Positives = 201/266 (75%), Gaps = 8/266 (3%) Query: 194 RRSLRSISAVLPEGAPEVDPRTHRLKKPVSVPAGAPPV-LPIYDXXXXXXXXXXXXXXXX 252 ++S + PEGAPEVDPRTHRLKKP P LPIYD Sbjct: 16 KKSAGQFQLLYPEGAPEVDPRTHRLKKPAPAVPAGAPPVLPIYDALAPGPSLAPAPAPGP 75 Query: 253 XXXXXHFDGESQVKDFIQTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPND 312 HFDGESQVKDFI TLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPND Sbjct: 76 GGPRHHFDGESQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPND 135 Query: 313 EAMAKLTTDQLSEPGAPEQIMYYHLVPEYQTEESMYNAVRRFGKVRYDTLRLPHKVVAQE 372 EAMAKLTTDQLSEPGAPEQI+YYH++PEYQTEESMYN+VRRFGKV+YDTLRLPH+VVAQE Sbjct: 136 EAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEESMYNSVRRFGKVQYDTLRLPHRVVAQE 195 Query: 373 ADGSVKFGEGDGSAYLFDPDIYTDGRISVQGIDGVLFPXXXXXXXXXXXXSRVTKLVAKP 432 ADGSVKFG GD SAYLFDPDIYTDGRISVQGID VLFP + V K KP Sbjct: 196 ADGSVKFGSGDSSAYLFDPDIYTDGRISVQGIDEVLFP----VEELEKKATPVVKAAVKP 251 Query: 433 RRGKLMEVACRMLGAFGQDSRFTTCQ 458 RRGKLMEVAC MLG GQ F++CQ Sbjct: 252 RRGKLMEVACSMLGTLGQ---FSSCQ 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60432 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35776 (532 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61185 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3840 85 6e-19 >Contig3840 Length = 186 Score = 85.1 bits (209), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 10/95 (10%) Query: 23 CDSCKSAAALLFCRADSAFLCVGCDSKIHGANKLASRHERVWM--------CEVCEQAPA 74 CD+C+SAAA++FC AD A LC CD K+H NKLASRH RV + C++CE APA Sbjct: 5 CDACESAAAIVFCAADEAALCRACDEKVHLCNKLASRHVRVGLATPSAVPRCDICENAPA 64 Query: 75 SVTCKADAAALCVTCDRDIHSANPLARRHDRVPVV 109 C+ D ++LC+ CD +H R H R V+ Sbjct: 65 FFYCEIDGSSLCLQCDMVVHVGG--KRTHGRYLVL 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33350 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 332 8e-94 >89552756 Length = 189 Score = 332 bits (851), Expect = 8e-94, Method: Compositional matrix adjust. Identities = 158/185 (85%), Positives = 164/185 (88%) Query: 1 MVNGSLKQFLQXXXXXXXXXXXXXXAMDASFGMEYLHGKNIVHFDLKCENLLVNMRDPHR 60 MVNGSLKQFLQ AMDA+FGMEYLHGKNIVHFDLKCENLLVNMRDP R Sbjct: 1 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 60 Query: 61 PVCKIGDLGLSKVKQHTLVSGGVRGTLPWMAPELLSGKTNMVTEKIDVYSFGIVMWELLT 120 PVCKIGDLGLSKVKQ TLVSGGVRGTLPWMAPELLSGK++MVTEKIDVYSFGIVMWELLT Sbjct: 61 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLT 120 Query: 121 GDEPYADMHCASIIGGIVNNTLRPQIPRWCEPEWKYLMESCWASDPAERPSFSEISQKLR 180 GDEPY DMHCASIIGGIVNNTLRPQIP WC+PEWK LMESCW S+PA+RPSFSEISQKLR Sbjct: 121 GDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQKLR 180 Query: 181 NMADA 185 NMA A Sbjct: 181 NMAAA 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20565 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4283 157 3e-41 >Contig4283 Length = 582 Score = 157 bits (398), Expect = 3e-41, Method: Composition-based stats. Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 1/101 (0%) Query: 1 MYGFKIKKCSKTRSHDWTECPFAHRGEKAKRRDPRKVNYAAISCPDFRNGAECPRGEACE 60 MY FK+K CS+ SHDWTECPF H GE A+RRDPRK Y+ + CP+FR G+ C +G+ CE Sbjct: 226 MYTFKVKPCSRAYSHDWTECPFVHPGENARRRDPRKYPYSCVPCPEFRKGS-CQKGDVCE 284 Query: 61 FAHGVFEYWLHPAKYRTRACNAGTFCQRKVCFFAHTPEQLR 101 +AHGVFE WLHPA+YRTR C T C RKVCFFAH PE+LR Sbjct: 285 YAHGVFESWLHPAQYRTRLCKDETGCTRKVCFFAHKPEELR 325 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39703 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9011 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3951 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38144 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49533 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 172 3e-46 >Contig1161 Length = 148 Score = 172 bits (436), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 81/83 (97%), Positives = 83/83 (100%) Query: 3 EVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 62 +VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 63 MYKTDRAKYETTARSWTQKYAMG 85 MYKTDR+KYETTARSWTQKYAMG Sbjct: 126 MYKTDRSKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40129 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48939 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27115 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 77 5e-17 >Contig2005 Length = 422 Score = 76.6 bits (187), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 51/122 (41%), Positives = 66/122 (54%), Gaps = 15/122 (12%) Query: 1 RAGCAFALSKDHVASCLEERERVTNAGGQVKWQVDTWRVGPAALQV---TRSIGDDDLKP 57 R G A LS DH +E R+ AGG+V + W GP L V +R+IGD+ LKP Sbjct: 262 RKGAAVPLSSDHKPDRPDELLRIEAAGGRVIY----WD-GPRVLGVLAMSRAIGDNYLKP 316 Query: 58 AVTAEPEITETILSVEDEFLVMASDGLWDVVSNAEVVSIIRDTVKEPGMCSKRLATEAAE 117 V +EPE+T + EDE L++ASDGLWDVVSN ++R MC + T A Sbjct: 317 YVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTACGVVR-------MCLRAQKTPGAS 369 Query: 118 RG 119 G Sbjct: 370 SG 371 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53215 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15666258 (608 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20292 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6226 (404 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4859 94 1e-21 >Contig4859 Length = 544 Score = 94.0 bits (232), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 46/68 (67%), Positives = 52/68 (76%), Gaps = 3/68 (4%) Query: 322 EGKNEEGIFSHEGH---SQRSIQREAALTKFRLKRKDRCFEKKVRYESRKKLAEQRPRVK 378 E N+ G + EG S R+ QREAAL KFRLKRKDRCFEKKVRY+SRK LAE+RPRVK Sbjct: 466 ESLNDSGCYVREGFGADSLRASQREAALIKFRLKRKDRCFEKKVRYQSRKILAEKRPRVK 525 Query: 379 GQFVRQVH 386 GQFV + H Sbjct: 526 GQFVHRAH 533 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47538 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43368 (465 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16766258 (393 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39293 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13481 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61762 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158371151 108 2e-26 >158371151 Length = 153 Score = 108 bits (269), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 58/128 (45%), Positives = 79/128 (61%), Gaps = 1/128 (0%) Query: 29 KKVIIFGVPGAFTPTCSVKHVPGFIEKAGELKSKGIDEILLVSVNDPFVMKAWAKTYPDN 88 KKV+IFG+PGA+T CS +HVP + + K+KGID ++ V+VNDPFV+ WA Sbjct: 26 KKVVIFGLPGAYTGVCSQQHVPSYKNNIDKFKAKGIDSVICVAVNDPFVLNGWADKLEAK 85 Query: 89 KDVKFLADGSATYTHALGLELDLSEKGLGTRSRRFALLVDDLKVKVANV-EAGGEFTVSS 147 ++F D ++ +L L+ DLS LG RS+R++ V D KVKV NV EA +F VS Sbjct: 86 DSIEFYGDFDGSFHKSLELDKDLSVALLGPRSQRWSAYVVDGKVKVLNVEEAPSDFKVSG 145 Query: 148 ADDILKAI 155 D IL I Sbjct: 146 GDVILGQI 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4466264 (57 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61067 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3063 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36389 (542 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20864 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56446 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 306 7e-86 >89552756 Length = 189 Score = 306 bits (784), Expect = 7e-86, Method: Compositional matrix adjust. Identities = 136/189 (71%), Positives = 167/189 (88%) Query: 42 MVNGSLRNSLQKNEKNLDKRKRLLIAMDVAFGMEYLHGKNIVHFDLKSDNLLVNLRDPHR 101 MVNGSL+ LQK ++ +D+RKRL+IAMD AFGMEYLHGKNIVHFDLK +NLLVN+RDP R Sbjct: 1 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 60 Query: 102 PICKVGDLGLSKVKCQPLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLT 161 P+CK+GDLGLSKVK Q L+SGGVRGTLPWMAPELL+G S +V+EK+DV+SFGIVMWELLT Sbjct: 61 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLT 120 Query: 162 GEEPYADLHYGAIIGGIVSNTLRPSVPEFCDPEWRALMERCWSSEPSERPSFTEIANQLR 221 G+EPY D+H +IIGGIV+NTLRP +P +CDPEW++LME CW SEP++RPSF+EI+ +LR Sbjct: 121 GDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQKLR 180 Query: 222 SMAAKIPPK 230 +MAA + K Sbjct: 181 NMAAAMNVK 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25846 (432 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7913 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38202 (478 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39281 (339 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31687 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31403 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33937 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34026 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19130 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5193 69 1e-14 >Contig5193 Length = 545 Score = 69.3 bits (168), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 4/168 (2%) Query: 9 EVLVPALLTGMLASM-AEGRTHYYDFVLKETNFTKLCKTKSMMTVNDSFPGPVIRIHRGD 67 +L +L +LA + AE ++ + + + L + + +N FPGP I D Sbjct: 10 ALLCLSLTASLLAVVTAEDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDINSVTND 69 Query: 68 LVYINVHNQDDFGVTIHWHGVKQTRNPWSDGPDHITQCKIQPGTNFTYKVIFGEDQEGTL 127 + INV N D + W+G++Q N + DG + T C I PG N TY ++ +DQ G+ Sbjct: 70 NLIINVFNSLDEPFLLSWNGIQQRHNSFQDGV-YGTTCPIPPGRNLTY-ILQVKDQIGSF 127 Query: 128 WWHAHSDWTRAS-VHGAIVILPTEGTTYPFPKPDGDHLLVLGTYSQTS 174 ++ + +A+ G I IL PFP P GD+ +++G + +++ Sbjct: 128 YYFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPSGDYTVLIGDWYKSN 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10907 (415 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10475 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19945 (463 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13297 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59383 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53854 (532 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55460 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53383 (292 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45652 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3735 248 2e-68 >Contig3735 Length = 260 Score = 248 bits (634), Expect = 2e-68, Method: Compositional matrix adjust. Identities = 133/221 (60%), Positives = 151/221 (68%), Gaps = 2/221 (0%) Query: 35 IPLPRGPSFHFSTLVPQPGLGPFSSWNGLRHLGISVKQKSLKIGRRGRCKGKVVYASLFG 94 I P+ H S + PQ GL PFS W+GL+ L +S + KS K R+GRCKG VVYASLFG Sbjct: 37 ISHPKNQKLHLSAVFPQLGLSPFSPWSGLKQLSVSFRPKSSKPERKGRCKGVVVYASLFG 96 Query: 95 VGAPEALVIGVVALLVFGPKGLAEVARNLGKTLREFQPTIKELQEVSKEFKSTLEKEIGF 154 VGAPEALVIGVVALLVFGPKGLAEVARNLGKTLR FQPTI+ELQEVS++FKSTLEKEIG Sbjct: 97 VGAPEALVIGVVALLVFGPKGLAEVARNLGKTLRAFQPTIRELQEVSRDFKSTLEKEIGL 156 Query: 155 DEISSSIQDTYXXXXXXXXXXXXXXXAGIEDSGNVVDPNGAPSLNKAYSSEEYLKITEEQ 214 D+ISSS +TY + DS DPNGAPS N+AY++EEYLKITEEQ Sbjct: 157 DDISSSSINTYNSKITGSPSATPSTTSN-GDSETTTDPNGAPSPNRAYTTEEYLKITEEQ 215 Query: 215 LKXXXXXXXXXTPPPGESQLEPQTEPLGAVQEGATAIPPSK 255 LK T P ESQ P P G V+E A PPS+ Sbjct: 216 LKATAAQNQGQTTSPVESQ-PPSQAPQGTVEETAVKTPPSQ 255 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57539 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60833 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19092 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63036 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6626 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 92 3e-21 >89550571 Length = 226 Score = 91.7 bits (226), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 54/134 (40%), Positives = 83/134 (61%), Gaps = 4/134 (2%) Query: 5 KIQMRRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSSSNMQS 64 KI++ +I+N +RQVT+SKRR GLLKKA ELSVLCD E +VIIFS G+L E SSS+ + Sbjct: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSSTKD 67 Query: 65 AIERYREHAKQVETNNPELEQYMQNLKQDAESMAKKIELLEVSQRKLLGQGLSSCSLDEI 124 I RY E N L+Q +L+ D ++ +I R++ G+ L ++DE+ Sbjct: 68 VITRYESQTGD-EGN---LDQSSLDLQHDCIKLSNEIADKSRVLRQMNGEDLEGLNIDEL 123 Query: 125 LEIDSQLEKSLKSI 138 ++++++ SL + Sbjct: 124 QRLETKIDGSLNRV 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20094 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65963 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28469 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13709 (426 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23749 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12866259 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2099 478 e-137 >Contig2099 Length = 263 Score = 478 bits (1229), Expect = e-137, Method: Compositional matrix adjust. Identities = 236/265 (89%), Positives = 248/265 (93%), Gaps = 3/265 (1%) Query: 1 MAASIMALSSPSFAGTTVKLGPNASDILGGGRVSMRKTGFKA-PSGSPWYGPDRVLYLGP 59 MAAS MALSSP+FAG V+L P +++ G GR+SMRKT KA SGSPWYGPDRV YLGP Sbjct: 1 MAASTMALSSPTFAGKAVQLAP--TEVFGTGRISMRKTVGKAVSSGSPWYGPDRVKYLGP 58 Query: 60 LSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSR 119 SG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+R Sbjct: 59 FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAR 118 Query: 120 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGP 179 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGP Sbjct: 119 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGP 178 Query: 180 LGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE 239 LGEV DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLE Sbjct: 179 LGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLE 238 Query: 240 NLADHLADPVNNNAWAYATNFVPGK 264 NLADHLADPVNNNAW+YATNFVPGK Sbjct: 239 NLADHLADPVNNNAWSYATNFVPGK 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56279 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39660 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6966261 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5162 80 2e-17 >Contig5162 Length = 448 Score = 79.7 bits (195), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 34/63 (53%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Query: 78 DSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPARKQVERSRVDPTMLVVTYSCEHNHPWP 137 D + WRKYGQK +KG+P PR YY+C+S+ GCP RK VER+ D ++ TY +HNH P Sbjct: 385 DGYRWRKYGQKVVKGNPNPRSYYKCTST-GCPVRKHVERASHDMRAVITTYEGKHNHDVP 443 Query: 138 ASR 140 A+R Sbjct: 444 AAR 446 Score = 63.2 bits (152), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Query: 78 DSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPARKQVERSRVDPTMLVVTYSCEHNHPWP 137 D + WRKYGQK +KGS PR YY+C+ CP +K+VERS +D + + Y HNH P Sbjct: 217 DGYNWRKYGQKQVKGSENPRSYYKCTFP-NCPTKKKVERS-LDGQITQIVYKGSHNHAKP 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15977 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9834 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1732 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv166265 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2242 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1727 (325 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21228 (503 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45541 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65214 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 73 7e-16 >Contig3804 Length = 391 Score = 73.2 bits (178), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 38/77 (49%), Positives = 45/77 (58%), Gaps = 1/77 (1%) Query: 46 TSSALEPARTIAKKHYRGVRRRPWGKYAAEIRDSAKHGARTWLGTFETXXXXXXXXXXXX 105 S A + A+ K YRG+R+RPWGK+AAEIRD K G R WLGTF T Sbjct: 103 NSQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRK-GVRVWLGTFNTAEEAARAYDAEA 161 Query: 106 FRMRGSKALLNFPVIAP 122 R+RG KA +NFP AP Sbjct: 162 RRIRGKKAKVNFPEEAP 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv583 (42 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1104 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43494 (505 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41034 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38447 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43152 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5788 141 1e-36 >Contig5788 Length = 224 Score = 141 bits (355), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 69/122 (56%), Positives = 89/122 (72%), Gaps = 1/122 (0%) Query: 1 MDHFMDNPFLSTSRGMGTG-IRRSWDVKETDDALHLRVDMPGLSKEDVKVSVEQNTLTIQ 59 MD FM+NP+L+ RG+G G RR WDVKET+D+L LR+DMPGL+KEDVK+SVEQ TLT++ Sbjct: 103 MDQFMENPYLAAYRGLGAGGSRRGWDVKETEDSLLLRMDMPGLNKEDVKISVEQGTLTVK 162 Query: 60 GEEKNXXXXXXXXXXXXXXIDLPEKLYKTGEIKAEMNKGVLKIVVPKLKEEERTDVINVK 119 GE K+ +DLP K+Y+ IKAEM GVLK+VVPK+KEEE+ +V VK Sbjct: 163 GEGKDPEGEEDGGRRFSTRLDLPAKIYELNSIKAEMKNGVLKLVVPKVKEEEKKNVFEVK 222 Query: 120 VE 121 +E Sbjct: 223 IE 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16110 (298 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158363934 178 3e-47 >158363934 Length = 240 Score = 178 bits (452), Expect = 3e-47, Method: Compositional matrix adjust. Identities = 87/236 (36%), Positives = 145/236 (61%), Gaps = 3/236 (1%) Query: 62 LWQWGDLIPYLVPYFNVYVPDLLFFGDSYTTRPERTESFQAQCVMRVMEAKSVKKMSLIG 121 +WQW + + P FNVYVPDL+FFG S TT P+R E+FQA V +++E V++ S++G Sbjct: 1 MWQWRKQVQFFTPNFNVYVPDLVFFGRSTTTSPDRAETFQAASVAKLLEKLGVERFSVVG 60 Query: 122 LSYGGFVGYSMAAQFKEAIERVVICGAGVCLEEKDLEKGLFKVSHIEDAASILLPQTPEK 181 SYGGFV Y +A + E +E+VVI +GV + +D E L K +++E ++LP T + Sbjct: 61 TSYGGFVAYHVARMWPERVEKVVIASSGVNMRGRDSE-ALLKRANVEKIEDLMLPATAAQ 119 Query: 182 LRELLSYTFYKPPRGLPSCLLNDFIQVMCTEFVEERKDLIRA--IPKDRKLSELPTIPQP 239 LR+L+ +K +P +ND I+ + ++ +E+ +L++ I +D K + P + Sbjct: 120 LRKLVRLAMFKKVDMIPQFFMNDLIEKLYSDKRKEKMELLKGVTIGRDDKANISPLDDKE 179 Query: 240 TLIIWGDQDKVFPVELAHRLKRHLGEEAQLVIISNAGHTFIIEKPKETFKYLKSFL 295 LI+WG+ D++FP+E+A LK+ +G +A+L +I N H IE + +++FL Sbjct: 180 VLIVWGESDQIFPLEMATELKQLMGTKARLEVIKNTSHMPQIEDSVQFNHIVQNFL 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8310 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4384 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3268 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 71 5e-15 >Contig3804 Length = 391 Score = 71.2 bits (173), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 32/67 (47%), Positives = 41/67 (61%) Query: 11 KPSANAKEVHFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTXXXXXXXXXXXXXXFRGA 70 K + ++ +RG+R+RPWG++AAEIRDP K RVWLGTF+T RG Sbjct: 108 KSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGK 167 Query: 71 KAKTNFP 77 KAK NFP Sbjct: 168 KAKVNFP 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11666263 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5128 (356 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27164 (381 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48577 (514 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1484 400 e-114 >Contig1484 Length = 242 Score = 400 bits (1029), Expect = e-114, Method: Compositional matrix adjust. Identities = 185/242 (76%), Positives = 216/242 (89%) Query: 273 MGEVLIDGETTGYCAGGCAAIADSGTSLLAGPTAVVAMINHAIGATGVVSQECKTVVAQY 332 MG+VLIDG+TTG+CAGGCAAIADSGTSLL GPT ++ +NHAIGATG+VSQECKTVVA+Y Sbjct: 1 MGDVLIDGKTTGFCAGGCAAIADSGTSLLVGPTTIITELNHAIGATGIVSQECKTVVAEY 60 Query: 333 GETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIESVVDEKNGDKSSGVHDAGCSACE 392 G+TI+ ++L++ PQKICSQIGLCTFDGTRGV +GI+SVVDE N S+G+ DA CSACE Sbjct: 61 GDTIIKMILAKDQPQKICSQIGLCTFDGTRGVSVGIKSVVDENNHKSSAGLSDAMCSACE 120 Query: 393 MAVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGESAVDCLQLSSMPNVSLTIGGKVFD 452 M VVWMQ+QL+QNQT++RIL+YVN+LCDRLPSPMGESAVDC LSSMP+VS TIGGK FD Sbjct: 121 MTVVWMQNQLKQNQTQDRILDYVNQLCDRLPSPMGESAVDCAGLSSMPSVSFTIGGKQFD 180 Query: 453 LSANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWILGDVFMGRYHTVFDYGNMRVGFAE 512 L+ +YVLKVGEG AQCISGF A+DVPPPRGPLWILGDVFMG+YHTVFD+G R+GFAE Sbjct: 181 LAPEQYVLKVGEGEVAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVFDFGKERIGFAE 240 Query: 513 AA 514 AA Sbjct: 241 AA 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10975 (393 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2870 222 3e-60 >Contig2870 Length = 408 Score = 222 bits (565), Expect = 3e-60, Method: Compositional matrix adjust. Identities = 117/294 (39%), Positives = 178/294 (60%), Gaps = 3/294 (1%) Query: 100 LKIGIYFATWWALNVVFNIYNKKVLNAFPYPWXXXXXXXXXXXXXXXISWAVRIAEPPKT 159 L G +F W+ LNV+FNI NKK+ N FPYP+ ISWAV + + Sbjct: 104 LVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLISWAVGLPKRAPM 163 Query: 160 DLDFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLLGETFPVP 219 D + K L PVA H +GHV + VS + VAVSFTH IK+ EP F+ S+F+LG++ P+ Sbjct: 164 DSNQLKLLIPVAACHALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFILGQSIPLS 223 Query: 220 VYFSLLPIIGGCALAAVTELNFNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVGGMNYYA 279 ++ SL P++ G ++A++TEL+FN GF+ AMISN++F +R+I+SK+ M + N YA Sbjct: 224 LWLSLAPVVLGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAM--TDMDSTNLYA 281 Query: 280 CLSMLSLLILTPFAIAVEGPQMWAAGWQKAISQIG-PNFIWWVAAQSVFYHLYNQVSYMS 338 +S+++L P A+ +EGPQ+ G+ AI+++G FI + +FYHLYNQ++ + Sbjct: 282 YISIIALFFCLPPALILEGPQLLKHGFADAIAKVGLVKFITDLVWVGLFYHLYNQLATNT 341 Query: 339 LDQISPLTFSIGNTMKRXXXXXXXXXXFHTPVQPVNALGAAIAILGTFLYSQAK 392 L++++PLT ++GN +KR F + +G AIAI G +YS K Sbjct: 342 LERVAPLTHAVGNVLKRVFVIGFSIVIFGNKISTQTGIGTAIAIAGVAIYSYLK 395 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59138 (341 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56886 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40797 (71 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8263 (460 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19366261 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6466264 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3122 (506 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65797 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22966261 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49553 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33541 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34883 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158359219 68 1e-14 >158359219 Length = 59 Score = 67.8 bits (164), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 4/58 (6%) Query: 8 GEE-GGPAGPKVLRMLYFVGAGFICTAAINKWRDLQRKS---AQQHADQLPEKPANNL 61 GEE GP PK++R+LYFVGA FICT INKWR+LQRKS +Q QL + AN L Sbjct: 1 GEEIAGPPAPKLVRLLYFVGAAFICTVGINKWRELQRKSLNLEKQKQQQLAQNTANAL 58 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24125 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11572 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4766 62 2e-12 >Contig4766 Length = 180 Score = 62.4 bits (150), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 40/126 (31%), Positives = 55/126 (43%), Gaps = 35/126 (27%) Query: 105 LDVRPEAEFKEAHPPGAINVQ-IYRLIKEWTAWDXXXXXXXXXXXXXXXTEENPEFMQSV 163 LDVR EF HP GA+N+ +YR+ +NPEF++ V Sbjct: 87 LDVRTPEEFSAGHPSGAVNIPYLYRV--------------------GSGMSKNPEFVKEV 126 Query: 164 ESKIDKSAKIIVACSSGGTMKPSQNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLYTWF 223 S K +IIV C G RS++AA LV G+T + + GG TW Sbjct: 127 SSHFRKHDEIIVGCQLG--------------KRSMMAATDLVAAGFTGITDMAGGYATWT 172 Query: 224 KEGLPS 229 + GLP+ Sbjct: 173 QNGLPT 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13534 (67 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2167 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39992 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24718 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37428 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34509 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52603 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5766 100 1e-23 >Contig5766 Length = 173 Score = 99.8 bits (247), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 47/55 (85%), Positives = 50/55 (90%) Query: 14 SFPPTAITTEQIQKYLDENKQLILAILENQNLGKLAECAQYQAQLQKNLIYLAAI 68 S PP ITTEQIQK LDENK+LILAIL+NQNLGKLAECAQYQ QLQKNL+YLAAI Sbjct: 14 SLPPNTITTEQIQKCLDENKKLILAILDNQNLGKLAECAQYQTQLQKNLMYLAAI 68 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49015 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51469 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14666265 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60386 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26266262 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3113 (393 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65380 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51169 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47835 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14001 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig839 271 2e-75 >Contig839 Length = 152 Score = 271 bits (692), Expect = 2e-75, Method: Compositional matrix adjust. Identities = 132/152 (86%), Positives = 136/152 (89%) Query: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 MSLVANEEFQHILRV+NTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVDMNKRAGELS Sbjct: 1 MSLVANEEFQHILRVMNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60 Query: 61 AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 A E+ENLM IVANPRQFKIPDWFLNRKKDYKDG+YSQVV+NALDMKLRDDLERLKKIRNH Sbjct: 61 AQEIENLMHIVANPRQFKIPDWFLNRKKDYKDGKYSQVVANALDMKLRDDLERLKKIRNH 120 Query: 121 RGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 152 RGLRHYWGLRVRGQH SKKR Sbjct: 121 RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4698 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40297 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16198 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41286 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21434 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566261 (365 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5264 675 0.0 >Contig5264 Length = 447 Score = 675 bits (1742), Expect = 0.0, Method: Compositional matrix adjust. Identities = 324/337 (96%), Positives = 332/337 (98%) Query: 1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD 240 VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD Sbjct: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEASNFTSXVIIMNH 337 KNVAVKDLKRGFVASNSKDDPAKEA+NFTS VIIMNH Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNH 337 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566257 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4544 357 e-101 >Contig4544 Length = 447 Score = 357 bits (915), Expect = e-101, Method: Compositional matrix adjust. Identities = 173/184 (94%), Positives = 179/184 (97%) Query: 1 MCVPFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAK 60 M V F P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK Sbjct: 264 MVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK 323 Query: 61 EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLK 120 EAANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF EILTKIDRRSGKELEKEPKFLK Sbjct: 324 EAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLK 383 Query: 121 NGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSGAKVTKSA 180 NGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VEKKDPSGAKVTKSA Sbjct: 384 NGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSGAKVTKSA 443 Query: 181 AKKK 184 AKKK Sbjct: 444 AKKK 447 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59489 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25720 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5896 231 2e-63 >Contig5896 Length = 167 Score = 231 bits (590), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 111/164 (67%), Positives = 124/164 (75%) Query: 5 STNQASXXXXXXXXXXCKNPVDGFSAGLVDESNIFEWSVTIIGPPDTLYDGGFFNAIMSF 64 + +QAS CKNPVDGFSAGLVDE+NIFEWSVTIIGPPDTLY+GGFFNAIMSF Sbjct: 2 AASQASLLLQKQLKDLCKNPVDGFSAGLVDENNIFEWSVTIIGPPDTLYEGGFFNAIMSF 61 Query: 65 PPNYPNSPPTVKFTSEVWHPNVYPDGRVCISILHPPGEDPNGYELASERWMPIHTVEXXX 124 P NYPNSPPTVKFTSE+WHPNVYPDGRVCISILHPPG+DPNGYELASERW P+HTVE Sbjct: 62 PSNYPNSPPTVKFTSELWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVESIV 121 Query: 125 XXXXXXXXXPNDESPANIEAAAELVNYKLCCLHALCMCIPKCCQ 168 PNDESPAN+EAA E + + + C+ K + Sbjct: 122 LSIISMLSSPNDESPANVEAAKEWRDRRDDFKKKVGRCVRKSQE 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3106 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24 476 e-137 >Contig24 Length = 471 Score = 476 bits (1226), Expect = e-137, Method: Compositional matrix adjust. Identities = 222/251 (88%), Positives = 237/251 (94%) Query: 1 MCCLFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII 60 MCCLFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNK+ENPRVPII Sbjct: 219 MCCLFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKQENPRVPII 278 Query: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPNREDRIGVCKGIFRSDNVPDDDIVKIVDTFPGQS 120 VTGNDFSTLYAPLIRDGRMEKFYWAP REDRIGVC GIF++DNVP DDIVK+VD FPGQS Sbjct: 279 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCTGIFKTDNVPTDDIVKLVDAFPGQS 338 Query: 121 IDFFGALRARVYDDEVRKWISGVGVDFIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 180 IDFFGALRARVYDDEVRKW++ VGV+ +GK+LVNSKEGPPTFEQPKMT+ KLLEYGNMLV Sbjct: 339 IDFFGALRARVYDDEVRKWVASVGVEGVGKRLVNSKEGPPTFEQPKMTLAKLLEYGNMLV 398 Query: 181 MEQENVKRVQLADKYLSEAALGDANVDSIERGTFYGKAAQQVGVPVPEGCTDPSAANFDP 240 EQENVKRVQL+DKYL EAALGDAN D+I+ G FYGKAAQQ+ +PVPEGCTDPSAANFDP Sbjct: 399 QEQENVKRVQLSDKYLKEAALGDANDDAIKSGNFYGKAAQQIHIPVPEGCTDPSAANFDP 458 Query: 241 TARSDNGSCQY 251 TARSDNGSC Y Sbjct: 459 TARSDNGSCLY 469 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17018 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5844 205 1e-55 >Contig5844 Length = 161 Score = 205 bits (522), Expect = 1e-55, Method: Compositional matrix adjust. Identities = 99/158 (62%), Positives = 119/158 (75%) Query: 1 MAKDRKIGVAVDFSQGSNIALKWAIDNLLDKGDTLFFIHVKPSQGDESRNLLWSATGSPL 60 M KDR+IGVA+DFS+ S AL+WAIDNL+DKGDTL IH+ ++ DESRN+LW+ +GSPL Sbjct: 1 MVKDRRIGVAMDFSKSSKNALQWAIDNLVDKGDTLHIIHINNNKHDESRNVLWAKSGSPL 60 Query: 61 IPLEEFRDLDVAQKYEINLDPEFLGMLATASSQXXXXXXXXXYWGDARDKLCDAVAELKL 120 IPL EFR+L+V +KY + D E L ML T S Q YWGDAR+KL AV +LKL Sbjct: 61 IPLSEFRELEVMKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYWGDAREKLLQAVEDLKL 120 Query: 121 DSLVMGSRGLGTIQRTFLGSVTNYVMVHATCPVTIVKD 158 DSLVMGSRGLGT++R LGSV+NYVM A PVTIVKD Sbjct: 121 DSLVMGSRGLGTLKRIVLGSVSNYVMTQAPIPVTIVKD 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60079 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20041 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57327 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60046 (572 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3652 244 9e-67 >Contig3652 Length = 310 Score = 244 bits (623), Expect = 9e-67, Method: Compositional matrix adjust. Identities = 123/287 (42%), Positives = 177/287 (61%), Gaps = 27/287 (9%) Query: 14 AMERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKEADLTNIDLSD 73 A++RT +W+FSQEIP+DV V VGE +FSLHKF LV+K YIRKL+ ES + +++ I+L D Sbjct: 30 ALKRTSEWIFSQEIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLVSESTDDEISVIELPD 89 Query: 74 IPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDGNLSGRTEDFLKQVA 133 +PGG E FE AAKFCYG+NFEI+ N+A LRC +EYL MT++Y GNL GRT+ +L +VA Sbjct: 90 VPGGAEAFELAAKFCYGINFEISTENIAMLRCVSEYLLMTEEYAIGNLVGRTDAYLNEVA 149 Query: 134 LTSLSGAVVVLKSCEDLLPKAEELKIVQRCVDVASTKACNEANF---------------- 177 L SL+GAV VL + E LP AE++K+V RC+D + C ++ F Sbjct: 150 LKSLAGAVSVLHTAESFLPIAEKVKLVSRCIDAIAYMTCKDSQFCLSGRSDSGNESLSSS 209 Query: 178 ---PSRSPPNWWTEELSILDIGFFEKIIAAMKLRGAKSLTVASALITYTERTLRDLVRDH 234 ++ +WW E+L++L I F++ + AM RG K + L+ Y +++LR Sbjct: 210 AVYQTKPIVDWWAEDLTVLRIDTFQRALIAMMARGFKQYALGPILMLYAQKSLR------ 263 Query: 235 TGNGIRSSDTEDSNLRSRQRELLEAIVVLLPSERAALPIN-FLCCLL 280 GN + + + +R +LE IV LLP E+ + FLCC + Sbjct: 264 -GNIRQGKEKIEPRQEHEKRVVLETIVSLLPREKIQCQLAFFLCCFV 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41997 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33767 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37449 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13872 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1093 (304 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22966256 (306 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 236 8e-65 >158372667 Length = 230 Score = 236 bits (603), Expect = 8e-65, Method: Compositional matrix adjust. Identities = 122/232 (52%), Positives = 159/232 (68%), Gaps = 4/232 (1%) Query: 60 RIAIGQPQDTYHPDALKKALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIAEALG 119 +IA G + P+ + + EF T +F+FAG GS MA KL G+ T L A+ Sbjct: 3 KIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKL---GADTTVALFFIAIT 59 Query: 120 HGLGLFVAVSGAWNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLLLKFC 179 H L + V +S A +ISGGH+NPAVT G GG+ITL R +LYWI QLL +A +C LLK+ Sbjct: 60 HALVVAVMIS-AGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLKYL 118 Query: 180 THGMTTSAFAISSGETVWNAFVLEIVMTFGLVYTVYATAIDPRNGNVGIIAPLAIGLIVA 239 T G+TT +++SG + EI++TF L++TVYAT +DP+ G++ + P G +V Sbjct: 119 TGGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGFVVG 178 Query: 240 ANILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGFVYET 291 ANILAGGAF GASMNPA SFGPALVSWDWT+HWVYW GPLIGGG+AGF+YE+ Sbjct: 179 ANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYES 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23251 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2986 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1568 142 3e-36 >Contig1568 Length = 297 Score = 142 bits (357), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 84/157 (53%), Positives = 97/157 (61%), Gaps = 16/157 (10%) Query: 1 MEFWGVEVKAGESFKVKSEDDKILHLSQAALGESKKEKGNESVPLFLKIDQQKLVLGTLL 60 MEFWGVEVKAGE KVK + ++HLSQA LGE+KK +SV ++ K +QKLVLG L+ Sbjct: 1 MEFWGVEVKAGEPMKVKPDLGNVVHLSQACLGEAKK--AADSVVIYGKAKEQKLVLGHLI 58 Query: 61 PANIPQLSFDLVFDKEFELSHNWKNGSVFFMGYKSVL----PXXXXXXXXXXXXXXXXLP 116 P+ IPQLSFDLVFD+EFELSHNWKNGSV F GY+SV+ LP Sbjct: 59 PSQIPQLSFDLVFDEEFELSHNWKNGSVHFAGYQSVMGDDDDNSSEYDSSDSEEEEEELP 118 Query: 117 VNAIENGKPEPKVEQAKAVPTNANA------GKAKVK 147 V A ENG KVE AK NA GK KVK Sbjct: 119 VIATENG----KVENAKPASAKNNAVKPESSGKQKVK 151 Score = 65.5 bits (158), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 38/68 (55%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Query: 230 VSPQKTDGKKGGAHTATPHPNKKAGKTPAXXXXXXXXXXXXXXQVSCKSCSKTFNSENAL 289 +PQKTD KKGG HT TPHP KK GKTPA S SCSK F S+ AL Sbjct: 228 TTPQKTDAKKGG-HTDTPHPAKK-GKTPATDKSKAQTPKSAGGNFSWGSCSKAFGSDGAL 285 Query: 290 QSHSKAKH 297 QSH+KAKH Sbjct: 286 QSHNKAKH 293 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24066257 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4738 (411 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11466257 (503 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22766257 (356 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66240 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14109 (388 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4729 577 e-167 >Contig4729 Length = 303 Score = 577 bits (1488), Expect = e-167, Method: Compositional matrix adjust. Identities = 275/301 (91%), Positives = 288/301 (95%), Gaps = 1/301 (0%) Query: 2 ASAARLDLDGNAIKPMTICMIGAGGFIGSHLCEKLMAETMHKVLAVDVYSDKIKHLLEPS 61 +SA R+DLDG+ IKPMTICMIGAGGFIGSHLCEKLMAET HKVLA+DVY+DKIKHLLEPS Sbjct: 3 SSATRVDLDGSPIKPMTICMIGAGGFIGSHLCEKLMAETPHKVLALDVYNDKIKHLLEPS 62 Query: 62 T-HPWSDRIQFHRINIKHDSRLEGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDAL 120 HPWSDRIQFHR+NIKHDSRLEGLIK +DLTINLAAICTPADYNTRPLDTIYSNFIDAL Sbjct: 63 DGHPWSDRIQFHRLNIKHDSRLEGLIKTSDLTINLAAICTPADYNTRPLDTIYSNFIDAL 122 Query: 121 PVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLWQDPTYYVLKEDASPCIFGPIEKQ 180 PVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPL QDP YY+LKE+ SPCIFG IEKQ Sbjct: 123 PVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLRQDPEYYLLKENDSPCIFGSIEKQ 182 Query: 181 RWSYACAKQLIERLIYAEGAENDLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFS 240 RWSYACAKQLIERLIYAEGAEN LEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFS Sbjct: 183 RWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFS 242 Query: 241 NNLLRHEPLKLVDGGQSQRTFVYIKDAIEAVLLMIDNPARANGHIFNVGNPNNEVTVRQL 300 NNLLR EPLKLVDGG+SQRTFVYIKDAI+AV+LMI+NPARANGHIFNVGNPNNEVTVRQL Sbjct: 243 NNLLRREPLKLVDGGESQRTFVYIKDAIDAVMLMIENPARANGHIFNVGNPNNEVTVRQL 302 Query: 301 A 301 Sbjct: 303 G 303 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48346 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54183 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11995 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29302 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31003 (427 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 64 1e-12 >89552756 Length = 189 Score = 64.3 bits (155), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 48/127 (37%), Positives = 70/127 (55%), Gaps = 15/127 (11%) Query: 191 GSLENHLHDLPPGTKPLDWNSRMKIAAGAAKGLEYLHDKMYPPVIYRDLKCSNILLG--E 248 GSL+ L + +D R+ IA AA G+EYLH K +++ DLKC N+L+ + Sbjct: 4 GSLKQFLQK---KDRTIDRRKRLIIAMDAAFGMEYLHGK---NIVHFDLKCENLLVNMRD 57 Query: 249 GYHP--KLSDFGLAKVGPTGDKTHVSTRVMGTYGYCAPDY--AMTGQLTFKSDIYSFRVV 304 P K+ D GL+KV +T VS V GT + AP+ + +T K D+YSF +V Sbjct: 58 PQRPVCKIGDLGLSKVK---QQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIV 114 Query: 305 LLELITG 311 + EL+TG Sbjct: 115 MWELLTG 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3302 (652 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5220 1160 0.0 >Contig5220 Length = 647 Score = 1160 bits (3000), Expect = 0.0, Method: Compositional matrix adjust. Identities = 561/618 (90%), Positives = 582/618 (94%) Query: 1 MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 60 MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN Sbjct: 1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 60 Query: 61 QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYRGEEKQFSA 120 QVAMNPINTVFDAKRLIGRRF+D+SVQ D+KLWPFKV +GP +KPMI V Y+GEEKQF+A Sbjct: 61 QVAMNPINTVFDAKRLIGRRFTDASVQGDMKLWPFKVTSGPAEKPMIGVQYKGEEKQFAA 120 Query: 121 EEISSMVLIKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP 180 EEISSMVLIKMREIAEAYLG +IKNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP Sbjct: 121 EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP 180 Query: 181 TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240 TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD Sbjct: 181 TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240 Query: 241 NRMMNHFVQEFKRKHKKDISGSPRALRRLRTACERAKRTLSSTAQTTIEIDSLFDGIDFY 300 NRM+NHFVQEFKRK+KKDISG+PRALRRLRT+CERAKRTLSSTAQTTIEIDSL++GIDFY Sbjct: 241 NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY 300 Query: 301 TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGVHDVVLVGGSTRIPKVQQLLQDFF 360 +TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS VHDVVLVGGSTRIPKVQQLLQDFF Sbjct: 301 STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF 360 Query: 361 NGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLI 420 NGKELCKSINPDE ILSGEGNEKVQD ETAGGVMTVLI Sbjct: 361 NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 420 Query: 421 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 480 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI Sbjct: 421 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 480 Query: 481 NVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 540 VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK Sbjct: 481 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 540 Query: 541 KVEAKNALENYAYNMRNTIKDEKIGAKLPPEDKKKIEDAIEQAIQWLDANQLAEADEFED 600 KVEAKNALENYAYNMRNTIKDEKIG KLP DKKKIEDAIE AIQWLD+NQLAEADEFED Sbjct: 541 KVEAKNALENYAYNMRNTIKDEKIGEKLPGADKKKIEDAIEAAIQWLDSNQLAEADEFED 600 Query: 601 KMKELESLCNPIIAKMYQ 618 KMKELES+CNPIIAKMYQ Sbjct: 601 KMKELESICNPIIAKMYQ 618 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23866261 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35628 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38423 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58117 (516 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32059 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158354627 143 1e-36 >158354627 Length = 97 Score = 143 bits (360), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 62/92 (67%), Positives = 80/92 (86%), Gaps = 2/92 (2%) Query: 177 QLTKNLACEWAEDNIRSNAVAPWYIKTPMVDQMLSN--KTFLEGVINRTPLRRVGDPKEV 234 QL KNLACEWA+DNIR N+VAPW ++TP+ + M ++ K+ LE VI+RTPL R+G+P+EV Sbjct: 1 QLAKNLACEWAKDNIRINSVAPWVVRTPLAEPMFTDDGKSLLEAVISRTPLGRIGEPEEV 60 Query: 235 SSVVAFLCLPASSYITGQTICVDGGMTVNGFE 266 S++VAFLCLPA+SYITGQT CVDGGMT+NGF+ Sbjct: 61 SALVAFLCLPAASYITGQTFCVDGGMTINGFQ 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16221 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16325 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43351 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20367 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54598 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3140 470 e-135 >Contig3140 Length = 264 Score = 470 bits (1209), Expect = e-135, Method: Compositional matrix adjust. Identities = 228/264 (86%), Positives = 237/264 (89%) Query: 1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE 60 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLI+ILRNRLKYALTYRE Sbjct: 1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE 60 Query: 61 VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK 120 VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK Sbjct: 61 VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK 120 Query: 121 FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDXXXX 180 FKLCKVRSVQFGQK IPY+NTYDGRTIRYPDPLIKANDTIKLDLE+NK+ DFIKFD Sbjct: 121 FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKVIDFIKFDVGNV 180 Query: 181 XXXXXXXXXXXXXXIKNREKRKGSFETIHVQDATGHEFATRLGNVFIIGKGTKPWVTLPK 240 IKNREK KGSFETIHVQDA GHEFATRLGNVF IGKGTKPWV+LPK Sbjct: 181 VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPK 240 Query: 241 GKGIKLSIIEEAQKRLAAQAASSA 264 GKGIKL+IIEEA+KR AA ++A Sbjct: 241 GKGIKLTIIEEARKRQAALQTATA 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49462 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15446 (50 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65578 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13445 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48827 (446 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1900 362 e-102 >Contig1900 Length = 451 Score = 362 bits (930), Expect = e-102, Method: Compositional matrix adjust. Identities = 172/435 (39%), Positives = 259/435 (59%), Gaps = 16/435 (3%) Query: 1 MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTG-----RYTGNSDLQLERVNVYYNEAS 55 MRE + + GQ G Q+G+ WE+ C EHGI P G + G D + N +++E Sbjct: 1 MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGD---DAFNTFFSETG 57 Query: 56 CGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDS 115 G+ VPRAV +DLEP +D VRTG Y Q+F P+ + G+ A NN+A+GHYT G E++D Sbjct: 58 AGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDL 117 Query: 116 VLDVVRKEAENCDCLQGFQVCHXXXXXXXXXXXXXXISKIREEYPDRMMLTFSVFPSPKV 175 LD +RK A+NC LQGF V + + ++ +Y + L F+V+PSP+V Sbjct: 118 CLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQV 177 Query: 176 SDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSG 235 S +VVEPYN+ LS H L+E+ D ++LDNEA+YDIC R+L + P++ +LN L+S +S Sbjct: 178 STSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISS 237 Query: 236 VTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWD 295 +T LRF G LN D+ + NL+P+PR+HF + +AP+ S + L+V E+T ++ Sbjct: 238 LTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFE 297 Query: 296 AKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCD 355 +MM DPRHG+Y+ M+RG + K+V+ + ++ K + FV+W P K + Sbjct: 298 PSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINY 357 Query: 356 IPPR--------GLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEME 407 PP + A I NSTS+ E+F R+ +F M+ ++AF+HWY GEGM+E E Sbjct: 358 QPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGE 417 Query: 408 FTEAESNMNDLVSEY 422 F+EA ++ L +Y Sbjct: 418 FSEAREDLAALEKDY 432 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47723 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44899 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566262 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4544 417 e-119 >Contig4544 Length = 447 Score = 417 bits (1072), Expect = e-119, Method: Compositional matrix adjust. Identities = 202/214 (94%), Positives = 210/214 (98%) Query: 10 LRLPLQDVYKIGGIGTVPVGRVETVVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPG 69 LRLPLQDVYKIGGIGTVPVGRVET ++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPG Sbjct: 234 LRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPG 293 Query: 70 DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT 129 DNVGFNVKNVAVKDLKRG+VASNSKDDPAKEAANFT+QVIIMNHPGQIGNGYAPVLDCHT Sbjct: 294 DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT 353 Query: 130 SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA 189 SHIAVKF EILTKIDRRSGKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFA Sbjct: 354 SHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFA 413 Query: 190 VRDMRQTVAVGVIKSVEKKDPSGAKVTKSAAKKK 223 VRDMRQTVAVGVIK+VEKKDPSGAKVTKSAAKKK Sbjct: 414 VRDMRQTVAVGVIKAVEKKDPSGAKVTKSAAKKK 447 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566259 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4544 805 0.0 >Contig4544 Length = 447 Score = 805 bits (2079), Expect = 0.0, Method: Compositional matrix adjust. Identities = 383/399 (95%), Positives = 396/399 (99%) Query: 1 MNKRSFKYAWVLDKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQ 60 MNKRSFKYAWVLDKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQ Sbjct: 49 MNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQ 108 Query: 61 ADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYD 120 ADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDAT+PKYSKARYD Sbjct: 109 ADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYD 168 Query: 121 EIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKR 180 EIVKEVSSYLKK+GYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKR Sbjct: 169 EIVKEVSSYLKKIGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKR 228 Query: 181 PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLP 240 P+DKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L Sbjct: 229 PSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQ 288 Query: 241 EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPV 300 EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKEAANFT+QVIIMNHPGQIGNGYAPV Sbjct: 289 EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPV 348 Query: 301 LDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPP 360 LDCHTSHIAVKF EILTKIDRRSGKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPP Sbjct: 349 LDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPP 408 Query: 361 LGRFAVRDMRQTVAVGVIKSVEKKDPSGAKVTKSAAKKK 399 LGRFAVRDMRQTVAVGVIK+VEKKDPSGAKVTKSAAKKK Sbjct: 409 LGRFAVRDMRQTVAVGVIKAVEKKDPSGAKVTKSAAKKK 447 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34966257 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4544 150 1e-39 >Contig4544 Length = 447 Score = 150 bits (380), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 74/77 (96%), Positives = 77/77 (100%) Query: 10 NGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE 69 +GKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VE Sbjct: 371 SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVE 430 Query: 70 KKDPSGAKVTKSAAKKK 86 KKDPSGAKVTKSAAKKK Sbjct: 431 KKDPSGAKVTKSAAKKK 447 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22361 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32189 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46331 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4034 103 2e-24 >Contig4034 Length = 239 Score = 103 bits (257), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 75/227 (33%), Positives = 109/227 (48%), Gaps = 13/227 (5%) Query: 114 FYGTRRNALFCRSWFPVAGEM-KGIMIIIHGLN-EHSGRYADFAKQLTSCSFGVYAMDWI 171 + +R LF W P + K +++I HG E S A +L F +Y +D+ Sbjct: 15 IFNSRGMKLFTCKWLPENNKPPKALILICHGYGMECSITMNSTAIRLAKAGFAIYGIDYE 74 Query: 172 GHGGSDGLHGYVPSLDHVVADTGAFLEKI--KSENPGIPCFLFGHSTGGAVVLKA-ASYP 228 GHG S GL G+V S D VV D + I EN G +L G S GGAV L P Sbjct: 75 GHGKSAGLAGFVKSFDAVVDDCTSHFTNICESKENKGKTRYLLGESMGGAVALLVHRKKP 134 Query: 229 EIEGILEGIVLTSPALRV----KPAHPIVGAVAPIFSLVVPRYQFKGANKRGIPVSRDPA 284 E +G VL +P ++ KP+ P+V +V V+P ++ N + P Sbjct: 135 EY---WDGAVLVAPMCKISDEMKPS-PVVVSVLTQLCRVIPTWKIIPTNDVIDFAFKVPE 190 Query: 285 AMLAKYSDPLVYTGPIRVRTGHEILRISSYLTRNFKSVTVPFLVLHG 331 +P Y G R++TG E+LR+S+ L + + VT+PFL+LHG Sbjct: 191 VRKQVRENPYCYKGRPRLQTGTELLRVSTELEQRLQEVTLPFLILHG 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45712 (346 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5214 266 9e-74 >Contig5214 Length = 355 Score = 266 bits (681), Expect = 9e-74, Method: Compositional matrix adjust. Identities = 133/328 (40%), Positives = 193/328 (58%), Gaps = 12/328 (3%) Query: 14 GGKIQKDEVLSAVEKYEKYHVCYGGEEEERKANYSDMVNKYYDLVTSFYEFGWGESFHFA 73 GG I ++V + +Y + ++ E D V+ +Y+LVT YE+GWG+SFHF+ Sbjct: 39 GGSISAEKVQDSYNQYWSFF--RRPKQIEASEKVPDFVDTFYNLVTDIYEWGWGQSFHFS 96 Query: 74 PRWKGESLRESIRRHEHFLALQLGVKPGQKVLDVGCGIGGPLREIARFSSTSVTGLNNNE 133 P G+S +++ R HE + VKPGQ++LDVGCG+GGP+R IA S +V G+ NE Sbjct: 97 PSVAGKSHKDATRLHEEMAVDLINVKPGQRILDVGCGVGGPMRAIAAHSRANVVGITINE 156 Query: 134 YQITRGRELNCIAGVDKTCDFVKADFMKMPFSDNTFDAVYAIEATCHAPDALGCYKEIYR 193 YQ+ R R N AG+D C+ V +F++MPF +N+FD Y+IEATCHAP Y EI+R Sbjct: 157 YQVKRARLHNKKAGLDSLCEVVCGNFLEMPFPENSFDGAYSIEATCHAPKLEEVYAEIFR 216 Query: 194 VLKPGQCFAAYEWCMTDAFDPNNQEHQKIKAEIEIGDGLPDIRLTRQCLEALKQAGFEVI 253 VLKPG + +YEW TD ++ ++ EH+++ IE GD LP +R EA ++ GFEV+ Sbjct: 217 VLKPGALYVSYEWVTTDKYNGDDAEHREVIQGIERGDALPGLRAQVDIAEAARKVGFEVV 276 Query: 254 WEKDLAVGSPLPWYLPLDKSHFSLSSFRLTAVGRFITKNMVKALEFVGLAPKGSQRVQAF 313 EKDLA W+ + ++ + + +V L F+G+APKG+ V Sbjct: 277 KEKDLAKPPSEAWW----------TRLKMGRIAYWRNHILVTVLSFLGIAPKGTVDVHEM 326 Query: 314 LEKAAEGLVDGGKKEIFTPMYFFLARKP 341 L A+ L GG+ IFTPM+ L RKP Sbjct: 327 LFVTADYLTRGGETGIFTPMHMILCRKP 354 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14908 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6492 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39374 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13066260 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8443 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38760 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23393 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47556 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2649 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43701 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26566259 (343 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44921 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28056 (310 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566265 (364 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540286 154 8e-40 >89540286 Length = 247 Score = 154 bits (388), Expect = 8e-40, Method: Compositional matrix adjust. Identities = 81/164 (49%), Positives = 111/164 (67%), Gaps = 5/164 (3%) Query: 138 YAATEDQLHDDPNVALFFFEKNMQ-PGTKMELHFIR-DANLATFLPRQVANSIPFSSKKF 195 Y +++++ +P++ FF +++Q G + L ++ +N AT L RQVA SIPFSS K Sbjct: 83 YGSSKEETPAEPDLTTFFQGQDLQQKGKTVTLRLLKPTSNKATLLSRQVAKSIPFSSSKL 142 Query: 196 PEILNEFSIKPESEEAETIKNTIRECEEPGIKGEEKYCATSLESMVDFSTSKLGKGVQVI 255 PEIL F +KP S A +K TI ECE P IK E KYC TSLES++DF+ S LGK V V Sbjct: 143 PEILTYFGVKPNSLAAGLMKQTIEECEAPAIKREGKYCLTSLESLIDFTVSNLGKDVGVY 202 Query: 256 STEVEKETPEQQYTI-TTGVKKLAGDKAVVCHKQSYPYAVFYCH 298 +TE E + +Q+Y+I TTGV+ + GDK +VCHK++Y Y VFYCH Sbjct: 203 TTEAETD-KKQEYSIETTGVQSI-GDKIIVCHKENYVYGVFYCH 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11866265 (337 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540286 145 3e-37 >89540286 Length = 247 Score = 145 bits (366), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 89/249 (35%), Positives = 132/249 (53%), Gaps = 45/249 (18%) Query: 27 YWNSMLPNTPMP-KSIRDVLRPDLVEDKSSSVDVGKGGVNVDAXXXXXXXXXXXXXXXXX 85 YWN+ P +P+P K+++ +L + ++S+ GK +N+ Sbjct: 37 YWNTAFPKSPLPSKAVQQLLN---LAGETSNTGFGKQALNL------------------- 74 Query: 86 XXXXXXHKGKPVYVGVTPGPNPFAYKYAATEDQLHADPSVALFFMEKDMRP-GTKMNLHF 144 P Y +++++ A+P + FF +D++ G + L Sbjct: 75 ------------------APEIPINSYGSSKEETPAEPDLTTFFQGQDLQQKGKTVTLRL 116 Query: 145 IKNT-KEATFLP-QSEHPIIFSSEKLPEILKHFSVKPESVEAQIIKNTIKECEAPGTKGE 202 +K T +AT L Q I FSS KLPEIL +F VKP S+ A ++K TI+ECEAP K E Sbjct: 117 LKPTSNKATLLSRQVAKSIPFSSSKLPEILTYFGVKPNSLAAGLMKQTIEECEAPAIKRE 176 Query: 203 EKYCATSLESMIDFSISKLGKRVQAISTEVVKETQKQKYTIAAGVKKMAGDESVVCHKQN 262 KYC TSLES+IDF++S LGK V +TE + +KQ+Y+I + GD+ +VCHK+N Sbjct: 177 GKYCLTSLESLIDFTVSNLGKDVGVYTTE-AETDKKQEYSIETTGVQSIGDKIIVCHKEN 235 Query: 263 YPYAVFYCH 271 Y Y VFYCH Sbjct: 236 YVYGVFYCH 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60795 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv408 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2353 (368 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2471 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48056 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43227 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25866264 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58648 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61809 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12996 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59526 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14935 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4327 (369 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42876 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35984 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45747 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29628 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2658 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3027 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12566264 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12566264 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2671 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20031 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5776 173 1e-45 >Contig5776 Length = 289 Score = 173 bits (438), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 92/241 (38%), Positives = 141/241 (58%), Gaps = 9/241 (3%) Query: 1 MAKAVAREVRMAASIMRLHFHDCFVKGCDAXXXXXXXXXXXXEKNSVPNRN-SARGFEVI 59 + K ++ AA ++RLHFHDCFV+GCD E+ + PN + A+ F++I Sbjct: 56 LKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPSEQQAPPNLSLRAKAFQII 115 Query: 60 DDIKSAVEKECPHTVSCSDILAIAARDSSVLTGGPSWEVPLGRRDSRG-ASLSGSNNNIP 118 +D++ V +C VSC+D+ A+AARD+ L+GGP +EVPLGR+D A+ + + N+P Sbjct: 116 NDLREIVHSKCGRVVSCADLTALAARDAVFLSGGPEYEVPLGRKDGLNFATRNETLANLP 175 Query: 119 APNNTFQTILTKFKLHGLNIVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGRPDYSLDQS 178 AP + +LT L+ D+VALSG HTIG CTSF RLY D S+D++ Sbjct: 176 APTSNTTKLLTDLAKKNLDATDVVALSGGHTIGLGHCTSFTGRLYPTQ-----DASMDKT 230 Query: 179 YAAQLRARCPRSGGDQNLFFLDFVSPTKFDNSYFKNILASKGLLSSDQLLFTKNQASMDL 238 +A L+ CP + + LD SP FDN Y+ +++ + L +SDQ L+T ++ + D+ Sbjct: 231 FANDLKQVCPAADTNATT-VLDIRSPDTFDNKYYVDLMNRQCLFTSDQDLYT-DKRTRDI 288 Query: 239 V 239 V Sbjct: 289 V 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12740 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 98 4e-23 >89550571 Length = 226 Score = 97.8 bits (242), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 66/164 (40%), Positives = 98/164 (59%), Gaps = 12/164 (7%) Query: 5 KIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYTSPTITT 64 KI+I++I+N RQVTYSKRR G+ KKA+EL+VLCD + S+I+FS TGK E +S +T Sbjct: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSS--ST 65 Query: 65 KKVYDQYQKTLGID--LWSSHYERMQENLRKLKEINNKLRREIRQRMGEDLGDLSIEDLR 122 K V +Y+ G + L S + + ++ EI +K R +RQ GEDL L+I++L+ Sbjct: 66 KDVITRYESQTGDEGNLDQSSLDLQHDCIKLSNEIADK-SRVLRQMNGEDLEGLNIDELQ 124 Query: 123 GLEQKMDASLGLVRERKYHVIKTQTETYRKKVRNLEEQHGNLLL 166 LE K+D SL V++T+ E ++ LE + L L Sbjct: 125 RLETKIDGSLN-------RVLQTKEENIIGEILALEAKGAELEL 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48899 (338 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65444 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25706 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20578 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 68 6e-14 >89552756 Length = 189 Score = 67.8 bits (164), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 53/178 (29%), Positives = 85/178 (47%), Gaps = 9/178 (5%) Query: 92 GDLESYIRHHGRVQEWVARRFMQQLGA-GLEVLHSHHIIHRDLKPGNILLS--GPESDVL 148 G L+ +++ R + R + A G+E LH +I+H DLK N+L++ P+ V Sbjct: 4 GSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQRPVC 63 Query: 149 LKIADFGLSRTVHPGEHAETVCGTPLYMAPEVLRFKKY--DEKVDMWSLGAILFELLNGY 206 KI D GLS+ + V GT +MAPE+L K + EK+D++S G +++ELL G Sbjct: 64 -KIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLTGD 122 Query: 207 PPFRGRTNVQLLQNIESCKMLPFSQLISPGLHPDCVDLCTKLLSTNPVHRLSFDEFCR 264 P+ ++ I + + P I P+ L + P R SF E + Sbjct: 123 EPYTDMHCASIIGGIVNNTLRP---QIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQ 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32486 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3936 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10935 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11260 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41392 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3070 73 9e-16 >Contig3070 Length = 218 Score = 73.2 bits (178), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 40/69 (57%), Positives = 54/69 (78%), Gaps = 1/69 (1%) Query: 48 SHPPYFQMIKEALLALDEKSGSSPYAIAKHMEEKHKAVLPANFKKILSLQLKNSVAKGNL 107 +HPP+ +MI EA++AL E++GSS YAI K +EEKHK LP +F+K+L L LK VA G L Sbjct: 16 AHPPFSEMITEAIVALKERTGSSQYAITKFVEEKHKQ-LPQSFRKLLLLNLKKLVASGKL 74 Query: 108 IKIKASYKL 116 +K+KAS+KL Sbjct: 75 VKVKASFKL 83 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26170 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 74 4e-16 >Contig1161 Length = 148 Score = 74.3 bits (181), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 2/100 (2%) Query: 19 IACNRLQKELVEWQVNPPAGFKH-KVTDNLQRWVIEVHGAPGTLYANESYQLQVDFPEHY 77 +A R+ KEL + Q +PP V +++ W + G P + YA + + + FP Y Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 78 PMEAPQVIFLQPAPLHPHIYSNGHICLDILYDSWSPAMTV 117 P + P+V F HP+I SNG ICLDIL + WSPA+T+ Sbjct: 61 PFKPPKVAFRTKV-FHPNINSNGSICLDILKEQWSPALTI 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28666260 (429 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45040 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33528 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47329 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11764 (416 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16928 (333 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64799 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33207 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23881 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13066259 (368 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39142 (325 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53456 (69 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23765 (328 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48468 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4299 295 2e-82 >Contig4299 Length = 462 Score = 295 bits (754), Expect = 2e-82, Method: Compositional matrix adjust. Identities = 149/207 (71%), Positives = 172/207 (83%), Gaps = 17/207 (8%) Query: 1 MLAMLNGDERFVEPSPKSLQNLTLQSVKDAVMNQFVGDNMEVSVVGDFSEEDIESCILDY 60 MLAML+GDERFVEP+P SLQNLTLQSVKDAVMNQFVG+NMEVS+VGDFSEE+IESCILDY Sbjct: 122 MLAMLDGDERFVEPTPTSLQNLTLQSVKDAVMNQFVGNNMEVSIVGDFSEEEIESCILDY 181 Query: 61 MGTVRASRDSEIEQQSSSIMFRSYPSDLQFQQVFLKDTDERACAYIAGPAPNRWGFTIEG 120 +GTV++++ SE+EQ+ + ++FR+ SDLQ QQVFLKDTDERACAYIAGPAPNRWGFT+ Sbjct: 182 LGTVQSAKHSEVEQKYNPVVFRA-SSDLQSQQVFLKDTDERACAYIAGPAPNRWGFTV-- 238 Query: 121 KDLFESINNISVDDDDEPQSESL-SEMKDCRKDLQRKLRNHPLFFGITMGLLAEIINSRL 179 DD + +SE L +E KD +KD+QR LR HPLFFGITMGLLAEIINSRL Sbjct: 239 -------------DDAQLKSEELVAEGKDTQKDMQRTLRGHPLFFGITMGLLAEIINSRL 285 Query: 180 FTTVRDSLGLTYDVSFELVSLIGLSLG 206 FTTVRDSLGLTYDVSFEL L+LG Sbjct: 286 FTTVRDSLGLTYDVSFELNLFDRLNLG 312 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30658 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12319 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50615 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11666259 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29860 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36397 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26066265 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4811 230 2e-63 >Contig4811 Length = 440 Score = 230 bits (587), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 111/135 (82%), Positives = 120/135 (88%) Query: 16 SFTFNPSTGAGTIFDSGTVFTRLVTPAYIAVRDAFRNRVGRNLTVTSLGGFDTCYTVPIA 75 + FNP+TGAGT+ DSGTVFTRLVTPAY AVR+ FR RVGR L VT+LGGFDTCYT PI Sbjct: 306 ALAFNPTTGAGTVIDSGTVFTRLVTPAYEAVRNEFRRRVGRKLLVTTLGGFDTCYTAPIV 365 Query: 76 APTITFMFTGMNVTLPPDNLLIHSTAGSTTCLAMAAAPDNVNSVLNVIANLQQQNHRLLY 135 PTITFMFTGMNVTLP DN++I STAGSTTCLAMAAAPDNVNSVLNVIAN+QQQNHR+L Sbjct: 366 VPTITFMFTGMNVTLPADNVVIRSTAGSTTCLAMAAAPDNVNSVLNVIANMQQQNHRVLI 425 Query: 136 DVPNSRLGVARELCT 150 DVPNSRLGVARE CT Sbjct: 426 DVPNSRLGVAREQCT 440 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48684 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4817 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3157 158 1e-41 >Contig3157 Length = 185 Score = 158 bits (399), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 73/115 (63%), Positives = 85/115 (73%) Query: 1 MVASRCFCCGKALNPGGSRAWAVILFITCWVTFLIAEICLLAGSVRNAYHTKYRTIFSED 60 M+ SRCFCCGK L+PGG+RA AV+LFITCW+ F IAE CLLAGSV NAYHTKYRTIFSED Sbjct: 70 MLVSRCFCCGKPLSPGGARALAVVLFITCWIFFFIAEACLLAGSVTNAYHTKYRTIFSED 129 Query: 61 PPSCETLRKGVXXXXXXXXXXXXILSELYYVCYSKARGSFPAYGGRETGVGMGTY 115 PP C+TLRKGV I+S Y+ YS+AR SF +YG E VG+GT+ Sbjct: 130 PPDCQTLRKGVFGAGAAFIFLNTIVSSFYHTNYSRARASFQSYGTGEAAVGLGTF 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56098 (292 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2437 177 5e-47 >Contig2437 Length = 408 Score = 177 bits (450), Expect = 5e-47, Method: Compositional matrix adjust. Identities = 89/196 (45%), Positives = 125/196 (63%), Gaps = 2/196 (1%) Query: 98 IHSLGVNAYRFSISWSRVLPRGRLGE-VNPKGVMFYSKIIDNLLLKGIEPYVTIYHHYHP 156 + +G++ +R SISW+RVLP+G+LG VNP GV FY+ + + LL GI+P+VT+ H+ P Sbjct: 1 MKKIGLDTFRMSISWTRVLPKGKLGGGVNPLGVKFYNNVFNELLANGIKPFVTLLHYDPP 60 Query: 157 QELEERFGAWLSPLMQEEFVHFAETCFENFGDRVKYWTTINEPNLLAEMAYLWGRYPPAH 216 Q LE+ +G +LSP + ++ + + CF+ FGDRVK+W T+NEPN A Y G + P Sbjct: 61 QALEDLYGGFLSPNIINDYGDYVDFCFKTFGDRVKHWVTMNEPNGFAISGYGGGTFAPGR 120 Query: 217 CSAPFGNCSSGNSDTEPLFVLHNMLLSHAQAANIYRHKYQLKQGGFIGIICNTLMCEPLR 276 CS GNC+SGNS TE V H++LL+H+ A IY+ KYQ Q G IGI T +P Sbjct: 121 CSNYEGNCTSGNSATESYTVAHHLLLAHSAAVKIYKDKYQASQKGQIGITVVTHWWKPKY 180 Query: 277 DIEL-DREAAKRALAF 291 +L R A R+L F Sbjct: 181 PAQLASRTATLRSLDF 196 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5168 (309 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7609 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58630 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31142 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28776 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8600 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30366260 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38410 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38280 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22466264 (71 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3456 (704 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16602 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2922 119 1e-29 >Contig2922 Length = 223 Score = 119 bits (298), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 74/199 (37%), Positives = 103/199 (51%), Gaps = 4/199 (2%) Query: 2 RVRVPLQKKGLKYEYSQED-LRNKSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDE 60 RV L+ KG+ YEY +ED L NKS LL+ NPVHKK+PVL+H GKPI ES +I++YI+E Sbjct: 17 RVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAGKPIAESAVILEYIEE 76 Query: 61 VWKDKSPLLPSDPYQRAQARFWADYVDKKLYELGGKIWSXXXXXXXXXXXXFIXXXXXXX 120 W ++PLLP DP+QRA ARFW + + K L G + Sbjct: 77 TWP-QNPLLPKDPHQRALARFWIKFGEDKFGALFGFFMTEGEQQVKATKERQEQLTILEE 135 Query: 121 XXXXXXPYFGGEKIGFVDVALVTFSCWF-YAYETFGNFSIEAEC-PKLIAWTKRCMEKES 178 +FGG+++G D+ + W E G IEAE P+L AW +R + + Sbjct: 136 QGLGDKKFFGGDELGMADLEFGWLAWWMDVMSELAGVKGIEAETFPRLHAWIQRFKDIPT 195 Query: 179 VSSFLEDPHKVHGFIMGMR 197 + L D + + G R Sbjct: 196 IKEHLPDRSAMLTYFKGGR 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16594 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16600 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2922 133 7e-34 >Contig2922 Length = 223 Score = 133 bits (335), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 85/214 (39%), Positives = 120/214 (56%), Gaps = 6/214 (2%) Query: 4 EIILLDFWPSMFGMRVRLALAEKGLKYEYKEED-LKNKSPLLLEMNPVHKQIPVLIHNGK 62 ++ +L W S + RV AL KG+ YEY EED L NKS LL+ NPVHK++PVL+H GK Sbjct: 3 QVTVLGAWSSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAGK 62 Query: 63 PICESLIIVQYIDEVWHDKSPLLPSDPYQRAQARFWADYVDKKLYGLGRKVWSTKGEEQE 122 PI ES +I++YI+E W ++PLLP DP+QRA ARFW + + K +G + T+GE+Q Sbjct: 63 PIAESAVILEYIEETW-PQNPLLPKDPHQRALARFWIKFGEDK-FGALFGFFMTEGEQQV 120 Query: 123 TAKKEFIXXXXXXXXX-XXXXPYFGGEKIGFVDVALVTFSCWF-YAYESFGNFSIEAEC- 179 A KE +FGG+++G D+ + W E G IEAE Sbjct: 121 KATKERQEQLTILEEQGLGDKKFFGGDELGMADLEFGWLAWWMDVMSELAGVKGIEAETF 180 Query: 180 PKLIAWTKRCKEKESVSSSLEDPHKVHGFVMGMR 213 P+L AW +R K+ ++ L D + + G R Sbjct: 181 PRLHAWIQRFKDIPTIKEHLPDRSAMLTYFKGGR 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32041 (333 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 173 1e-45 >Contig1666 Length = 421 Score = 173 bits (438), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 85/162 (52%), Positives = 106/162 (65%), Gaps = 3/162 (1%) Query: 10 SQLSLPPGFRFYPTDEELLVQYLCRKVAGQGFSLEIIGEIDLYKFDPWVLPSKAIFGEK- 68 S SL PGFRF+PTDEEL+ YL RKVAG+ F + I +D+YK +PW LP K+ + Sbjct: 5 SSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLKSRD 64 Query: 69 -EWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITTEGRKVGIKKALVFYIGKAPKG 127 EWYFFS DRKY N SR NR GYWK TG D+ + R VG+KK LVF+ G+APKG Sbjct: 65 TEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHSSRAVGMKKTLVFHSGRAPKG 124 Query: 128 TKTNWIMHEYRLLENS-RKNGSSKLDDWVLCRIYKKNSNSSK 168 +TNW+MHEYRL K G + D +VLCRI++K+ K Sbjct: 125 ARTNWVMHEYRLDNQELEKAGIVEKDAYVLCRIFQKSGTGPK 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17327 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23769 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29224 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6166264 (381 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4695 750 0.0 >Contig4695 Length = 382 Score = 750 bits (1937), Expect = 0.0, Method: Compositional matrix adjust. Identities = 380/380 (100%), Positives = 380/380 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 Query: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT Sbjct: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240 Query: 241 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 300 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR Sbjct: 241 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 300 Query: 301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 360 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL Sbjct: 301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 360 Query: 361 ADYNIQKESTLHLVLRLRGG 380 ADYNIQKESTLHLVLRLRGG Sbjct: 361 ADYNIQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61962 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4695 408 e-116 >Contig4695 Length = 382 Score = 408 bits (1049), Expect = e-116, Method: Compositional matrix adjust. Identities = 206/215 (95%), Positives = 208/215 (96%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 Query: 181 KIQDKEGIPPNXQRLIFAGKQLGKGPNLADYTFQR 215 KIQDKEGIPP+ QRLIFAGKQL G LADY Q+ Sbjct: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK 215 Score = 408 bits (1049), Expect = e-116, Method: Compositional matrix adjust. Identities = 206/215 (95%), Positives = 208/215 (96%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 137 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 196 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 197 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 256 Query: 181 KIQDKEGIPPNXQRLIFAGKQLGKGPNLADYTFQR 215 KIQDKEGIPP+ QRLIFAGKQL G LADY Q+ Sbjct: 257 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK 291 Score = 408 bits (1049), Expect = e-116, Method: Compositional matrix adjust. Identities = 206/215 (95%), Positives = 208/215 (96%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 213 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 272 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 273 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 332 Query: 181 KIQDKEGIPPNXQRLIFAGKQLGKGPNLADYTFQR 215 KIQDKEGIPP+ QRLIFAGKQL G LADY Q+ Sbjct: 333 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK 367 Score = 303 bits (777), Expect = 4e-85, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 289 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 348 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 152 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 349 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1532 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1895 166 4e-44 >Contig1895 Length = 361 Score = 166 bits (419), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 78/89 (87%), Positives = 85/89 (95%) Query: 1 MIDSVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQK 60 MIDSVPGMKALDMN AED IV+LTRE+VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQK Sbjct: 261 MIDSVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQK 320 Query: 61 AAHLALKSLGLPNALDGTYIGNLHPELVL 89 AAHLALK+LGLPNALDG+Y+G + PEL+L Sbjct: 321 AAHLALKALGLPNALDGSYVGGIQPELIL 349 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31298 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21553 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62168 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1985 113 2e-28 >Contig1985 Length = 156 Score = 113 bits (283), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 55/84 (65%), Positives = 66/84 (78%), Gaps = 1/84 (1%) Query: 4 LRIKRVPTVVSNYQKEDSDDGARQVGGCGRNCLKQRCIQGAKLPLYAYKKVKDVVXEKAS 63 L+IKRVPTVVSNYQK+++D+G R+ GGCGRNCL + CI GAKLPLYA+KK + EK Sbjct: 3 LKIKRVPTVVSNYQKDEADEG-RRAGGCGRNCLNKCCISGAKLPLYAFKKQNNSPGEKGF 61 Query: 64 SGDENKEQPVPFLDSLVRXEWEDR 87 SG E ++ PV FLDSLV EWEDR Sbjct: 62 SGHEKQDAPVAFLDSLVLGEWEDR 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3966261 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 72 2e-15 >Contig3804 Length = 391 Score = 72.4 bits (176), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 32/57 (56%), Positives = 40/57 (70%) Query: 30 RYRGVRKRPWGRFAAEIRDPWKKTRVWLGTFDSPEEXXXXXXXXXXTLRGPKAKTNF 86 +YRG+R+RPWG++AAEIRDP K RVWLGTF++ EE +RG KAK NF Sbjct: 117 QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNF 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34911 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158357238 72 3e-15 >158357238 Length = 253 Score = 71.6 bits (174), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 69/205 (33%), Positives = 97/205 (47%), Gaps = 31/205 (15%) Query: 1 MFASRVLFRSTRTLLAQGRTSSLLAPQ-SHLNTFLIGESTDKV--VATQVSLLHHLVHNA 57 MF SRV R +R A R + A Q +H L +S + + +VSLLHH + Sbjct: 1 MFVSRVFARVSR---AVPRNAVTFAAQPNHRFPILSNQSQPLIQDMPNKVSLLHHSTPTS 57 Query: 58 SIFQRFGIS-----------SSASPQTNEKETTQSGNEQGT--VENDGAPADAEPA---- 100 SI Q FG S + + ++ + ++ G+ Q + G+ D++ A Sbjct: 58 SISQLFGFSSSASPEPSERVGNGGSEKSDAKVSEGGDTQAADQTKESGSIPDSQSANVRR 117 Query: 101 --------KTNQAEESDSEADLSMDDXXXXXXXXXXXXXXXXXXXXXXQDKVLRSYAEME 152 K +SDS+ DLS +D QDKVLR+YAEME Sbjct: 118 QRNLRGGTKRTAFSDSDSDEDLSTEDLVKLLTEKEELLKQKHKEVEKMQDKVLRTYAEME 177 Query: 153 NVMERARREAENSKKFAIQNFAKAY 177 NVM+R RREAEN+KKF+IQNFAK+ Sbjct: 178 NVMDRTRREAENTKKFSIQNFAKSL 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32166256 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33366264 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22466260 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12028 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26023 (341 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13283 (420 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47614 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3994 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49951 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2632 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4178 131 6e-33 >Contig4178 Length = 303 Score = 131 bits (330), Expect = 6e-33, Method: Compositional matrix adjust. Identities = 75/235 (31%), Positives = 125/235 (53%), Gaps = 18/235 (7%) Query: 117 RRLISGAIAGAVSRTAVAPLETIRTHLMVGSSGH----STTEVFNNIMKTDGWKGLFRGN 172 + L++G +AG VSRTAVAPLE ++ L V + + T + I +T+G++GLF GN Sbjct: 43 KSLVAGGVAGGVSRTAVAPLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGFRGLFIGN 102 Query: 173 LVNVIRVAPSKAIELFAYDTVNKNL-----SPIPGEQPKIPIPASLVAGACAGVSSTLVT 227 N R+ P+ A++ F+Y+ +K + E ++ L AGACAG+ + T Sbjct: 103 GTNCARIVPNSAVKFFSYEQASKGILWMYREKTGNEDAQLTPLLRLGAGACAGIIAMSAT 162 Query: 228 YPLELLKTRLTIQGDV----YNGLFDAFVKILQEGGPAELYRGLTPSLIGVVPYAATNYF 283 YP+++++ R+T+Q + Y G+F A +L+E GP LY+G PS+IGVVPY N+ Sbjct: 163 YPMDMVRGRITVQTEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFA 222 Query: 284 AYDTLRKTYRK-----ILKQEKIGNIETXXXXXXXXXXXXXXTFPLEVARKHMQV 333 Y++L+ K +++ + +PL+V R+ MQ+ Sbjct: 223 VYESLKDWLIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQM 277 Score = 77.4 bits (189), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 56/198 (28%), Positives = 91/198 (45%), Gaps = 11/198 (5%) Query: 207 IPIPASLVAGACAGVSSTLVTYPLELLKTRLTIQGD---VYNGLFDAFVKILQEGGPAEL 263 + + SLVAG AG S PLE +K L +Q Y+G I + G L Sbjct: 39 LSVCKSLVAGGVAGGVSRTAVAPLERMKILLQVQNPHNIKYSGTVQGLKYIWRTEGFRGL 98 Query: 264 YRGLTPSLIGVVPYAATNYFAYDTLRKTYRKILKQEKIGNIETXXX-------XXXXXXX 316 + G + +VP +A +F+Y+ K + + EK GN + Sbjct: 99 FIGNGTNCARIVPNSAVKFFSYEQASKGILWMYR-EKTGNEDAQLTPLLRLGAGACAGII 157 Query: 317 XXXXTFPLEVARKHMQVGALSGRQVYKNVLHALSSILEQEGIPGLYKGLGPSCLKLVPAA 376 T+P+++ R + V + Y+ + HALS++L +EG LYKG PS + +VP Sbjct: 158 AMSATYPMDMVRGRITVQTEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYV 217 Query: 377 GISFMCYEACKRILVENE 394 G++F YE+ K L+++ Sbjct: 218 GLNFAVYESLKDWLIKSR 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41386 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8266259 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 62 3e-12 >Contig3804 Length = 391 Score = 61.6 bits (148), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 33/60 (55%) Query: 5 QQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETXXXXXXXXXXXXXLMCGPRARTNFP 64 + +YRG+RQR WG W +EIR P R+WLGTF T + G +A+ NFP Sbjct: 115 KNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFP 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26753 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1046 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35992 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42224 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11566260 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig908 281 2e-78 >Contig908 Length = 216 Score = 281 bits (720), Expect = 2e-78, Method: Compositional matrix adjust. Identities = 150/221 (67%), Positives = 166/221 (75%), Gaps = 5/221 (2%) Query: 1 MATASPMASQLKSSFTSPTTSRALPVASPKGXXXXXXXXXXXXXXXXXXXIKAIQSEKPT 60 MA+A+PMASQLKS+FTSP SRAL +PKG IKA Q++KP Sbjct: 1 MASAAPMASQLKSTFTSPV-SRAL--LAPKGLSASPLKLFPSKRSSSFT-IKATQTDKP- 55 Query: 61 YQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPVLRGIEVGLAHGFLLVGP 120 +QVIQPINGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVSP+LRG+EVGLAHG+LLVGP Sbjct: 56 FQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGP 115 Query: 121 FVKTGPLRDTXXXXXXXXXXXXXXXXXLSICLTMYGIASFKEGEPSIAPSLTLTGRTKEP 180 FVK GPLR+T LS+CLTMYGIASFKEGEPS APSLTLTGR KEP Sbjct: 116 FVKAGPLRNTEVAGAAGSLAAAGLVVILSVCLTMYGIASFKEGEPSTAPSLTLTGRKKEP 175 Query: 181 DQLQSADGWAKXXXXXXXXXISGVTWAYFLLYVLNLPYFVK 221 DQLQ+A+GWAK ISGVTWAYFLLYVLNLPY+VK Sbjct: 176 DQLQTAEGWAKFTGGFFFGGISGVTWAYFLLYVLNLPYYVK 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51555 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15866261 (471 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2708 173 2e-45 >Contig2708 Length = 543 Score = 173 bits (438), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 122/366 (33%), Positives = 184/366 (50%), Gaps = 67/366 (18%) Query: 5 WQSRWVKSDWKKSEGKAGSFKHTAGKWAGDPDDKGIQTSTDARHFAISAKIPE-FSNKNR 63 ++ RW S + +G +KH+ + +D G+ S A+ +AI ++ E S K+ Sbjct: 40 FEGRWTVSGKDEYQG---VWKHSKSEGH---EDFGLLVSEKAKKYAIVTEVDEPVSLKDG 93 Query: 64 TLVLQYSIRFEQEIECGGGYIKLL----SGFVNQKKFGGDTPYSVMFGPDLCGTQTKKLH 119 T+VLQ+ R + +ECGG Y+K L +G+ K F ++PYS+MFGPD CG T K+H Sbjct: 94 TVVLQFETRLQNGLECGGAYLKYLRPQEAGW-EPKIFDNESPYSIMFGPDKCGL-TNKVH 151 Query: 120 VIVSYQGQ------NYPIKKDLQCETDKLTHFYTFILRPDASYSVLIDNRERESGSMYSD 173 I ++ + + DKL+H YT I++PD +L+D E++ + S Sbjct: 152 FIFKHKNPKSGEYVEHHLTTPPSVPADKLSHVYTAIIKPDNELIILVDGEEKKKANFLSA 211 Query: 174 WDILPP----RKIKDTKAKKPADWDDREYIEDPNDVKPEGYDS-IPAEIPDPKAKEPDNW 228 D +PP + I D + KKP DWD+R I DPN VKP+ +D P EI D +A++P+ W Sbjct: 212 DDFMPPLIPTKTIPDPEDKKPEDWDERAKIPDPNAVKPDDWDEDAPMEIEDEEAEKPERW 271 Query: 229 DEEED--------------------------------------GLWKPPKIPNPAFKGPW 250 ++E G WK P NPA+KG W Sbjct: 272 LDDEPEEVEDPEATKPEDWDDEEDGEWEAPKIDNPKCVTAPGCGEWKRPMKRNPAYKGKW 331 Query: 251 RRKKIKNPNYKGKWKNQWIDNPEF--EEDPDLYVLKPIKYVGMEVWQVKAGAIYDNILIC 308 I NP+YKG WK Q I NP + E P+ +PI +G+E+W ++ G ++DNILI Sbjct: 332 HAPLIDNPSYKGIWKPQEIPNPSYFELEKPN---FEPIAAIGIEIWTMQDGILFDNILIT 388 Query: 309 DDPEYA 314 D + A Sbjct: 389 KDEKVA 394 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30962 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55987 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44108 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12883 (435 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35768 (529 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3449 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 155 1e-40 >89540794 Length = 177 Score = 155 bits (391), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 74/85 (87%), Positives = 83/85 (97%) Query: 1 MASAEIEYRCFVGGLAWATDDQSLERAFSQFGEILESKIINDRETGRSRGFGFVTFSSEQ 60 MASAEIE+RCFVGGLAWATD+ +LERAF+ FGEI+ESKIINDRETGRSRGFGFVTFS+E+ Sbjct: 1 MASAEIEFRCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEK 60 Query: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 +MRDAIEGMNGQ+LDGRNITVNEAQ Sbjct: 61 AMRDAIEGMNGQDLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5103 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55060 (75 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4026 (401 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15886 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11110 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3966262 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9932 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38163 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25034 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17321 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16732 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4725 317 4e-89 >Contig4725 Length = 393 Score = 317 bits (811), Expect = 4e-89, Method: Compositional matrix adjust. Identities = 154/174 (88%), Positives = 158/174 (90%) Query: 1 PVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPT 60 PV+PEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY KDPT Sbjct: 217 PVVPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPT 276 Query: 61 KVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKI 120 KVDRSGAYIVRQAAKSIVANGLARR +VQVSYAIGVPEPLSVFV++YGTGKIPDKEILKI Sbjct: 277 KVDRSGAYIVRQAAKSIVANGLARRALVQVSYAIGVPEPLSVFVETYGTGKIPDKEILKI 336 Query: 121 VKENFDFRPGMIAINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 174 VKENFDFRPGMI INLDLKRGGN RFLKTAAYGHFGRDDPDFTWEVVKPLKWEK Sbjct: 337 VKENFDFRPGMITINLDLKRGGNKRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52514 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16735 (391 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4725 751 0.0 >Contig4725 Length = 393 Score = 751 bits (1940), Expect = 0.0, Method: Compositional matrix adjust. Identities = 362/390 (92%), Positives = 370/390 (94%) Query: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTK 60 METFLFTSESVNEGHPDKLCDQISDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTK Sbjct: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTK 60 Query: 61 ADIDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA 120 A++DYEKIVRDTCR IGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGH TKRPEEIGA Sbjct: 61 ANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGA 120 Query: 121 GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCSWLRPDGKTQVTVEYHNEN 180 GDQGHMFGYATDETPELMPLSHVLATKLGA+LTEVRKNGTC+WLRPDGKTQVTVEYHNE Sbjct: 121 GDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTVEYHNEG 180 Query: 181 GAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 GAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPV+PEKYLDEKTIFHLNPSGRFVI Sbjct: 181 GAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVVPEKYLDEKTIFHLNPSGRFVI 240 Query: 241 GGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 GGPHGDAGLTGRKIIIDTY KDPTKVDRSGAYIVRQAAKSIVANGLAR Sbjct: 241 GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 Query: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNG 360 R +VQVSYAIGVPEPLSVFV++YGTGKIPDKEILKIVKENFDFRPGMI INLDLKRGGN Sbjct: 301 RALVQVSYAIGVPEPLSVFVETYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNK 360 Query: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390 RFLKTAAYGHFGRDDPDFTWEVVKPLKWEK Sbjct: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39734 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53432 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 172 2e-45 >Contig3037 Length = 313 Score = 172 bits (435), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 78/127 (61%), Positives = 91/127 (71%) Query: 1 MGRAPCCEKMGLKKGPWTPEEDQILVNYIHLYGHGNWRALPKQAGLLRCGKSCRLRWTNY 60 MGR+PCCEK KG WT EEDQ L++YI ++G G WR+LPKQAGLLRCGKSCRLRW NY Sbjct: 1 MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINY 60 Query: 61 LRPDIKRGNFTSXXXXXXXXXXXRLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLKHNH 120 LRPD+KRGNFT LGN+WS IA +LPGRTDNEIKN W+TH+K++L Sbjct: 61 LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRG 120 Query: 121 ATPPPKR 127 P R Sbjct: 121 LDPQTHR 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33417 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2739 (256 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig288 199 2e-53 >Contig288 Length = 499 Score = 199 bits (505), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 110/248 (44%), Positives = 160/248 (64%), Gaps = 6/248 (2%) Query: 8 IFSGFDAQQLAEAFNVDVQLIRKLQGQNDRRGNIVRVEGGLQALLXXXXXXXXXXXXXDH 67 +F+GFD + LA+A N+D Q ++LQGQND R IVRV+G L + Sbjct: 250 VFAGFDTRLLADALNIDQQTAQQLQGQNDNRPQIVRVQGRLDFV---QPPESMREERQQQ 306 Query: 68 LHARGNGYEETICSLRLKQNIGDPWRADVYTPRGGHRSSVTGYDLPVLQKLVKLSAHKGR 127 NG+EE C +++KQNIG P ADV++P+ G S + G +PVL+ L +LSA +G Sbjct: 307 GRQGQNGFEEVFCHMKMKQNIGKPSMADVFSPQAGRISVLNGLSMPVLRHL-RLSAERGF 365 Query: 128 LYQGALVLPYYNVNANSVIYAIRGSARIQVVQQQDQTVANEEVQQGQVLVIPQNFAALIK 187 Y A+ P++N+NA+ V Y IRGSAR+QVV +T+ +++V+QGQ+ ++PQN A L K Sbjct: 366 FYNNAIYSPHWNLNAHEVYYVIRGSARVQVVNDNGETILDDQVRQGQLFIVPQNHAVLQK 425 Query: 188 ARDSGFEYVAIKTDENAMINTLASNLSLMRAMPVQVIASAYQASNNEAKQLRRNRAESTI 247 A +G+EY+A KT +NA+INTLA S++RA+P V+A+AYQ +A+ L+ NR E+ Sbjct: 426 AMSNGYEYIAFKTQDNAIINTLAGRTSVLRALPDVVLANAYQMDRQQARNLKYNRQETV- 484 Query: 248 GAPGSSRS 255 A SSRS Sbjct: 485 -ALSSSRS 491 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53911 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29068 (340 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv766258 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15462 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7592 (363 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1185 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4128 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26626 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4178 60 6e-12 >Contig4178 Length = 303 Score = 59.7 bits (143), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 4/81 (4%) Query: 53 LLAGGIAGALSKTCTAPLARLTILFQVQGMHSDVATLTKASIWQEASRIIGEEGFRAFWK 112 L+AGG+AG +S+T APL R+ IL QVQ H+ + + Q I EGFR + Sbjct: 45 LVAGGVAGGVSRTAVAPLERMKILLQVQNPHN----IKYSGTVQGLKYIWRTEGFRGLFI 100 Query: 113 GNLVTIAHRLPYSSVSFYAYE 133 GN A +P S+V F++YE Sbjct: 101 GNGTNCARIVPNSAVKFFSYE 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47090 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2437 169 2e-44 >Contig2437 Length = 408 Score = 169 bits (427), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 79/149 (53%), Positives = 104/149 (69%), Gaps = 2/149 (1%) Query: 92 MVETGLEAYRFSISWSRLIPNGR--GPVNPKGLAYYNNLINELLSHGIQPHVTLFHSDTP 149 M + GL+ +R SISW+R++P G+ G VNP G+ +YNN+ NELL++GI+P VTL H D P Sbjct: 1 MKKIGLDTFRMSISWTRVLPKGKLGGGVNPLGVKFYNNVFNELLANGIKPFVTLLHYDPP 60 Query: 150 QALEDEYEGWISRRIVKDFKEYADVCFKEFGDRVLYWSTINEGNIFALGGYDIGITPPQR 209 QALED Y G++S I+ D+ +Y D CFK FGDRV +W T+NE N FA+ GY G P R Sbjct: 61 QALEDLYGGFLSPNIINDYGDYVDFCFKTFGDRVKHWVTMNEPNGFAISGYGGGTFAPGR 120 Query: 210 CSPPFGNCPKGNSPSKPYIAGHHILLAHA 238 CS GNC GNS ++ Y HH+LLAH+ Sbjct: 121 CSNYEGNCTSGNSATESYTVAHHLLLAHS 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14166258 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158358249 98 2e-23 >158358249 Length = 174 Score = 98.2 bits (243), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 60/174 (34%), Positives = 91/174 (52%), Gaps = 19/174 (10%) Query: 1 MATAEKSVMVVGIDHSEHSLYAFEWTLDHFFAPFPGTAPFKLVIVHAKPSPATAIGLGGP 60 +A E+ ++V +D E S+YA W L + ++ L++V+ KP A + L G Sbjct: 4 VAEKERRILV-AVDEGEESMYALSWCLGNVV-----SSKDTLILVYVKPPKAVYMPLDGT 57 Query: 61 G----------AIDVLPYVEADLKKTADRVVEKAREICS---SKSXXXXXXXXXXXXARN 107 G + D+ +E + A+ V+EKA+ C + R+ Sbjct: 58 GRSQSSSGYMFSSDLYATMENYSNEVANSVIEKAKNKCRDVLQEQDVKVETRIENGDPRD 117 Query: 108 VMCEAVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTKH 161 V+C VE+ A ILV+GS GYG IKRA LGSVS++CA + +C V+IVKKPKT + Sbjct: 118 VICHLVEQLGAHILVMGSRGYGLIKRAFLGSVSNHCAQNVNCPVLIVKKPKTNN 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32818 (296 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50497 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44727 (719 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52321 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52325 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52425 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3118 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35742 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3466264 (447 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5264 897 0.0 >Contig5264 Length = 447 Score = 897 bits (2319), Expect = 0.0, Method: Compositional matrix adjust. Identities = 432/447 (96%), Positives = 441/447 (98%) Query: 1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEPKRPSDKPLRLPLQD 240 VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EPKRPSDKPLRLPLQD Sbjct: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETGI+KPGMVVTFGPTGLTTEVKSVEMHHE+L+EALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRGFVASNSKDDPAKEAANF SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 AEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 EI+TKIDRRSGKE+EKEPKFLKNGD+G+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 GEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKNVEKKDPSGAKVTKSAAKKK 447 VAVGVIKNVEKKDPSGAKVTKSAAKKK Sbjct: 421 VAVGVIKNVEKKDPSGAKVTKSAAKKK 447 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52609 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58040 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4034 153 1e-39 >Contig4034 Length = 239 Score = 153 bits (387), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 91/239 (38%), Positives = 125/239 (52%), Gaps = 10/239 (4%) Query: 27 SVTHSSEYITNSRGMKLFTQSWTP---LPPTKIIGTLAVVHGFTGESSWFLQLTAVHFTK 83 +V + EYI NSRGMKLFT W P PP +I + HG+ E S + TA+ K Sbjct: 7 NVIYEEEYIFNSRGMKLFTCKWLPENNKPPKALI---LICHGYGMECSITMNSTAIRLAK 63 Query: 84 AGFATCAIDHQGHGFSDGLVAHIPDINPVVDDCIAFFDSF-RARHAPSLPSFLYSESLGG 142 AGFA ID++GHG S GL + + VVDDC + F + ++ +L ES+GG Sbjct: 64 AGFAIYGIDYEGHGKSAGLAGFVKSFDAVVDDCTSHFTNICESKENKGKTRYLLGESMGG 123 Query: 143 AIALLITLRRGPSRPWDGLVLNGAMCGISPKFKPPWPLEHFLFLLAAVVPTWRVVPTRGA 202 A+ALL+ R+ P WDG VL MC IS + KP + L L V+PTW+++PT Sbjct: 124 AVALLVH-RKKPEY-WDGAVLVAPMCKISDEMKPSPVVVSVLTQLCRVIPTWKIIPTNDV 181 Query: 203 LPQLSFKVEWKRNLXXXXXXXXXXXXXXXXXQELLRVCREIQNRYGEVEVPFLVVHGAD 261 + +FKV R ELLRV E++ R EV +PFL++HG + Sbjct: 182 I-DFAFKVPEVRKQVRENPYCYKGRPRLQTGTELLRVSTELEQRLQEVTLPFLILHGEE 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28823 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17253 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2618 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49849 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53255 (468 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29047 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16648 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 130 7e-33 >Contig4694 Length = 351 Score = 130 bits (328), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 86/280 (30%), Positives = 141/280 (50%), Gaps = 42/280 (15%) Query: 2 LINHGVPESLMTGMIEACRGFFDLTEEEKREFQGTHVLSPIRCGTSF--NARVDQILFWR 59 +INHGVP + + R FF EEKR+ + +C + + W+ Sbjct: 65 VINHGVPLEMREKVETTARKFFAQPLEEKRKIRRDE-----KCVVGYYDTEHTKNVRDWK 119 Query: 60 DFLKVFVHP----------------QFHS--PSKPAGFSEVCLEYTQRMRKVAGELLKGI 101 + V Q+ + P P EV +Y+Q + K++ +L+ I Sbjct: 120 EVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLI 179 Query: 102 SKSLGLEE-----WYIDKTMNMDSGLQILTVNLYPPCPQPEYAMGMPPHSDHSFLTILIQ 156 + SLGL E ++ D+T + +N YPPCP PE A+G+ H D LT+L Q Sbjct: 180 ALSLGLPEDRFKGYFKDQT-------SFIRLNHYPPCPSPELALGVGRHKDGGALTVLAQ 232 Query: 157 NGIGGLQVQHK--GQWFDVNPIPNSILVNTGDHLEVLSNGKYKSVLHRAVVNNKTTRISL 214 + +GGL+V+ K G+W V P PN+ ++N GD ++V SN +Y+SV HR +VN++ R S+ Sbjct: 233 DEVGGLEVKRKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHRVMVNSEKERFSV 292 Query: 215 ALSNGPSLDTVVEPIPELS---HPLKYVGMAYKEYLELQQ 251 P+ T V+P+ EL+ +P KY ++ ++L L++ Sbjct: 293 LFFLNPAHYTEVKPLEELTNKQNPAKYTPYSWGKFLTLRK 332 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59773 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65016 (376 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65135 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37390 (344 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15940 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5193 62 2e-12 >Contig5193 Length = 545 Score = 62.4 bits (150), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 42/168 (25%), Positives = 79/168 (47%), Gaps = 10/168 (5%) Query: 17 RKLHLPVTIQGQEGTLWWHAHSSWLRATV-YGALIIHPKPGSSYPFTKPKRETPILLGEW 75 R L + ++ Q G+ ++ ++ +A +G + I +P PF P + +L+G+W Sbjct: 112 RNLTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPSGDYTVLIGDW 171 Query: 76 WDANPIDVVRQATRTGAAPNVSDAYTINGQPGDLYNCSSKDTVIVPIDSGETNLLRVINS 135 + +N + R P D ING+ + ++ + + G+T LR+ N Sbjct: 172 YKSNHTTLKAHLDRGKKLP-FPDGILINGRGPNQFSLT--------FEQGKTYRLRISNV 222 Query: 136 GLNQELFFTVANHKFTVVSADASYTKPFTTSVIMLGPGQTTDVLITGD 183 GL L F + +HK +V + ++T T S + + GQ+ VL+T D Sbjct: 223 GLQHSLNFRIQDHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTAD 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14542 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47266 (334 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20467 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2427 334 3e-94 >Contig2427 Length = 260 Score = 334 bits (856), Expect = 3e-94, Method: Compositional matrix adjust. Identities = 159/227 (70%), Positives = 179/227 (78%), Gaps = 2/227 (0%) Query: 28 GGWEGGHATFYXXXXXXXXXXXXXXYGNLYSQGYGTNTAALSTALFNSGLSCGACYEMKC 87 G W+ HATFY YGNLYSQGYG NTAALSTALFN+GLSCGAC+E+KC Sbjct: 32 GPWQEAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKC 91 Query: 88 NDDPKWCLPG--TLTVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLQIAQYRAGI 145 DDP+WC G ++ VTATNFCPPN A + NGGWCNPP HFDLA P FL+IA+Y+AGI Sbjct: 92 GDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWCNPPRTHFDLAMPMFLKIAEYKAGI 151 Query: 146 VPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRNWG 205 VPVS+RRVPCVKKGGIRFTINGH YFNLVL+TNVAGAGD+ +VS+KG+ TGW PMSRNWG Sbjct: 152 VPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAGAGDIVSVSVKGTNTGWMPMSRNWG 211 Query: 206 QNWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGWQFGQTYEGAQF 252 QNWQSNS L GQ LSF+V SD R+ T+ NVAPA WQFGQTY G F Sbjct: 212 QNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANWQFGQTYSGKNF 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19966262 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44844 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16608 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6266260 (394 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1900 734 0.0 >Contig1900 Length = 451 Score = 734 bits (1896), Expect = 0.0, Method: Compositional matrix adjust. Identities = 356/373 (95%), Positives = 356/373 (95%) Query: 4 KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL 63 KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL Sbjct: 60 KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL 119 Query: 64 DRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVST 123 DRIRKLADNCTGLQGFLVFNAV VDYGKKSKLGFTVYPSPQVST Sbjct: 120 DRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVST 179 Query: 124 SVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLT 183 SVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLT Sbjct: 180 SVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLT 239 Query: 184 ASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS 243 ASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS Sbjct: 240 ASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS 299 Query: 244 SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP 303 SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP Sbjct: 300 SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP 359 Query: 304 PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS 363 PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS Sbjct: 360 PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS 419 Query: 364 EAREDLAALEKDY 376 EAREDLAALEKDY Sbjct: 420 EAREDLAALEKDY 432 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57366 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57874 (41 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26175 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 70 2e-14 >Contig2005 Length = 422 Score = 69.7 bits (169), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 59/201 (29%), Positives = 91/201 (45%), Gaps = 43/201 (21%) Query: 18 DVIKKAFNATEEEFLHVVKRSLP--------ARPQIASVGSCCLVGAISNGVLYVANLGD 69 D ++++F+ +EE + R+L PQ +VGS +V ++ + V+N GD Sbjct: 197 DTMERSFSKMDEE-VQAGNRALQNPNCRCELQTPQCDAVGSTAVVAVVTPEKIIVSNCGD 255 Query: 70 SRAVLGRRASEGRKNPVVAERLSTDHNXXXXXXXXXXXALNPDDSHVVVYTRGVWRIKGI 129 SRAVL R+ + A LS+DH A V+Y G R+ G+ Sbjct: 256 SRAVLCRKGA--------AVPLSSDHKPDRPDELLRIEAAG----GRVIYWDGP-RVLGV 302 Query: 130 IQVSRSIGDVYLKKPEFNRDPIFQQFGNPVPLKRPVMTAEPSILIRKLLPQDSFLIFASD 189 + +SR+IGD YLK P + +EP + I +D LI ASD Sbjct: 303 LAMSRAIGDNYLK---------------------PYVISEPEVTIMDRTAEDECLILASD 341 Query: 190 GLWEQLSDEAAVEIVFKNPRA 210 GLW+ +S++ A +V RA Sbjct: 342 GLWDVVSNDTACGVVRMCLRA 362 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54859 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15066257 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28021 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24 127 1e-32 >Contig24 Length = 471 Score = 127 bits (319), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 60/68 (88%), Positives = 66/68 (97%) Query: 4 VGKRLVNSKEGPPSFEQPKMTLEKLLEYGSMLVQEQENVKRVQLADKYLNEAALGDANED 63 VGKRLVNSKEGPP+FEQPKMTL KLLEYG+MLVQEQENVKRVQL+DKYL EAALGDAN+D Sbjct: 366 VGKRLVNSKEGPPTFEQPKMTLAKLLEYGNMLVQEQENVKRVQLSDKYLKEAALGDANDD 425 Query: 64 AIKSGSFF 71 AIKSG+F+ Sbjct: 426 AIKSGNFY 433 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53324 (304 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42089 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158354627 124 5e-31 >158354627 Length = 97 Score = 124 bits (312), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 2/92 (2%) Query: 177 QITKSLACEWAKDNIRSNCVAPFCTRTPLIEQMLAK--KSMMEEVVSRTPLGRPGEPQEI 234 Q+ K+LACEWAKDNIR N VAP+ RTPL E M KS++E V+SRTPLGR GEP+E+ Sbjct: 1 QLAKNLACEWAKDNIRINSVAPWVVRTPLAEPMFTDDGKSLLEAVISRTPLGRIGEPEEV 60 Query: 235 SSLATFLCMPCASYITGQVISVDGGLTANAFS 266 S+L FLC+P ASYITGQ VDGG+T N F Sbjct: 61 SALVAFLCLPAASYITGQTFCVDGGMTINGFQ 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2342 (645 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5220 1166 0.0 >Contig5220 Length = 647 Score = 1166 bits (3016), Expect = 0.0, Method: Compositional matrix adjust. Identities = 566/618 (91%), Positives = 580/618 (93%) Query: 1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 60 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN Sbjct: 1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 60 Query: 61 QVAMNPINTVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGPGDKPMITVTYKGEDKQFAA 120 QVAMNPINTVFDAKRLIGRRF+DASVQ D+K W FKV GP +KPMI V YKGE+KQFAA Sbjct: 61 QVAMNPINTVFDAKRLIGRRFTDASVQGDMKLWPFKVTSGPAEKPMIGVQYKGEEKQFAA 120 Query: 121 EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP 180 EEISSMVLIKMREIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP Sbjct: 121 EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP 180 Query: 181 TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240 TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD Sbjct: 181 TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240 Query: 241 NRMVNHFVQEFKRKHKKDITGNARSLRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY 300 NRMVNHFVQEFKRK+KKDI+GN R+LRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY Sbjct: 241 NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY 300 Query: 301 STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQDFF 360 STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST+HDVVLVGGSTRIPKVQQLLQDFF Sbjct: 301 STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF 360 Query: 361 NGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLI 420 NGKELCKSINPDE ILSGEGNEKVQD ETAGGVMTVLI Sbjct: 361 NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 420 Query: 421 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 480 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI Sbjct: 421 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 480 Query: 481 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEEHKK 540 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYKSEDEEHKK Sbjct: 481 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 540 Query: 541 KVEAKNALENYAYNMRNTVKDEKISAKLPPADKKKIEDAVEQAIQWLDSNQLAEADEFED 600 KVEAKNALENYAYNMRNT+KDEKI KLP ADKKKIEDA+E AIQWLDSNQLAEADEFED Sbjct: 541 KVEAKNALENYAYNMRNTIKDEKIGEKLPGADKKKIEDAIEAAIQWLDSNQLAEADEFED 600 Query: 601 KMKELESICNPIIAKMYQ 618 KMKELESICNPIIAKMYQ Sbjct: 601 KMKELESICNPIIAKMYQ 618 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47089 (109 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26466257 (396 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35733 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv460 (357 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16133 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36401 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89544763 78 5e-17 >89544763 Length = 157 Score = 78.2 bits (191), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 56/155 (36%), Positives = 77/155 (49%), Gaps = 19/155 (12%) Query: 15 RILQEVKEMQSN--PSDDFMSLPLEENIFEWQFAIRGPSDTEFEGGIYHGRIQLPAEYPF 72 R+ +E KE+Q D + + NIF+W I+GPS+T FEGGI+ +P +YP Sbjct: 7 RLFKEYKEVQREKVADPDIQLVCDDSNIFKWTALIKGPSETPFEGGIFQLAFAVPEQYPL 66 Query: 73 QPPSFMLLT----PNGRFETQTKICLSISNHHPEHWQPSWSVRTALVALIAFM----PTS 124 QPP LT PN F+T +ICL I + W P+W++++ A+IA M P S Sbjct: 67 QPPQVRFLTKIFHPNVHFKT-GEICLDILKN---AWSPAWTLQSVCRAIIALMAHPEPDS 122 Query: 125 P-NGALGSL----DYKKEERHALAIKSREAAPKFG 154 P N G+L D K A A PK G Sbjct: 123 PLNCDSGNLLRAGDIKGYHSMARMYTRLAAMPKKG 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55895 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23874 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65458 (352 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 139 3e-35 >Contig4694 Length = 351 Score = 139 bits (349), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 83/277 (29%), Positives = 145/277 (52%), Gaps = 18/277 (6%) Query: 62 PETTEKELQKLKSALSSWGCFQATGHGISTSFLDEIRQVTKEFFEQPIEEKKKISKGVEE 121 P+ E ++++ +A +WG FQ HG+ +++ ++FF QP+EEK+KI + + Sbjct: 43 PKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTARKFFAQPLEEKRKIRRDEKC 102 Query: 122 FEGYGADPTPEEGQYLDWSDRV-FLDVYP------------EDLRKYKFWPESPNSFRDV 168 GY T DW + FL P E+ + + WPE+P R+V Sbjct: 103 VVGYYD--TEHTKNVRDWKEVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREV 160 Query: 169 LENYTIKMKIVTEMISKAMAKSLNLEEKCFLNQFGERGALQARFNYYSRCLRPDIVLGLK 228 +E+Y+ +++ ++ + +A SL L E F F ++ + R N+Y C P++ LG+ Sbjct: 161 MEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQTSF-IRLNHYPPCPSPELALGVG 219 Query: 229 PHADGSGYTILLQNEVDGLQILK--DDCWLTIPTISNALLVLMGDQMEIMSNGIFKSPVH 286 H DG T+L Q+EV GL++ + D W+ + NA ++ +GD +++ SN ++S H Sbjct: 220 RHKDGGALTVLAQDEVGGLEVKRKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEH 279 Query: 287 RVLASSERERISVAVFYTPESGKLIGPEEGLIDEERP 323 RV+ +SE+ER SV F P + P E L +++ P Sbjct: 280 RVMVNSEKERFSVLFFLNPAHYTEVKPLEELTNKQNP 316 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40831 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14292 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55193 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43469 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14967 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41031 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5457 (325 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158354890 82 3e-18 >158354890 Length = 172 Score = 82.4 bits (202), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 57/174 (32%), Positives = 83/174 (47%), Gaps = 2/174 (1%) Query: 152 IGTFAIQIAKYIGARVFVTAGNEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDV 211 +G+ Q A +GA V T +EK K+ G I YK EDF+ARV E T GVDV Sbjct: 1 VGSLLCQWANALGAIVIGTVSTKEKAVQAKEDGCHHVIIYKEEDFIARVTEITSDNGVDV 60 Query: 212 ILDNIGGAYFQRNIDSLNVDGRLFIIGFQGGTVAEVNLSGLLARRLTVQAAGLRNRSLEN 271 + D++G FQ ++ L G + G G V LS L A+ L + L + Sbjct: 61 VYDSVGKDTFQGSLACLKTRGYMVSFGQASGRPDPVPLSALAAKSLFLTRPALFQYTATR 120 Query: 272 KAAIVSEVEKNVWPAIVAGKVKPVVYKYFPLTEAAEAHQLMESSNHVGKILLIP 325 +V+ E V+ + +G + V +PL+ A EAH +E+ G +LIP Sbjct: 121 DKLLVAAGE--VFANVASGVLHVRVNHKYPLSHAPEAHADLENRRTSGSAVLIP 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36508 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60213 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49587 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18989 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26166 (320 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18629 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6759 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 137 4e-35 >Contig2950 Length = 216 Score = 137 bits (345), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 70/202 (34%), Positives = 110/202 (54%), Gaps = 15/202 (7%) Query: 12 KLVLVGDMGTGKTSLVLRFVKGQFFEHQEPTIGAAFFTQLLSLNEATVKFDIWDTAGQER 71 K+VL+GD G GK++L+ RF + +F + TIG F T+ + +++ VK IWDTAGQER Sbjct: 14 KVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQER 73 Query: 72 YHNLAPMYYRGXXXXXXXYDISNVDTFVRAKKWVQELQKQGNKNLVMALVANKCDLESKR 131 Y + YYRG YD++ TF ++W++EL+ + N+V+ LV NK DL R Sbjct: 74 YRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLR 133 Query: 132 EVNTQEGEKLSEENGMFFIETSAKTSLNINELF-------YEIAKRLAIAQPSQPSGMNL 184 V+ ++ + +E FF+ETSA S+N+ F Y++ R A+ P+ + Sbjct: 134 AVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEVGDDPAAVPK 193 Query: 185 HETENSG--------RRLFCCS 198 +T N G ++ CCS Sbjct: 194 GQTINVGGKDDVSAIKKAGCCS 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6345 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51913 (408 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7966262 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48818 (46 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60961 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56337 (311 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26640 (292 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47699 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6362 (325 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3451 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1990 169 2e-44 >Contig1990 Length = 354 Score = 169 bits (427), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 87/206 (42%), Positives = 123/206 (59%), Gaps = 22/206 (10%) Query: 74 KSYASQEEHDYRFKVFKANLRRARRHQQLDPSATHGVTQFSDLTPAEFRGTYLGLRP--- 130 K Y E + RF++FK NL+ H + S G+ F+DLT E+R +LG RP Sbjct: 44 KVYNGIGEEETRFQIFKDNLKFVDEHNAENRSYKVGMNAFADLTNQEYRARFLGTRPDPK 103 Query: 131 ---LKLPHDAQKAPILPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWSFSTTGALEGANFL 187 +K + + + +LP + LPE DWR GAV +KNQGSCGSCW+FST A+EG N + Sbjct: 104 RRVMKAKNPSLRYVVLPDDKLPESVDWRALGAVNPIKNQGSCGSCWAFSTVAAVEGINKI 163 Query: 188 ATGNLVSLSEQQLVECDHECDPEEMGSCDSGCNGGLMNTAFEYTLKAGGLMKEEDYPYTG 247 ATG LVSLSEQ+LV+CD + ++GCNGGLM+ AFE+ +K GG+ E DYPY Sbjct: 164 ATGELVSLSEQELVDCDRK--------YNAGCNGGLMDYAFEFIIKNGGMDTESDYPYKA 215 Query: 248 TDRGSCKFDKTKIAASVSHFQCISLD 273 ++ + AS+ + + +S+D Sbjct: 216 VNQ--------QCDASLENNKVVSID 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55742 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51028 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55459 (83 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7783 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28441 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51002 (53 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14207 (366 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 96 4e-22 >Contig2005 Length = 422 Score = 95.5 bits (236), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 80/230 (34%), Positives = 109/230 (47%), Gaps = 40/230 (17%) Query: 91 FCGVFDGHGPWGHYVAK-------RVRESMPSSLLCNWQETLAEASLDPDFDLQA-EKKL 142 F GV+DGHG H K V++ + S + W++T+ + D ++QA + L Sbjct: 159 FYGVYDGHG-CSHVALKCKDRLHEIVKQDLESQRVVQWKDTMERSFSKMDEEVQAGNRAL 217 Query: 143 HRFNIWKHSYLKTCAAIDQELEHHRRIDSFNSGTTALTIVRQGESIFVANVGDSRAVLAT 202 N C A+ G+TA+ V E I V+N GDSRAVL Sbjct: 218 QNPNCRCELQTPQCDAV---------------GSTAVVAVVTPEKIIVSNCGDSRAVLCR 262 Query: 203 MSDDGNLEPVQLTIDFKPNLPQEAERIIQCKGRVFCLGDEPGVHRVWLPHEESPGLAMSR 262 V L+ D KP+ P E RI GRV D P V V LAMSR Sbjct: 263 KG-----AAVPLSSDHKPDRPDELLRIEAAGGRVI-YWDGPRVLGV---------LAMSR 307 Query: 263 AFGDYCVKDFGLISVPEVTQRNITSRDQFVVLATDGVWDVVSNQEAVQIV 312 A GD +K + +IS PEVT + T+ D+ ++LA+DG+WDVVSN A +V Sbjct: 308 AIGDNYLKPY-VISEPEVTIMDRTAEDECLILASDGLWDVVSNDTACGVV 356 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36090 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13281 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55978 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13517 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53479 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42126 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55360 (387 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11347 (296 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27426 (254 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41990 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12139 (355 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1991 60 2e-11 >Contig1991 Length = 284 Score = 60.1 bits (144), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 46/179 (25%), Positives = 69/179 (38%), Gaps = 15/179 (8%) Query: 1 MTSESADENCLAWAARDPSGLLSPYKFSRRALGSDDVSLNITHCGVCYADVIWTRNKLGD 60 M ++ C A A +P+ L + +V + I + +C+ D K + Sbjct: 1 MATQGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVRILYTALCHTDAYTWGGKDPE 60 Query: 61 SKYPVVPGHEIAGIVKEVGSNVCRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCA----- 115 +P + GHE AGIV+ VG V + GDHV + Y C +C++C G C Sbjct: 61 GLFPCILGHEAAGIVESVGEGVTTVQPGDHV-IPCYQAECGECKFCKSGKTNLCGKVRAA 119 Query: 116 ---------RGSVFTFNXXXXXXXXXXXXYSSHIVVHERYCFKIPDNYPLASAAPLLCA 165 R S F+ N +S + VVH+ KI PL L C Sbjct: 120 TGVGVMMSDRQSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCG 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54200 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5844 176 8e-47 >Contig5844 Length = 161 Score = 176 bits (445), Expect = 8e-47, Method: Compositional matrix adjust. Identities = 82/156 (52%), Positives = 115/156 (73%), Gaps = 1/156 (0%) Query: 4 NRRVGVAVDFSACSKKALKWALDNVVRDGDHLIILSVLPEGHYEEGEMQLWETTGSPLIP 63 +RR+GVA+DFS SK AL+WA+DN+V GD L I+ + H +E LW +GSPLIP Sbjct: 4 DRRIGVAMDFSKSSKNALQWAIDNLVDKGDTLHIIHINNNKH-DESRNVLWAKSGSPLIP 62 Query: 64 LSEFSDPIISKKYGVKPDAETLDIVNCVARQKDIVVVMKVYWGDAREKICEAIDNIPLSC 123 LSEF + + KKYGV D E LD+++ V+RQK++ ++ KVYWGDAREK+ +A++++ L Sbjct: 63 LSEFRELEVMKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYWGDAREKLLQAVEDLKLDS 122 Query: 124 LVIGNRGLGKIKRAILGSVSNYVVNNGSCPVTVVKN 159 LV+G+RGLG +KR +LGSVSNYV+ PVT+VK+ Sbjct: 123 LVMGSRGLGTLKRIVLGSVSNYVMTQAPIPVTIVKD 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15082 (369 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4183 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666 (612 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2678 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30866258 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34340 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48218 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5776 179 1e-47 >Contig5776 Length = 289 Score = 179 bits (454), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 99/205 (48%), Positives = 129/205 (62%), Gaps = 9/205 (4%) Query: 13 SCLFMISFLMVCLGVRSQLTTDFYNESCPNLLTIVRKAVKNAIKTETRMAASLVRLHFHD 72 S F +S + V L+ FY+ SCP L +IVRK +K K + AA L+RLHFHD Sbjct: 18 SSYFGVSEAQPSVPVVKGLSWSFYDSSCPKLDSIVRKQLKKVFKEDIGQAAGLLRLHFHD 77 Query: 73 CFVNGCDGSVLLDGS---DGEKSALPNLN-SVRGFDVVDTIKSSVESACPGVVSCADILA 128 CFV GCDGSVLLDGS E+ A PNL+ + F +++ ++ V S C VVSCAD+ A Sbjct: 78 CFVQGCDGSVLLDGSASGPSEQQAPPNLSLRAKAFQIINDLREIVHSKCGRVVSCADLTA 137 Query: 129 IAARDSVLLSGGNTWKVFLGRRDGL---VANQTGANNGLPFPTDSLDTITQKFANVGLNQ 185 +AARD+V LSGG ++V LGR+DGL N+T AN LP PT + + A L+ Sbjct: 138 LAARDAVFLSGGPEYEVPLGRKDGLNFATRNETLAN--LPAPTSNTTKLLTDLAKKNLDA 195 Query: 186 TDVVSLSGAHTIGLARCTTFSSRLF 210 TDVV+LSG HTIGL CT+F+ RL+ Sbjct: 196 TDVVALSGGHTIGLGHCTSFTGRLY 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31136 (506 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158358365 275 3e-76 >158358365 Length = 266 Score = 275 bits (704), Expect = 3e-76, Method: Compositional matrix adjust. Identities = 144/271 (53%), Positives = 179/271 (66%), Gaps = 11/271 (4%) Query: 6 ETTLEYTPTWVVAAVCTVIVSISLGAERILHYAGKYLKKKDQKPLYEALLKIKEELMLLG 65 ++LEYTPTWVVA VC VIV +SL ER LH GK L+ + Q LYEAL K+KEELMLLG Sbjct: 7 NSSLEYTPTWVVAGVCFVIVLLSLCVERGLHKLGKCLQHERQDALYEALQKLKEELMLLG 66 Query: 66 FISLLLTVFQDTIAKICIPKRYSDDWLPCXXXXXXXXXXXXXXXHFQTFYHFTSGGARRL 125 FISLLLTV Q +I++ICIP + LPC H+ F + + RRL Sbjct: 67 FISLLLTVSQRSISRICIPAHVATHMLPC----KRETAEHNTPAHY--FLNQATNNGRRL 120 Query: 126 LAEHSASPSYCAKRGKDPLLSTTALHHLHIFIFVLAVVHVIFCVLTIIFGGAKIRQWKHW 185 L+E A+ +C +GK PLLS LHHLHIFIFVLAVVHVIFCV T++ GGA+IRQWK W Sbjct: 121 LSE--ATSDHCQLKGKVPLLSLEGLHHLHIFIFVLAVVHVIFCVSTMVLGGARIRQWKRW 178 Query: 186 EDAISKKEYDPEEVLKFTNVREHDFIKDRYRGVGKIGNLRGWVRSFFKQFYASVTRSDYV 245 ED+I K D + + H+F+K+R G + + GW+ +F KQFY SVT+SDY+ Sbjct: 179 EDSIQK---DRRSGVAHVSHHHHEFLKERADGYWRRAAIIGWMIAFCKQFYGSVTKSDYI 235 Query: 246 TMRMGFIMTHCRGNPKFNFHKYMIRALEADF 276 +R GFI HC GNP F+FHKYM+R LE DF Sbjct: 236 ALRQGFIKEHCPGNPNFDFHKYMMRTLEIDF 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23527 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43002 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20760 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158361786 226 1e-61 >158361786 Length = 186 Score = 226 bits (576), Expect = 1e-61, Method: Compositional matrix adjust. Identities = 114/186 (61%), Positives = 127/186 (68%), Gaps = 11/186 (5%) Query: 41 LISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANDYF 100 +ISW+E GSTF+VWRPAEFARD+LPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFAND F Sbjct: 1 MISWSEGGSTFVVWRPAEFARDILPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANDCF 60 Query: 101 RKGEKALLRDIQRRKISP-----XXXXXXXXXXXXXXXXXXXXXXSPTNSGDEQVLSSNS 155 ++GEK LLR+IQRRKISP SP NSGDEQV+SSNS Sbjct: 61 KRGEKGLLREIQRRKISPSVSASAATVAAAAAVTAAVLPVAAVSVSPANSGDEQVISSNS 120 Query: 156 SPATVP------VTVHRTSSCSSTPEIXXXXXXXXXXXSQLTQELTQLRGLCNNILALMT 209 SP VP + R SC+ST EI QL+ ELTQLRGLCNNIL +MT Sbjct: 121 SPMAVPTPAPAVTLLQRARSCNSTAEILEENERLRKENMQLSNELTQLRGLCNNILGMMT 180 Query: 210 NYAAGQ 215 NYA+GQ Sbjct: 181 NYASGQ 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54217 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 62 2e-12 >89540794 Length = 177 Score = 62.4 bits (150), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 26/78 (33%), Positives = 51/78 (65%), Gaps = 1/78 (1%) Query: 185 ESPYKLYVGNLAWAIKPEDLRNHFSQFGTVVSARVVHDRKAGKHRAYGFLSFSSA-AECE 243 E ++ +VG LAWA + L F+ FG ++ +++++DR+ G+ R +GF++FS+ A + Sbjct: 5 EIEFRCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEKAMRD 64 Query: 244 AAMFLNGKEFRGRSLVVS 261 A +NG++ GR++ V+ Sbjct: 65 AIEGMNGQDLDGRNITVN 82 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65232 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30500 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53533 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44029 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54977 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4195 (462 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38834 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19271 (485 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 260657394 100 1e-23 >260657394 Length = 118 Score = 100 bits (250), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 65/115 (56%), Positives = 76/115 (66%), Gaps = 2/115 (1%) Query: 111 GEAYTWGWKECVPSGKVLLD-STGVRFEKDSFGKQSLLQTEQEGPKPQSSNSTGGMLSRV 169 G YTWGWKECVPSGKV+++ S G FEKD +QS T+Q P+ Q S S+ G +S Sbjct: 2 GAVYTWGWKECVPSGKVIVEPSMGTNFEKDVMERQSSFLTDQVSPRSQGSRSSSGTMSAT 61 Query: 170 DNRKAREGSIKKRRTSSAKQEPESSSMSDDETFLASPCLVTLGPGVRISTVAAGG 224 + R A E K+RR SSAKQ ESSS S DET A PCLVTL P VRI+ AAGG Sbjct: 62 EARGAGEEYSKRRRVSSAKQAGESSS-SGDETLSALPCLVTLNPXVRIANGAAGG 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv866 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv941 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41557 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60295 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5032 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47772 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48554 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55522 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54745 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56146 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3413 186 5e-50 >Contig3413 Length = 153 Score = 186 bits (473), Expect = 5e-50, Method: Compositional matrix adjust. Identities = 82/148 (55%), Positives = 110/148 (74%), Gaps = 1/148 (0%) Query: 2 STPARKRLMRDFKRLQQDPPAGISGAP-QDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFS 60 S+ A+ RLM D K + +PP G S +P D+N+ +W+A IFGPD+TPW+GG F L L FS Sbjct: 3 SSSAQLRLMSDLKTIINEPPEGCSASPMSDDNLFVWSATIFGPDETPWEGGVFSLRLTFS 62 Query: 61 EEYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS 120 E YP KPP VRF S MFHPN+Y DG++C+DI+Q+ WSP ++V+ ILTS+QSLL DPNP+S Sbjct: 63 ERYPEKPPRVRFTSEMFHPNVYHDGALCMDIIQDAWSPCHNVSTILTSVQSLLTDPNPSS 122 Query: 121 PANSEAARMFSENKREYNRRVREIVEQS 148 PAN EAA+++ + + YN+RVR S Sbjct: 123 PANPEAAQLYQHDIKAYNKRVRRCARNS 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13930 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22768 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50063 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14039 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55440 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30686 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6463 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50297 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13463 (308 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19474 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5214 133 5e-34 >Contig5214 Length = 355 Score = 133 bits (335), Expect = 5e-34, Method: Compositional matrix adjust. Identities = 67/182 (36%), Positives = 102/182 (56%), Gaps = 10/182 (5%) Query: 1 MKMPFSNDTFDAVFAIEATCHAPDVLDCYKEIYRVLKPGQCFAAYEWCITDCFDPMNREH 60 ++MPF ++FD ++IEATCHAP + + Y EI+RVLKPG + +YEW TD ++ + EH Sbjct: 183 LEMPFPENSFDGAYSIEATCHAPKLEEVYAEIFRVLKPGALYVSYEWVTTDKYNGDDAEH 242 Query: 61 QRIKGEVELGNGLPDIRSVGQCLEALKLAGFEVLWEKDVAADSPLPWYLPLDTTQFSLSN 120 + + +E G+ LP +R+ EA + GFEV+ EKD+A W+ L + + Sbjct: 243 REVIQGIERGDALPGLRAQVDIAEAARKVGFEVVKEKDLAKPPSEAWWTRLKMGRIAY-- 300 Query: 121 FRTTSFGRFITRNMVKALEFVRLAPEGSQRVQAFLEKAAEALVEGGREGIFTPMYFFVAR 180 + +V L F+ +AP+G+ V L A+ L GG GIFTPM+ + R Sbjct: 301 --------WRNHILVTVLSFLGIAPKGTVDVHEMLFVTADYLTRGGETGIFTPMHMILCR 352 Query: 181 KP 182 KP Sbjct: 353 KP 354 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25553 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3492 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42846 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46739 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7682 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30030 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36678 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38964 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60290 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50787 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57061 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31139 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41033 (703 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4283 347 1e-97 >Contig4283 Length = 582 Score = 347 bits (890), Expect = 1e-97, Method: Compositional matrix adjust. Identities = 201/505 (39%), Positives = 269/505 (53%), Gaps = 79/505 (15%) Query: 15 LLELAANNDVGRFKQSIEREPSGVDEIGQWYGRQKGSKQMVLEYRTPLMVAATYGSIDVM 74 L+EL+A++++ F+ +E + VDE WYGR+ GSK+M E RTPLM+AA +GS V+ Sbjct: 34 LVELSASDNLDAFRSEVEEKGLHVDEASFWYGRRIGSKKMGFEERTPLMIAAMFGSTKVL 93 Query: 75 KLILSLSDSDVNRFCGLDKSTALHCAASGGSVNAVDVVKLLLLVGADPNSLDANGHRPVD 134 + I+ DVNR CG D+ TALHCA +GGS ++++VVK LL+ A ++ N + Sbjct: 94 RYIIESGKVDVNRSCGSDRVTALHCATAGGSSSSLEVVK--LLLDASADANCVNANGNKP 151 Query: 135 VLVVPPKLQDV----KATLEELLATNGSSVERXXXXXXXXXXXXXXXXXXXXXXXXXXXX 190 V ++ P + + +E LL + S + Sbjct: 152 VDLIAPAWKSSCNLRRKAMEMLLKGDMSLL------------------------------ 181 Query: 191 XXXXXXXXXVKLNDLP----ISCASEKKEYPVDPSLPDIKNSIYATDEFRMFSFKVRPCS 246 + ++P + SEKKEYP+D +LPDI N IY +DEFRM++FKV+PCS Sbjct: 182 ------GSDIDDQEVPSLQLLKEGSEKKEYPIDIALPDINNGIYGSDEFRMYTFKVKPCS 235 Query: 247 RAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLH 306 RAYSHDWTECPFVHPGENARRRDPRK+ YSCVPCP+FRKG+C++GD+CEYAHGVFE WLH Sbjct: 236 RAYSHDWTECPFVHPGENARRRDPRKYPYSCVPCPEFRKGSCQKGDVCEYAHGVFESWLH 295 Query: 307 PAQYRTRLCKDGTNCNRRVCFFAHTTEELRPLYMSTGXXXXXXXXXXXXXXXMDFATAMN 366 PAQYRTRLCKD T C R+VCFFAH EELRP+Y STG M + + Sbjct: 296 PAQYRTRLCKDETGCTRKVCFFAHKPEELRPVYASTGSAMPSPRSMSACAGDMTTMSPLA 355 Query: 367 LIXXXXXXXXXXXXXXXXXXXXXXANGVSHSSMGWAQPNV----PTLHLPGXXXXXXXXX 422 L NG G Q V P L LPG Sbjct: 356 LGSPSLSMPTTSTPPMSPIASSSPKNG------GLWQNKVNLTPPALQLPGSRLKSASS- 408 Query: 423 XXXXARDIPAEDINLMLDFDIQQH--------QLLNELSCLSQPCVNSNSLNRSGRSKTL 474 A D++L ++F + H + +E+S LS P +NS R L Sbjct: 409 ---------ARDLDLEMEFLGRDHANQQQQQQHMWDEMSRLSSPSCYNNS-----RMGEL 454 Query: 475 TPSNLDELFSAESSSPRYSDQALAS 499 P+NLD++F + S QAL++ Sbjct: 455 KPTNLDDVFGSFDPSLLSQLQALST 479 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20370 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 106 9e-26 >89540794 Length = 177 Score = 106 bits (264), Expect = 9e-26, Method: Compositional matrix adjust. Identities = 44/79 (55%), Positives = 67/79 (84%) Query: 6 EYRCFIGGLSWSTSDRSLKEAFEKFGHLVEAKVVVDKFSGRSRGFGFVSFDDKQAMEDAI 65 E+RCF+GGL+W+T + +L+ AF FG ++E+K++ D+ +GRSRGFGFV+F +++AM DAI Sbjct: 7 EFRCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEKAMRDAI 66 Query: 66 KEMHGMDLDGRSITVDKAQ 84 + M+G DLDGR+ITV++AQ Sbjct: 67 EGMNGQDLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6854 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38339 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 97 9e-23 >Contig1666 Length = 421 Score = 97.4 bits (241), Expect = 9e-23, Method: Compositional matrix adjust. Identities = 51/118 (43%), Positives = 63/118 (53%), Gaps = 16/118 (13%) Query: 10 EKEWYFFSPRDRKYPNGLRPNRAAASGYWKATGTDKTIXXXXXXXXXXXXXXXXXXALVF 69 + EWYFFS DRKY N R NRA GYWK TG D+ + LVF Sbjct: 64 DTEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPV-------CHSSRAVGMKKTLVF 116 Query: 70 YQGRPPKGIKTNWIMHEYRLAQPPNPAINKPPLKLRDASMRLDNWVLCRIYKKSNAVP 127 + GR PKG +TNW+MHEYRL N + K + +DA +VLCRI++KS P Sbjct: 117 HSGRAPKGARTNWVMHEYRL---DNQELEKAGIVEKDA------YVLCRIFQKSGTGP 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4686 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5015 169 7e-45 >Contig5015 Length = 197 Score = 169 bits (429), Expect = 7e-45, Method: Compositional matrix adjust. Identities = 78/187 (41%), Positives = 121/187 (64%), Gaps = 4/187 (2%) Query: 1 MESFWDLSDGNVKSGGENWLS----AVVPLMKLLSLAVIGLILAHPKLQVMSKATFRLLS 56 MES + + + G ++ LS AV+P+ K+ ++ +GL++A + ++ +LL+ Sbjct: 1 MESILTMVEMGSQVGSQSLLSTIKIAVLPIAKVFTVCSLGLLMASKYVNILPANGRKLLN 60 Query: 57 KLVFVLFLPCLIFTHLGQSITGKNFVLWWFIPVNVIISTAVGCILGYLVAIICQPPPEFF 116 LVF L LPCLIF+ LGQ+IT + + WWFIP NV++ + G I+GY+ A I +PP +F Sbjct: 61 GLVFSLLLPCLIFSQLGQAITWEKMLEWWFIPANVVLGSISGSIIGYITASIVRPPYPYF 120 Query: 117 RFTIIMTAFGNTGNLPLAIVGSVCHSAKNPFGPDCHTSGVSYVSFAQWVAVILVYTLVYH 176 +FTI+ GN GN+PL ++ ++C NPFG C T+G +Y+SF QWV I++YT V+H Sbjct: 121 KFTIVQIGIGNIGNVPLVLIAALCRDTSNPFGDTCSTNGTAYISFGQWVGAIILYTYVFH 180 Query: 177 MMEPPLE 183 M+ PP E Sbjct: 181 MLAPPPE 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30228 (378 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10309 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1885 (65 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48941 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11916 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv601 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60434 (83 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3886 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26266265 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59040 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2297 (309 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23174 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21324 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33977 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2967 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4515 394 e-112 >Contig4515 Length = 469 Score = 394 bits (1011), Expect = e-112, Method: Compositional matrix adjust. Identities = 184/262 (70%), Positives = 204/262 (77%) Query: 1 MDYAFEFIINNGGIDSEEDYPYKASDGRCDQYRKNARVVTIDGYEDVPENDEKSLEKAVA 60 MDYAFEFIINNGGIDSE+DYPYK D CD YRKNARVV+ID YEDVP DEK+L+KAVA Sbjct: 208 MDYAFEFIINNGGIDSEDDYPYKGYDSTCDTYRKNARVVSIDSYEDVPTYDEKALKKAVA 267 Query: 61 NQPVSVAIEAGGREFQLYQSGIFTGRCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWG 120 NQP++VAIE GGREFQLY SG+FTGRCGTALDHGV VGYGTE+G DYWIV+NSWG SWG Sbjct: 268 NQPIAVAIEGGGREFQLYSSGVFTGRCGTALDHGVAVVGYGTEHGSDYWIVRNSWGDSWG 327 Query: 121 EEGYIRMERDLATSATGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXTVCDNYYACPE 180 E GYIRMER+L SATGKCGIAME SY VCDNY++CPE Sbjct: 328 ESGYIRMERNLGNSATGKCGIAMEPSYPVKIGQNPPNPGPSPPSPIKPPQVCDNYFSCPE 387 Query: 181 SSTCCCIFEYAKYCFQWGCCPLEAATCCEDHDSCCPQEYPVCNVRAGTCMMSKDNPLGVK 240 S+TCCCI++Y YCF WGCCPLE ATCC+DH SCCP +YPVCNV AGTC +SK NP+ VK Sbjct: 388 SNTCCCIYQYQNYCFAWGCCPLEGATCCDDHYSCCPSDYPVCNVNAGTCQLSKGNPMSVK 447 Query: 241 ALKRTAAKPHWAYGGDGKRSSA 262 ALKRT AK HW GG K SS+ Sbjct: 448 ALKRTPAKAHWTLGGGAKHSSS 469 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29255 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41793 (323 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1576 87 2e-19 >Contig1576 Length = 164 Score = 86.7 bits (213), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 42/122 (34%), Positives = 76/122 (62%), Gaps = 1/122 (0%) Query: 194 TAPVQAASLLLLGPFLDYWLTNKRVDNYQYSLISVMFIILSCTIAVGTNLSQFICIGRFT 253 + P Q+ +LL+ GPFLD++LTN+ V +++Y+ ++FI+LSC I+V N S F+ IG+ + Sbjct: 1 SCPYQSGTLLITGPFLDWFLTNQNVFSFKYTTQVLVFIVLSCLISVSVNFSTFLVIGKTS 60 Query: 254 AVSFQVIGHMKTXXXXXXXXXXXXKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKERRS 313 V++QV+GH+KT + + +LG+++A++GM+ Y ++ G K+ Sbjct: 61 PVTYQVLGHLKT-CLVLTFGYTLLHDPFDWRNILGILVALMGMVLYSYFCTREGQKKVAE 119 Query: 314 PA 315 A Sbjct: 120 EA 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34301 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1241 72 2e-15 >Contig1241 Length = 276 Score = 72.4 bits (176), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 48/127 (37%), Positives = 60/127 (47%), Gaps = 14/127 (11%) Query: 78 ELNFAKSGLGYCDVAVGSGEEAP-FGELINVHYTARFADGTVFDSNYKRARPLTMRIGAG 136 E K+GL + G G E P G+ + VHYT DGT FDS+ R P +G G Sbjct: 38 EKELGKNGLKKKLIKQGEGWETPGSGDEVQVHYTGTLLDGTKFDSSRDRGTPFKFSLGQG 97 Query: 137 KLIKGLDQGILGGEGVPPMLVGGKRKLRIPPALAYGPEPAGCFSGD-CNIPANATLLYDI 195 ++IKG D EG+ M G IPP LAYG SG IP NATL +D+ Sbjct: 98 QVIKGWD------EGIKTMKKGENAIFTIPPELAYGE------SGSPPTIPPNATLQFDV 145 Query: 196 NFVGIYS 202 + S Sbjct: 146 ELLSWTS 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52996 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24909 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv786 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18392 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8144 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33397 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11866256 (301 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31700 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19490 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58465 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42823 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31784 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47125 (406 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46792 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29781 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55918 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38343 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9578 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17894 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60577 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60664 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15500 (509 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5193 821 0.0 >Contig5193 Length = 545 Score = 821 bits (2120), Expect = 0.0, Method: Compositional matrix adjust. Identities = 394/486 (81%), Positives = 433/486 (89%) Query: 24 GPDIYSVTNDNLIINVYNSLTEPFLLSWSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQ 83 GPDI SVTNDNLIINV+NSL EPFLLSW+G+QQR NS++DGVYGTTCPIPPGRN TYILQ Sbjct: 60 GPDINSVTNDNLIINVFNSLDEPFLLSWNGIQQRHNSFQDGVYGTTCPIPPGRNLTYILQ 119 Query: 84 VKDQIGSFFYFPSLDFHKAAGGFGGIRILSRPRIPVPFPDPAGDITVLIGDWYKANHTTL 143 VKDQIGSF+YFPSL FHKAAGGFGGIRILSRPRIPVPFPDP+GD TVLIGDWYK+NHTTL Sbjct: 120 VKDQIGSFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPSGDYTVLIGDWYKSNHTTL 179 Query: 144 KAILDRGKKLHFPDGILINGRGPNGVSFTVEQGKTYRFRISNVGLQNSLNFRIQDHKMVL 203 KA LDRGKKL FPDGILINGRGPN S T EQGKTYR RISNVGLQ+SLNFRIQDHKM L Sbjct: 180 KAHLDRGKKLPFPDGILINGRGPNQFSLTFEQGKTYRLRISNVGLQHSLNFRIQDHKMKL 239 Query: 204 VEVEGTHTLQTTYSSLDVHVGQSYSVLVTADQPAQDFYIVVSTRFTSQVLTTTGILRYSN 263 VEVEGTHTLQTTYSSLDVHVGQSYSVLVTADQP D+YIVVS+RF++ +LTTTGIL YS Sbjct: 240 VEVEGTHTLQTTYSSLDVHVGQSYSVLVTADQPGHDYYIVVSSRFSTPILTTTGILHYSG 299 Query: 264 SAXXXXXXXXXXXTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTSRTIRLASS 323 + TIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYG+IN ++T LAS+ Sbjct: 300 AGGQVSGPIPGGPTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYILASA 359 Query: 324 AGQVNGKQRYAVNSVSYVPGDTPLKVADFFKIGGVFRVGSISDNPTGGGVYLDTSVMGAD 383 AGQVNGKQRY +NSVS+VP DTPLK+AD+FKI GVFRVGS+SD PTGG +YLDTSV+GAD Sbjct: 360 AGQVNGKQRYGINSVSFVPADTPLKLADYFKISGVFRVGSVSDRPTGGNLYLDTSVLGAD 419 Query: 384 FRAFVEIVFENPEDIIQSWHIDGYSFFVVGMDGGLWTANSRNQYNLRDAVARSTTQVYPK 443 +R FVEIVF+N EDI+QS+H+DGY FFVVGMDGG WT SRN YNLRDAVARSTTQVYP Sbjct: 420 YRTFVEIVFQNDEDIVQSYHLDGYQFFVVGMDGGKWTTASRNGYNLRDAVARSTTQVYPF 479 Query: 444 SWTAIYVALDNVGMWNVRSEFWARQYLGQQFYLRVYSPVESIRDEFPIPKNALLCGKASG 503 SWTAIY++LDNVGMWN+R+EFWARQYLGQQ YLRVY+ SIRDE+PIP+NA LCG+ASG Sbjct: 480 SWTAIYLSLDNVGMWNLRTEFWARQYLGQQLYLRVYTSSTSIRDEYPIPRNARLCGRASG 539 Query: 504 RRTRPL 509 R TRPL Sbjct: 540 RHTRPL 545 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6236 (488 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13694 (385 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27803 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26371 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65980 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13409 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 122 1e-30 >Contig4694 Length = 351 Score = 122 bits (306), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 73/212 (34%), Positives = 109/212 (51%), Gaps = 27/212 (12%) Query: 18 SYIRPEPERPRLSQVSECKHVPIIDLGKDVNRAQ---------LIQHIADACRLYGFFQV 68 ++I+ RP+LS + E VP+IDL + L++ I +AC+ +GFFQV Sbjct: 7 AFIQDPEHRPKLS-IIEADGVPLIDLSPLTSADSISDPKAIEVLVREIGNACKNWGFFQV 65 Query: 69 INHGVAAEMMEKMLEVADEFYRLPVEEKMKLYSDDPTKTMRLSTSFNVNKEKVHNWRDYL 128 INHGV EM EK+ A +F+ P+EEK K+ D+ T N V +W++ Sbjct: 66 INHGVPLEMREKVETTARKFFAQPLEEKRKIRRDEKCVVGYYDTEHTKN---VRDWKEVY 122 Query: 129 RL----------HCYPLD----QYTPEWPSNPPSFKEIVSSYCKEVRELGFRLQEMISES 174 P D Q+ +WP NPP +E++ Y +EV +L +L +I+ S Sbjct: 123 DFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLIALS 182 Query: 175 LGLEKDHIKNVFGEQGQHMAVNYYPPCPQPEL 206 LGL +D K F +Q + +N+YPPCP PEL Sbjct: 183 LGLPEDRFKGYFKDQTSFIRLNHYPPCPSPEL 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48365 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51286 (314 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4658 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 85 2e-19 >Contig2950 Length = 216 Score = 85.1 bits (209), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 55/176 (31%), Positives = 88/176 (50%), Gaps = 14/176 (7%) Query: 6 FIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSA-NVAVDGSIVNLGLWDTAGQ 64 K V +GD VGK+ +L +T N+F + T+ F+ ++ VD IV +WDTAGQ Sbjct: 12 LFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQ 71 Query: 65 EDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFA-PNVPIVLVGTKLDLR 123 E Y + YRGA +L + + ++ENV ++W+ ELR N+ I+LVG K DLR Sbjct: 72 ERYRAITSAYYRGAVGALLVYDVTRHVTFENV-ERWLKELRDHTDSNIVIMLVGNKADLR 130 Query: 124 EDKGYLADHMGSNVITSAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQ 179 H+ + + A+ R+ ++E S+ NV+ F + + Q Sbjct: 131 --------HLRAVSVEDAKAFAEREN---TFFMETSALESMNVENAFSEVLTQIYQ 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50350 (390 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54245 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19053 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv480 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27208 (343 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6991 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55033 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18352 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22152 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24737 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48772 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3949 138 2e-35 >Contig3949 Length = 245 Score = 138 bits (347), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 73/175 (41%), Positives = 101/175 (57%), Gaps = 4/175 (2%) Query: 37 PEPPGLCHEIVSSIKSAVFPNGSKHSSSSTKQTRSTAAGVVSFLHGLFPILTWGRNYKAT 96 P P + +S+K FP+ + +R G+ +FPI W Y Sbjct: 22 PPPQPFITTLKNSLKETFFPDDPLRQFKNQPASRKLVLGI----QYVFPIFEWAPRYTLD 77 Query: 97 KFRNDLMAGLTLASLSIPQSIGYATLANLAPQYGLYTSVVPPLVYALMGSSREIAIGPVA 156 ++DL++G+T+ASL+IPQ I YA LANL P GLY+S +PPLVYA+MGSSR++A+G VA Sbjct: 78 FLKSDLISGITIASLAIPQGISYAKLANLPPILGLYSSFIPPLVYAMMGSSRDLAVGTVA 137 Query: 157 VVSLLLSSMIQNVVDPVANAVAYRKLVLTVTFFAGTFQFIFWIVQAGFSGGFFSH 211 V SLL +SM+ V+ N Y L T TFFAG FQ + +++ GF F SH Sbjct: 138 VASLLTASMLGAEVNATENPTLYLHLAFTATFFAGVFQALLGLLRLGFIVDFLSH 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22322 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14022 (487 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40064 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6587 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29202 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2876 278 2e-77 >Contig2876 Length = 258 Score = 278 bits (710), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 132/156 (84%), Positives = 144/156 (92%), Gaps = 2/156 (1%) Query: 1 MTVIDEHLIPASTAGESTVFYYKMKGDYYRYLAEFKTGNERKEAADQSLKAYQTASTTAE 60 M VIDEHL+P+ + ESTVF+YKMKGDYYRYLAEFKTG++RKE ADQS+KAYQ AS+ AE Sbjct: 101 MRVIDEHLLPSCSGFESTVFFYKMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAE 160 Query: 61 SDLSPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLSEESYKDSTLI 120 +DL PTHPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAISELDTLSEESYKDSTLI Sbjct: 161 TDLPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLI 220 Query: 121 MQLLRDNLTLWTSDIPEDG--EDQKMESSAKAGGDD 154 MQLLRDNLTLWTSDIPEDG E QK +SSAKAGG+D Sbjct: 221 MQLLRDNLTLWTSDIPEDGVEEGQKADSSAKAGGED 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26595 (393 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11509 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15466256 (322 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6269 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9181 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40140 (391 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57391 (672 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66241 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7275 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10357 (117 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89542775 150 2e-39 >89542775 Length = 117 Score = 150 bits (380), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 75/117 (64%), Positives = 86/117 (73%) Query: 1 MNNPYGEDQDDTTVVGFEVPKSPDSSYNNVYPGHEDEAKDXXXXXXXXXXXXXXXXXXRD 60 MNN Y +D D+ TV GFEV +SPD+SYNN YPG+EDEA+D D Sbjct: 1 MNNSYDDDYDEATVAGFEVIRSPDTSYNNTYPGNEDEARDPPIVPPHLQQTLLSYPASGD 60 Query: 61 TSGTLPVPQNVILNHLYIENRETPRSVVALGITHRFRSKFVTVVLYKPVQRSASTST 117 T+GTLP+P NV LNHLYIENRE+PRSVVALG THRFRSKFVTVVLYKPVQR ++ST Sbjct: 61 TTGTLPLPPNVTLNHLYIENRESPRSVVALGFTHRFRSKFVTVVLYKPVQRKGASST 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53517 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89557288 60 1e-11 >89557288 Length = 216 Score = 60.1 bits (144), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 2/78 (2%) Query: 1 MKAMDKNVMLNRNKVHRACAEREILDMLDHPFLPALYASFQTKTHICLITDYCPGGELFL 60 MK + K ML R +V AER +L +D ++ LY SFQ + + LI +Y PGG++ Sbjct: 141 MKKLKKLEMLRRGQVEHVKAERNLLAEVDSAYIVKLYCSFQDEEFLYLIMEYLPGGDMMT 200 Query: 61 LLDRQPTKVLKEDAVRFY 78 LL R+ +L ED RFY Sbjct: 201 LLMRKD--ILTEDEARFY 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32064 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158354627 140 7e-36 >158354627 Length = 97 Score = 140 bits (353), Expect = 7e-36, Method: Compositional matrix adjust. Identities = 61/92 (66%), Positives = 79/92 (85%), Gaps = 2/92 (2%) Query: 177 QLTKNLACEWAEDNIRSNAVAPWYIKTPMVDQMLSN--KTFLEGVINRAPLRRVGDPKEV 234 QL KNLACEWA+DNIR N+VAPW ++TP+ + M ++ K+ LE VI+R PL R+G+P+EV Sbjct: 1 QLAKNLACEWAKDNIRINSVAPWVVRTPLAEPMFTDDGKSLLEAVISRTPLGRIGEPEEV 60 Query: 235 SSLVAFLCLPASSYITGQTICVDGGVTVNGFE 266 S+LVAFLCLPA+SYITGQT CVDGG+T+NGF+ Sbjct: 61 SALVAFLCLPAASYITGQTFCVDGGMTINGFQ 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32058 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158354627 143 1e-36 >158354627 Length = 97 Score = 143 bits (360), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 64/96 (66%), Positives = 79/96 (82%), Gaps = 2/96 (2%) Query: 177 QLTKNLACEWAKDNIRSNAVAPWYIKTPMVEQMLTN--QAFLEEVINRAPLRRVGDPKEV 234 QL KNLACEWAKDNIR N+VAPW ++TP+ E M T+ ++ LE VI+R PL R+G+P+EV Sbjct: 1 QLAKNLACEWAKDNIRINSVAPWVVRTPLAEPMFTDDGKSLLEAVISRTPLGRIGEPEEV 60 Query: 235 SSLVAFLCLPASSYITGQIICVDGGMTVNGFESNLL 270 S+LVAFLCLPA+SYITGQ CVDGGMT+NGF+ L Sbjct: 61 SALVAFLCLPAASYITGQTFCVDGGMTINGFQFQAL 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3366 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14312 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20159 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4966261 (340 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5522 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77981379 79 2e-17 >77981379 Length = 204 Score = 78.6 bits (192), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 49/124 (39%), Positives = 68/124 (54%), Gaps = 13/124 (10%) Query: 22 GPLDIELWPKEAPKAVRNFVQLCL--EG--------YYDNTIFHRIIKGFLVQXXXXXXX 71 G + + L+ K PK NF LC +G +Y + FHRII F++Q Sbjct: 49 GRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSKFHRIIPSFMLQGGDFTLG 108 Query: 72 -XXXXESIYGSAFADEFHSRLRFNHRGLVACANAGSPNSNGSQFFISLDRCDWLDRKNTI 130 ESIYG FADE + +L+ GL++ ANAG P++NGSQFFI+ WLD ++ + Sbjct: 109 DGRGGESIYGEKFADE-NFKLKHTGPGLLSMANAG-PDTNGSQFFITTVTTTWLDGRHVV 166 Query: 131 FGKV 134 FGKV Sbjct: 167 FGKV 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14935 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12823 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10115 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34249 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54458 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51319 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47510 (344 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47659 (393 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7008 (238 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38985 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39875 (372 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55560 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3618 (254 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35823 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47597 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9179 (371 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4113 680 0.0 >Contig4113 Length = 368 Score = 680 bits (1754), Expect = 0.0, Method: Compositional matrix adjust. Identities = 330/370 (89%), Positives = 349/370 (94%), Gaps = 4/370 (1%) Query: 2 EITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDMT 61 E+TNV+EYEAIAKQKLPKM +DYYASG+EDQWTL +NR+AFS+ILFRPRILIDVS IDMT Sbjct: 3 EVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNIDMT 62 Query: 62 TTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWATSSVEEVASTGP 121 TTVLGFKISMPIMIAPTA QKMAHPEGEY GTIMTLSSWATSSVEEVASTGP Sbjct: 63 TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 122 Query: 122 GIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 181 GIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK Sbjct: 123 GIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 182 Query: 182 NFEGLDLGKMDKADDSGLASYVAGQIDRTLSWKDVKWLQTITNLPILVKGVLTAEDTRLA 241 NFEGLDLGKMDKA+DSGLASYVAGQIDR+LSWKDV+WLQTIT LPILVKGVLTAED RL+ Sbjct: 183 NFEGLDLGKMDKANDSGLASYVAGQIDRSLSWKDVQWLQTITKLPILVKGVLTAEDARLS 242 Query: 242 IQAGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRVPVFLDGGVRRGTDVFKALALG 301 +Q+GAAGIIVSNHGARQLDYVP+TIMALEEVVKAAQGR+PVFLDGGVRRGTDVFKALALG Sbjct: 243 VQSGAAGIIVSNHGARQLDYVPSTIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALG 302 Query: 302 ASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITRDHIVTEWEVP 361 ASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITR+HIV +W+ P Sbjct: 303 ASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITRNHIVADWDAP 362 Query: 362 RPGSRPLPRL 371 RP+PRL Sbjct: 363 ----RPVPRL 368 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35060 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60475 (405 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12571 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26965 (379 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54335 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21129 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18866257 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4216 611 e-177 >Contig4216 Length = 332 Score = 611 bits (1576), Expect = e-177, Method: Compositional matrix adjust. Identities = 297/332 (89%), Positives = 308/332 (92%) Query: 1 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGADQPVILHMLDIPPAAEALNGVKMELVD 60 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGADQPVILH+LDI AAEAL GVKMEL+D Sbjct: 1 MAKEPVRVLVTGAAGQIGYALVPMIARGVMLGADQPVILHLLDIEFAAEALKGVKMELID 60 Query: 61 AAFPLLKGVVATTDVVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALENH 120 AAFPLLKGVVATTDVVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALE + Sbjct: 61 AAFPLLKGVVATTDVVEACTGVNIAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKY 120 Query: 121 AAANCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQVSERLNVQVSDVK 180 AAANCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQ+SERLNVQVSDVK Sbjct: 121 AAANCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQISERLNVQVSDVK 180 Query: 181 NVIIWGNHSSTQYPDVNHATVKTPAGEKPVRGLVGDDAWLNGEFITTVQQRGAAIIKARK 240 NVIIWGNHSS+QYPDVNHATVKTP+GEKPVR LV DDAWLNGEFI TVQQRGAAIIKARK Sbjct: 181 NVIIWGNHSSSQYPDVNHATVKTPSGEKPVRELVADDAWLNGEFIATVQQRGAAIIKARK 240 Query: 241 XXXXXXXXXXXCDHIRDWVLGTPEGTWVSMGVYSDGSYNVPAGLIYSFPVTCCAGEWKIV 300 CDHIRDWVLGTPEGTWVSMGVYSDGSY VPAGLIYSFPVTCC G+WKIV Sbjct: 241 LSSALSAASSACDHIRDWVLGTPEGTWVSMGVYSDGSYGVPAGLIYSFPVTCCNGDWKIV 300 Query: 301 QGLHIDEFSRKKLDLTAQELSEEKELAYSCLS 332 QGL IDEFSRKK+D TA ELSEEK LAY+C++ Sbjct: 301 QGLPIDEFSRKKMDATADELSEEKALAYTCIN 332 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54996 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36276 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57895767 64 3e-13 >57895767 Length = 167 Score = 64.3 bits (155), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 36/99 (36%), Positives = 58/99 (58%), Gaps = 6/99 (6%) Query: 39 LHLDDILSKSAREVSKFATVALVDI-DSEDIQVYVKYFDITLIPSTV-FFFNAHHMKMDS 96 + +D++L+ A ++ FA + LVDI + D + +D PSTV FFF H+ +D Sbjct: 64 VQMDEVLAAVADKIKNFAVIYLVDISEVPDFNTMYELYD----PSTVMFFFRNKHIMIDL 119 Query: 97 GSADHTKWVGAFDRKQDFIDVVEAIFRGAMKGKLIVTCP 135 G+ ++ K A KQ+FID+VE ++R A KG+ +V P Sbjct: 120 GTGNNNKINWALKDKQEFIDIVETVYRXARKGRGLVIAP 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58683 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 70 1e-14 >89540794 Length = 177 Score = 70.1 bits (170), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 34/76 (44%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Query: 17 KVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFVTFKEPEAAKKACED 76 + FVGGLAW T +A+ F +GEI+E+ II+D+ TGRS+G+GFVTF +A + A E Sbjct: 9 RCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEKAMRDAIEG 68 Query: 77 TTPM-INGRRANCNLA 91 ++GR N A Sbjct: 69 MNGQDLDGRNITVNEA 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8236 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51732 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36198 (403 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51178 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 100 1e-23 >Contig4694 Length = 351 Score = 99.8 bits (247), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 80/222 (36%), Positives = 115/222 (51%), Gaps = 27/222 (12%) Query: 44 DSIPVIDFSLLTSGNPDQRSKAIQDLHR----ACEEWGFFMVINHGVEESLMKGMIEACR 99 D +P+ID S LTS + KAI+ L R AC+ WGFF VINHGV + + + R Sbjct: 24 DGVPLIDLSPLTSADSISDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTAR 83 Query: 100 GFFD--LTEEEKGEFEGKPVLAPIRCGTSSNTSLDKILFWRDFL--KVFLHP-------- 147 FF L E+ K + K V+ + N K ++ DFL + L P Sbjct: 84 KFFAQPLEEKRKIRRDEKCVVGYYDTEHTKNVRDWKEVY--DFLVEEPTLVPSSTEPDDK 141 Query: 148 -QFHSLNK----PPGFSEVSLEYSQRIKKVVEELLKGISKSLGL-EEWYIDKAMNMSSGL 201 + N+ PP EV +YSQ ++K+ +L+ I+ SLGL E+ + + +S + Sbjct: 142 EETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQTSFI 201 Query: 202 QVLVANLYPPCPQPEHAMGLPPHSDYGLLTVLTQNEVGGLKC 243 ++ N YPPCP PE A+G+ H D G LTVL Q+EVGGL+ Sbjct: 202 RL---NHYPPCPSPELALGVGRHKDGGALTVLAQDEVGGLEV 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19027 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53084 (68 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12964 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44542 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48734 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39656 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17620 (373 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566261 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26424 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30033 (447 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11404 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18766263 (296 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42482 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39848 (420 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39428 (380 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14248 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46232 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10829 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22593 (385 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21063 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22196 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17040 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50131 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 260659647 134 3e-34 >260659647 Length = 154 Score = 134 bits (337), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 63/128 (49%), Positives = 91/128 (71%) Query: 29 YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN 88 +DE SM++S F +L++LK+LR QLYSAAEY E+ Y +QKQ+VL+ LKDYA++ALVN Sbjct: 12 FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDNLKDYAVRALVN 71 Query: 89 TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK 148 VDHLG+V YK+ LD + +V +L+ +C+ Q++ TC+ F+++ G QQ LL P+ Sbjct: 72 AVDHLGTVAYKLTDLLDQQTLDVSTMDLKVTCLNQKLFTCKTFMDKEGARQQQLLPFIPR 131 Query: 149 HHKRYTFP 156 HHK Y P Sbjct: 132 HHKHYILP 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57970 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1399 268 2e-74 >Contig1399 Length = 143 Score = 268 bits (685), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 122/143 (85%), Positives = 138/143 (96%) Query: 135 MRDESKKATLKLVDMECSYLTVDFFRKLPQDIEKGGNPTHSIFDRYNDSYLRRIGTTVLS 194 MR+ESKKATL+LVDMECSYLTVDFFRKLPQD++KGGNP+HS+FDRYNDSYLRRIG+ VL+ Sbjct: 1 MREESKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPSHSLFDRYNDSYLRRIGSNVLA 60 Query: 195 YVNMVCATLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEPKQLASLLNEDPAVMARRT 254 YVNMVCA+LRNSIPKS+VYCQVREAKRSLLD FFT++GKL+ KQL+SLLNEDPAVM RR+ Sbjct: 61 YVNMVCASLRNSIPKSVVYCQVREAKRSLLDRFFTDMGKLDAKQLSSLLNEDPAVMERRS 120 Query: 255 ALAKRLELYRSAQAEIDAVAWSK 277 ALAKRLELYRSAQAE+D VAWSK Sbjct: 121 ALAKRLELYRSAQAEMDTVAWSK 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30100 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45299 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33590 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10928 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31562 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31466256 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21966263 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43954 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57583 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15680 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5466 160 3e-42 >Contig5466 Length = 121 Score = 160 bits (404), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 76/115 (66%), Positives = 89/115 (77%) Query: 3 KSYFKQEHDFXXXXXXXXXXXXXYPDRIPVIVEKAERSDIPNIDKKKYLVPADLTVGQFV 62 KS FK++H YP+R+PVIVEKA +SD+P+IDKKKYLVPADLTVGQF Sbjct: 5 KSLFKKQHALERRKAEALRIREKYPERVPVIVEKAVKSDVPDIDKKKYLVPADLTVGQFG 64 Query: 63 YVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSGIYDEKKDADGFLYVTYSGENTFG 117 YV+RKRIKL AEKAIF FV+NVLPP A+MS IY++ KD DGFLY+TYSGEN FG Sbjct: 65 YVVRKRIKLGAEKAIFTFVNNVLPPQAALMSAIYEDNKDEDGFLYMTYSGENAFG 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63858 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2896 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58015 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41423 (360 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89546967 72 5e-15 >89546967 Length = 114 Score = 72.0 bits (175), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 35/88 (39%), Positives = 58/88 (65%), Gaps = 1/88 (1%) Query: 71 LSFPVLCKIFVLGLIG-CASQTMGYRGINISSPTLASAISNLVPAFTFILAVIFRMEKLA 129 ++ + KI VLGL+ Q + Y G+ ++ T A+A+SN++PA TF++A I R+EK+ Sbjct: 1 MTLAIFTKIMVLGLLEPVLDQNLYYLGMKYTTATFAAAMSNILPALTFVMAWILRLEKVK 60 Query: 130 LRSSSSQAKIIGTIVSISGAFVVTLYKG 157 L SQ K++GT +++GA ++TL KG Sbjct: 61 LTCIRSQCKLLGTAATVAGAMIMTLVKG 88 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37180 (79 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23500 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54396 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49860 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2569 57 8e-11 >Contig2569 Length = 246 Score = 57.0 bits (136), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 47/154 (30%), Positives = 62/154 (40%), Gaps = 44/154 (28%) Query: 42 SQWSSGICAC--------CDDMQSCCIGFFCPCFLFAKNAEFLGSGT---LAGSCMTHLI 90 SQW S + AC D++ C +G PC L+ NAE L S T A C+T+ Sbjct: 77 SQWDSDLLACLGRNDEFCSSDLEVCLLGSVAPCVLYGSNAERLFSSTGSSFASHCLTYSG 136 Query: 91 FWALVNTVCCLLSDGTLLGLPGCFVACYACGYRRALRSKYNLQ------EAPCG------ 138 + + N G C +A R A+R K+NLQ + CG Sbjct: 137 LYLIGNA---------FFGW-NCLAPWFAARNRTAMRHKFNLQGGCETFQNTCGCCGSMG 186 Query: 139 -----------DFTTHFFCHLCAICQEYREIRER 161 D TH CH A+CQE RE+R R Sbjct: 187 EEDQEQCEAFCDVATHLCCHPLALCQEGREVRRR 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1614 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54714 (254 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18120 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23966261 (59 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1803 59 5e-12 >Contig1803 Length = 76 Score = 58.9 bits (141), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 4/57 (7%) Query: 2 RCKMYPDLSFSEGATTTETIIAGVAPVKTHFEGSEMGVGAENGWKCGSNCSCDPCTC 58 C YPDL ++TT TII+GV +FE SEM GAENG KCGSNCSC C C Sbjct: 22 NCGNYPDLE----SSTTATIISGVPSTTMYFEESEMSFGAENGCKCGSNCSCTSCGC 74 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34353 (484 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43938 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77981379 104 4e-25 >77981379 Length = 204 Score = 104 bits (259), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 61/151 (40%), Positives = 83/151 (54%), Gaps = 13/151 (8%) Query: 19 GSFTVELYYKHAPRTCRNFLEL--SRRG--------YYDNVKFHRIIKDFIVQXXX-XXX 67 G + L+ K P+T NF L +G +Y KFHRII F++Q Sbjct: 49 GRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSKFHRIIPSFMLQGGDFTLG 108 Query: 68 XXXXXESIYGSKFEDEIKPELKHTGAGILSMANAGPNSNGSQFFITLAPAQSLDGKHTIF 127 ESIYG KF DE +LKHTG G+LSMANAGP++NGSQFFIT LDG+H +F Sbjct: 109 DGRGGESIYGEKFADE-NFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTTWLDGRHVVF 167 Query: 128 GRVCRGMEIIKRLGSVQTDNTDRPIHDVKIL 158 G+V GM+++ ++ + + P V I+ Sbjct: 168 GKVLSGMDVVYKV-EAEGSQSGTPKSKVAIV 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18849 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43714 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3413 185 1e-49 >Contig3413 Length = 153 Score = 185 bits (469), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 81/148 (54%), Positives = 110/148 (74%), Gaps = 1/148 (0%) Query: 2 STPARKRLMRDFKRLQQDPPAGISGAP-QDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 S+ A+ RLM D K + +PP G S +P D+N+ +W+A IFGPD+TPW+GG F L L F+ Sbjct: 3 SSSAQLRLMSDLKTIINEPPEGCSASPMSDDNLFVWSATIFGPDETPWEGGVFSLRLTFS 62 Query: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS 120 E YP KPP VRF S MFHPN+Y DG++C+DI+Q+ WSP ++V+ ILTS+QSLL DPNP+S Sbjct: 63 ERYPEKPPRVRFTSEMFHPNVYHDGALCMDIIQDAWSPCHNVSTILTSVQSLLTDPNPSS 122 Query: 121 PANSEAARMFSENKREYNRRVREIVEQS 148 PAN EAA+++ + + YN+RVR S Sbjct: 123 PANPEAAQLYQHDIKAYNKRVRRCARNS 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12397 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41955 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50138 (302 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21011 (61 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29667 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46377 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48157 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6784 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4537 56 7e-11 >Contig4537 Length = 586 Score = 56.2 bits (134), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 28/80 (35%), Positives = 48/80 (60%), Gaps = 2/80 (2%) Query: 38 LSQAIDLKPSGGIHIIYKVRSSARLTMGNYAGALEDANEALTLAPRYPEAYICQGDAFLA 97 ++AI+L P+ H++Y RS++ ++ Y+ AL DA + + L P + + Y G A Sbjct: 25 FTEAINLAPTN--HVLYSNRSASYASLNRYSDALSDAKKTVELKPDWVKGYSRLGAAHHG 82 Query: 98 MDQFDDAEKSYSTCLELDPS 117 + QFDDA +Y+ LE+DP+ Sbjct: 83 LAQFDDAVSAYNKGLEIDPN 102 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20414 (345 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5214 78 8e-17 >Contig5214 Length = 355 Score = 77.8 bits (190), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 69/292 (23%), Positives = 118/292 (40%), Gaps = 26/292 (8%) Query: 67 LYDQSSGLWEDIWGDHMHHGFYEPDSAASDADHRFAQIRMIEESLRFAGVSEEGEKRPKR 126 Y+ + ++E WG H + P A H+ A R+ EE V K +R Sbjct: 77 FYNLVTDIYEWGWGQSFH---FSPSVAGKS--HKDAT-RLHEE----MAVDLINVKPGQR 126 Query: 127 VVDVGCGIGGSSRYLAKKYGASCQGITLSPLQAQRAQTLAASQGLADKVSFQVADALDQP 186 ++DVGCG+GG R +A A+ GIT++ Q +RA+ GL + L+ P Sbjct: 127 ILDVGCGVGGPMRAIAAHSRANVVGITINEYQVKRARLHNKKAGLDSLCEVVCGNFLEMP 186 Query: 187 FPDGQFDLVWSMESGEHMPDKKKFVSELARVAAPGGTIILVTWCHRDXXXXXXXXXXXXX 246 FP+ FD +S+E+ H P ++ +E+ RV PG + W D Sbjct: 187 FPENSFDGAYSIEATCHAPKLEEVYAEIFRVLKPGALYVSYEWVTTDKYNGDDAEHREVI 246 Query: 247 XXXDKICSAYYLPDWCSTTDYVKLLESLSLQDIKAADWSEYVAPFWPAVIRSA------- 299 ++ LP + D + + + +K D ++ + W ++ Sbjct: 247 QGIER---GDALPGLRAQVDIAEAARKVGFEVVKEKDLAKPPSEAWWTRLKMGRIAYWRN 303 Query: 300 ---LTFKGFISLLRSGWKTIRGALVMP--LMIRGYKMGLIK-FAIITCRKPE 345 +T F+ + G + L + + RG + G+ +I CRKPE Sbjct: 304 HILVTVLSFLGIAPKGTVDVHEMLFVTADYLTRGGETGIFTPMHMILCRKPE 355 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51189 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26501 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24573 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20166258 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57937 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40998 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60751 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158367455 154 3e-40 >158367455 Length = 251 Score = 154 bits (390), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 70/159 (44%), Positives = 110/159 (69%), Gaps = 4/159 (2%) Query: 44 SSQEDIVYAVLHPLFMVIGFILISGEAILVHRWLPGSRNLKKSVHLSMQGLALASGVFGI 103 S +D+++ V HP+ MVIG ++++GEA+L ++ + G+++ KK VHL++Q +A + G+ Sbjct: 41 SDNKDLIFNV-HPVLMVIGLVILNGEAMLAYKTVSGTKSFKKLVHLTLQFIAFCLSIVGV 99 Query: 104 WT--NFHGQDGIVANFWSLHSWMGLICMLLFGAQWLIGFLSFWHRGEMRTTRVSVLPWHV 161 W FH GI NF+SLHSW+GL C+ LF Q GF+++W+ G + +R +++PWHV Sbjct: 100 WAALKFHNDKGI-DNFYSLHSWLGLACVFLFTIQGAAGFVTYWYPGGSKNSRANLMPWHV 158 Query: 162 FLGLYTYGLAVATAETGLLEKLTFLQTNRNVSKHCTESM 200 F G+Y Y LAV T TG+LEK TFLQ N +S++ TE++ Sbjct: 159 FFGVYIYALAVVTVTTGILEKATFLQANHVISRYSTEAL 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65703 (340 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28146 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60283 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26432 (342 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48963 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48482 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53385 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41364 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57845 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42836 (344 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37731 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig258 230 8e-63 >Contig258 Length = 254 Score = 230 bits (587), Expect = 8e-63, Method: Compositional matrix adjust. Identities = 111/165 (67%), Positives = 130/165 (78%), Gaps = 8/165 (4%) Query: 201 APATKAQVVGWPPIRSFRKNTLATTSKNTEVD------GKAGPGALFVKVSMDGAPYLRK 254 AP KAQVVGWPP+RSFRKN +A K+T+ D G A FVKVSMDGAPYLRK Sbjct: 92 APRAKAQVVGWPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTSTSAAFVKVSMDGAPYLRK 151 Query: 255 VDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGSEYVLTYEDK 314 VDL+ Y +YQELS+AL KMFS FTIG GS G ++ ++ESKL DLL+GSEYV +YEDK Sbjct: 152 VDLKLYQSYQELSTALGKMFSSFTIGNCGSQGM--KDFMNESKLIDLLNGSEYVPSYEDK 209 Query: 315 DGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGLAPRAVEKCKNRN 359 DGDWMLVGDVPW+MF+++CKRLRIMK +AIGLAPRAVEK KNR+ Sbjct: 210 DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23925 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32066 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11077 (113 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666260 (593 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4806 (349 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5700 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55404 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12773 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17373 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32253 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158352558 233 4e-64 >158352558 Length = 141 Score = 233 bits (594), Expect = 4e-64, Method: Compositional matrix adjust. Identities = 113/141 (80%), Positives = 127/141 (90%) Query: 1 MSGEEVVVAVETSAPAPALGEPMDLMTALQLVLRKSLAHGGLARGLHEGAKVIEKHAAHL 60 MSG+E V APAPALGEPMD+MTA+QLVLRKSLAHGGL RGLHE AKV+EKHAA L Sbjct: 1 MSGDEAPAPVVAEAPAPALGEPMDIMTAVQLVLRKSLAHGGLVRGLHEAAKVVEKHAAQL 60 Query: 61 CVLAEDCNQPDYVKLVKALCADHNVSLITVPSAKTLGEWAGLCKIDSEGKARKVVGCSCV 120 CVLAEDC+Q DYVKLVK LCA+HNV+++TVP+AKTLGEWAGLCKIDSEGKARKVVGCSCV Sbjct: 61 CVLAEDCDQQDYVKLVKGLCAEHNVNMLTVPNAKTLGEWAGLCKIDSEGKARKVVGCSCV 120 Query: 121 VVKDFGEETEAMNVVQQQVKS 141 VVKDFGE+ EA++VVQQ VK+ Sbjct: 121 VVKDFGEDHEALHVVQQHVKA 141 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30789 (260 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30012 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60922 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14526 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24828 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64741 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 131 3e-33 >Contig2950 Length = 216 Score = 131 bits (330), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 62/160 (38%), Positives = 97/160 (60%) Query: 12 KLVLLGDMGTGKTSLVLRFVKGQFYDFQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 K+VL+GD G GK++L+ RF + +F +STIG F T+ + +++ +K IWDTAGQER Sbjct: 14 KVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQER 73 Query: 72 YHSLAPMYYRGXXXXXXXYDITSMDSFERAKKWVQELQRQGNPNLLMILVANKADLETKR 131 Y ++ YYRG YD+T +FE ++W++EL+ + N++++LV NKADL R Sbjct: 74 YRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLR 133 Query: 132 EVENEKGEQYAKENGLLFFETSAKTAQNVNELFYEIAKKL 171 V E + +A+ F ETSA + NV F E+ ++ Sbjct: 134 AVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQI 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18966262 (322 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5081 (348 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16066256 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35775 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27537 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9798 (45 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55270 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6184 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6191 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4036 (296 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15674 (389 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4554 (304 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62914 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9128 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7822 (386 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 81 1e-17 >Contig2005 Length = 422 Score = 80.9 bits (198), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 78/275 (28%), Positives = 128/275 (46%), Gaps = 55/275 (20%) Query: 57 RWGLCRLQGPREEMEDEAVVR----SDGLD--GFSFAAVFDGHAGFSSVKF-LRDELYKD 109 R+G + G R +MED + +DG D G F V+DGH G S V +D L++ Sbjct: 124 RFGSTSVCGRRRDMEDAVSIHPKLFNDGSDSDGCHFYGVYDGH-GCSHVALKCKDRLHEI 182 Query: 110 CVAALQGGLLLSGKN-----FNIIREALE---KAFESADAKLLNWLETTGEDVESGSTAT 161 L+ ++ K+ F+ + E ++ +A ++ + + L+T D GSTA Sbjct: 183 VKQDLESQRVVQWKDTMERSFSKMDEEVQAGNRALQNPNCRC--ELQTPQCDA-VGSTAV 239 Query: 162 VLLIGDDMVFISHVGDSCVVLSRSGKAEELTNPHRPYGSNKSSLEEIRRIREAGGWIV-- 219 V ++ + + +S+ GDS VL R G A L++ H+P +E+ RI AGG ++ Sbjct: 240 VAVVTPEKIIVSNCGDSRAVLCRKGAAVPLSSDHKP-----DRPDELLRIEAAGGRVIYW 294 Query: 220 -NGRICGDIAVSRSFGDMRFKTKKNEMLEKGLEEGRWSQKFVSRVQFTGDLVVASPDVFQ 278 R+ G +A+SR+ GD K V++ P+V Sbjct: 295 DGPRVLGVLAMSRAIGDNYLKP----------------------------YVISEPEVTI 326 Query: 279 VALGSDAEFLLLASDGLWDYMNSSEAVTFVRNELR 313 + ++ E L+LASDGLWD +++ A VR LR Sbjct: 327 MDRTAEDECLILASDGLWDVVSNDTACGVVRMCLR 361 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49213 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42152 (539 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56147 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20403 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59502 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7766263 (346 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34312 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21350 (47 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31041 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41919 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38140 (432 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48497 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37204 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49382 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66220 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15366264 (387 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58612 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14945 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47095 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5807 (404 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35377 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53282 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5650 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39117 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28689 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10964 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3572 164 3e-43 >Contig3572 Length = 108 Score = 164 bits (415), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 84/107 (78%), Positives = 100/107 (93%) Query: 60 MLGSGGMPSSHSATVTALAVAIGFQEGTGGSAFAIAVVLACVVMYDASGVRLHAGRQAEL 119 ML SGGMPSSHSA VTAL VA+G +GTGG+AFA+A+VLA +VMYDA+GVRLHAGRQAEL Sbjct: 1 MLDSGGMPSSHSALVTALTVAVGLDQGTGGAAFALALVLALIVMYDATGVRLHAGRQAEL 60 Query: 120 LNQIVCELPPDHPVSNVRPLRDSLGHTPLQVVAGSVLGCVVAYLMKS 166 LNQI+CELPP+HP+S VRPLRDSLGHTP+QVVAG++LGCVVA+LM++ Sbjct: 61 LNQILCELPPEHPLSTVRPLRDSLGHTPVQVVAGAILGCVVAFLMRA 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40628 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9466 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48920 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2998 (387 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47102 (411 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5164 146 2e-37 >Contig5164 Length = 389 Score = 146 bits (369), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 98/294 (33%), Positives = 157/294 (53%), Gaps = 17/294 (5%) Query: 77 IKTLWVGDLHQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRATAEKIL 136 ++ +VG++H + + L+ F TG V S K+IR +++ YGFV +F R A + Sbjct: 18 LRLRYVGNIHTQVTEPLLQEVFASTGAVESCKLIRKEKSS----YGFVHYFDRRCAALAI 73 Query: 137 HSYNGTLMPNTEQPFRLNWATFSTGDRRTDAGSDLSIFVGDLASDVTDALLQETFATRYP 196 S NG + QP ++NWA +++G +R D +IFVGDL+ +VTDA L F+ Y Sbjct: 74 VSLNGRQLFG--QPIKVNWA-YASG-QREDTSGHFNIFVGDLSPEVTDATLFACFSV-YS 128 Query: 197 SVKGAKVVTDSNTGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRIGVATPKKASGX 256 S A+V+ D TGRS+G+GFV F ++ + A+N++NG + +SR +R AT + Sbjct: 129 SCSDARVMWDQKTGRSRGFGFVSFRNQQDAQSAINDLNGKWLASRQIRCNWATKGAGTNE 188 Query: 257 XXXXX--XXALVLAGGNASNGAVAQGSQA-NGDSTNTTIFVGGLDSEVTDEDLRQSFSQF 313 + L G++ +G ++A + TT++VG L EVT DL + F Sbjct: 189 DKQSSDGKSVVELTNGSSEDGKEPTNNEAPENNPQYTTVYVGNLAPEVTQLDLHRHFYAL 248 Query: 314 --GEVVSVKIPVGKGCGFVQFANRNSAEDALQRLN--GTVIGKQTVRLSWGRNP 363 G + V++ KG GFV+F+ A A+Q N + G+Q ++ SWG P Sbjct: 249 GVGVIEEVRLQRDKGFGFVRFSTHGEAALAIQMGNTQSNLFGRQ-IKCSWGSKP 301 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35303 (394 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 115 4e-28 >Contig2005 Length = 422 Score = 115 bits (288), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 87/257 (33%), Positives = 122/257 (47%), Gaps = 19/257 (7%) Query: 85 RSGSFADIGPRRYMEDEHIRIDDLSMHLGSVSRLPNPCAFYGVFDGHGGPEAAAYVRKNV 144 R GS + G RR MED + I + GS S + C FYGV+DGHG A + + Sbjct: 124 RFGSTSVCGRRRDMEDA-VSIHPKLFNDGSDS---DGCHFYGVYDGHGCSHVALKCKDRL 179 Query: 145 DRFFFEDANFPRTSEVNDV----FSERVE--NSVRKAFXXXXXXXXXXXXXXXXXXXXXX 198 +D R + D FS+ E + +A Sbjct: 180 HEIVKQDLESQRVVQWKDTMERSFSKMDEEVQAGNRALQNPNCRCELQTPQCDAVGSTAV 239 Query: 199 XXXIFGRTLMVANAGDCRAVLCRKGQAVDMSQDHRPSYPLERKRVEELGG---FVDGEYL 255 + ++V+N GD RAVLCRKG AV +S DH+P P E R+E GG + DG + Sbjct: 240 VAVVTPEKIIVSNCGDSRAVLCRKGAAVPLSSDHKPDRPDELLRIEAAGGRVIYWDGPRV 299 Query: 256 NGVLSVTRALGDWDMKFPRGSASPLIAEPEFRQVALTEEDEFLIIGCDGIWDVMSSQEAV 315 GVL+++RA+GD +K +I+EPE + T EDE LI+ DG+WDV+S+ A Sbjct: 300 LGVLAMSRAIGDNYLK------PYVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTAC 353 Query: 316 SLVRRGLRRHDDPEQSA 332 +VR LR P S+ Sbjct: 354 GVVRMCLRAQKTPGASS 370 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47006 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15777 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57603 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4218 218 2e-59 >Contig4218 Length = 191 Score = 218 bits (555), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 2/186 (1%) Query: 1 MSFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKP 60 M+F GT QKC AC KTVY V++L+AD ++HK+CF+C HC GTLKLSNY+S EGVLYC+P Sbjct: 1 MAFAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP 60 Query: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSP--SKAASMFSGTQEKCATCGKTAYPL 118 HF+QLFK +G+ +K+F+ K + P + P SKA+ MF GT++KC C T YP Sbjct: 61 HFDQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAASKASGMFGGTRDKCFGCKNTVYPT 120 Query: 119 EKVTVESQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSAS 178 EKVTV YHK CFKC+HGGC ISPSNY A EG LYCKHH QL +EKG+ + L Sbjct: 121 EKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIREKGNLSQLEGGGD 180 Query: 179 MKRSAA 184 +++ A Sbjct: 181 NEKATA 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45791 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3566 111 2e-27 >Contig3566 Length = 175 Score = 111 bits (277), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 66/165 (40%), Positives = 97/165 (58%), Gaps = 15/165 (9%) Query: 5 EKSVMVVGVDDSEHSFYALQWTLDHFFAPFPGTAPFKLVIVHAKPSPTTAIGLAGP-GAA 63 EK VMV VD+SE S YAL W +D+ +P L+I A+P P I A P G+A Sbjct: 15 EKPVMV-AVDESECSHYALMWVIDNLKESINTNSP--LLIFMAQPPPANNITFAAPLGSA 71 Query: 64 --------DVLPYVEADLKKIAGRVVGKAHEICASKSVT-DVILEVVEGDARNVMCEAVE 114 + ++ + +K+ ++ +A +ICAS VT + E+ GDA+ +C AV Sbjct: 72 RMYCPPTPEFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEI--GDAKTAICAAVL 129 Query: 115 KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKI 159 KH+ +LV+G G G IKRA+LGSVS+YC +A C V++VKKP++ Sbjct: 130 KHNVKLLVLGERGLGKIKRAILGSVSNYCVLNAKCPVLVVKKPQV 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10131 (473 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25277 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 150 6e-39 >Contig2950 Length = 216 Score = 150 bits (378), Expect = 6e-39, Method: Compositional matrix adjust. Identities = 86/210 (40%), Positives = 114/210 (54%), Gaps = 13/210 (6%) Query: 15 LIKLLLIGDSGVGKSCLLLRXXXXXXXXXXXXXXXXXXKIRTIELDGKRIKLQIWDTAGQ 74 L K++LIGDSGVGKS LL R R+I +D K +K QIWDTAGQ Sbjct: 12 LFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQ 71 Query: 75 ERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKVLVGNKADMDE 134 ER+R IT+AYYRGA+G LLVYDVT +F N+ W++ + H N+ +LVGNKAD+ Sbjct: 72 ERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADL-R 130 Query: 135 SKRAVPTSKGQALADEYGIKFFETSAKTNLNVEEVFFSIAKDIKQRLAET------DSKA 188 RAV +A A+ F ETSA ++NVE F + I Q ++ D A Sbjct: 131 HLRAVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEVGDDPAA 190 Query: 189 EP--QTIKINQPDQAANGGQAPQKSACCGS 216 P QTI + D + A +K+ CC + Sbjct: 191 VPKGQTINVGGKDDVS----AIKKAGCCSA 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4366264 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20419 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18694 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7245 (280 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20266261 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8576 (323 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4034 347 3e-98 >Contig4034 Length = 239 Score = 347 bits (891), Expect = 3e-98, Method: Compositional matrix adjust. Identities = 157/238 (65%), Positives = 195/238 (81%), Gaps = 2/238 (0%) Query: 1 MAGEMRNHVKYEEEYILNSRGLKLFTCRWFPAN-QDPKALIFILHGYAMECSISMNDTGT 59 MA +M N V YEEEYI NSRG+KLFTC+W P N + PKALI I HGY MECSI+MN T Sbjct: 1 MAIDMGN-VIYEEEYIFNSRGMKLFTCKWLPENNKPPKALILICHGYGMECSITMNSTAI 59 Query: 60 RLAKAGYAVYGIDFEGHGKSSGLGGLISCFDDIVSDCANYFSTICEHKDNIGKMRYLYGE 119 RLAKAG+A+YGID+EGHGKS+GL G + FD +V DC ++F+ ICE K+N GK RYL GE Sbjct: 60 RLAKAGFAIYGIDYEGHGKSAGLAGFVKSFDAVVDDCTSHFTNICESKENKGKTRYLLGE 119 Query: 120 SMGGAIALNLDRQTPDYWDGAVLVAPMCKIADDMKPNPVVITVLTMLCKVIPTWKMIPTE 179 SMGGA+AL + R+ P+YWDGAVLVAPMCKI+D+MKP+PVV++VLT LC+VIPTWK+IPT Sbjct: 120 SMGGAVALLVHRKKPEYWDGAVLVAPMCKISDEMKPSPVVVSVLTQLCRVIPTWKIIPTN 179 Query: 180 DVVEMAFKEPEKRAEIRSNPYCYKGRIRLKTGQELLRVSLDLEKNLHKIQMPFLVVHG 237 DV++ AFK PE R ++R NPYCYKGR RL+TG ELLRVS +LE+ L ++ +PFL++HG Sbjct: 180 DVIDFAFKVPEVRKQVRENPYCYKGRPRLQTGTELLRVSTELEQRLQEVTLPFLILHG 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34890 (312 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2820 (374 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3766256 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16415 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23194 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57895818 101 8e-24 >57895818 Length = 106 Score = 101 bits (251), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 47/79 (59%), Positives = 59/79 (74%), Gaps = 1/79 (1%) Query: 207 LYLANQEKFHKEADKQYWKAIAELIPHEVPNIEXXXXXXXXXXXXSITVIQGPKPGKPTD 266 +++A+QEKFH E DK YWKA+A+LIP+EVP IE S+ V+QGPKPGKPT+ Sbjct: 1 MFVASQEKFHAEVDKNYWKAVADLIPNEVPAIEKRGRKDQEKKP-SVVVVQGPKPGKPTE 59 Query: 267 LSRMRHILVKLKHTPPPHM 285 LSRMR IL+KLKH PPH+ Sbjct: 60 LSRMRQILLKLKHNTPPHL 78 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9627 (481 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41435 (320 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4628 73 2e-15 >Contig4628 Length = 524 Score = 73.2 bits (178), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 54/186 (29%), Positives = 90/186 (48%), Gaps = 19/186 (10%) Query: 36 RVHFMGSGASPLSPDVMDFLRVCFGCQVIEGYGMTETSCLISCM---DKGDNLSGHVGSP 92 ++ F+ S ++ L+P ++ L FG V+E Y MTE + L+ + G + G VG P Sbjct: 281 KLRFIRSCSASLAPSILARLEESFGAPVLEAYAMTEATHLMCSNPLPEDGAHKPGSVGKP 340 Query: 93 NPACEIKLVDVPEMNYTSEDQPYP-RGEICVRGPVLFQGYYKDEVQTKEVIDGDGWLHTG 151 E+ + +N QP GE+C+RGP + +G YK+ + + GW HTG Sbjct: 341 V-GQELAI-----LNENGVVQPSDVSGEVCIRGPNVTKG-YKNNPEANKAAFTFGWFHTG 393 Query: 152 DIGLWLPGGRLKIIDRKKNIFKLAQGEYIAPEKIENVYAKCKFVSQ--CF-----IYGDS 204 D+G G L ++ R K + GE I+P +++ V + Q CF YG+ Sbjct: 394 DVGFLDSDGYLHLVGRIKELINRG-GEKISPIEVDAVLLSHPEICQAVCFGVPDDKYGEE 452 Query: 205 LNSCLV 210 +N ++ Sbjct: 453 INCAII 458 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32125 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158365572 159 2e-41 >158365572 Length = 238 Score = 159 bits (402), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 82/203 (40%), Positives = 116/203 (57%), Gaps = 14/203 (6%) Query: 25 TKASPLPSGMMRISQTPRIVFRATGLRFKSSSIAAVN---ASRTYKQCMPVCLFGGKGQS 81 TK LP + + P + ++ + ++ N A+ T + +PVCL GGKG++ Sbjct: 26 TKPCILPIRAKHVLRNPLVATCKAAVQQRCMTVLKNNRCRAASTSQHSLPVCLLGGKGKN 85 Query: 82 EGDSEASPWKALEKAMGNFKKESSVEDVLRKQIEKQEYFXXXXXXXXXXXXXXXXXXXXX 141 D+E SPWK+LEKAMGN KKESS+EDVLR+QIEK E++ Sbjct: 86 GSDNEGSPWKSLEKAMGNLKKESSIEDVLRQQIEKNEFYEDKDSGTRGGGSGGGGNGGGG 145 Query: 142 XXXX-----------XXIMDEAVQVFLATVAFILLYIYLLDGEEMVRLARDYIKYLFGGQ 190 I+DE +QV LAT+ FI LY+Y++DGEE RLA+DY+KYLF G Sbjct: 146 GGGADPSGGSEDEGFAGIIDETLQVILATIGFIFLYVYIIDGEEWTRLAKDYLKYLFSGS 205 Query: 191 KSIRLQRAMSNWRRFLKRFSTKK 213 +S+RL+RAM NW +F ++ + KK Sbjct: 206 ESVRLRRAMYNWGKFYQKLTEKK 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36904 (446 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4628 138 6e-35 >Contig4628 Length = 524 Score = 138 bits (347), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 102/358 (28%), Positives = 166/358 (46%), Gaps = 27/358 (7%) Query: 81 YTSGTTASPKGVVLHHRGAYIMALSGALVWGMNEGAVYLWTLPMFHCNGWCFTWTLAALC 140 +TSGTT+ PKGV L + V+ + E + LP+FH +G + Sbjct: 169 HTSGTTSRPKGVPLTQLNLASSVRNIRSVYRLTESDSTVIVLPLFHVHGLIAGLLSSFTA 228 Query: 141 GTNICL---RQVATKAIYQAIANDGVTHLCAAPVVLNSIVNAPKSETILPLPRVVHVMTA 197 G + L + + + + T A P + I++ ++ P++ + + Sbjct: 229 GAAVTLPAAGRFSASTFWADMLKYNATWYTAVPTIHQIILDRHANKPEPAYPKLRFIRSC 288 Query: 198 GAAPPPSVLFAMSQQ-GFRVTHTYGLSETYGPSTVCAWK-PEWDELPPETQARLNARQGV 255 A+ PS+L + + G V Y ++E +C+ PE P + + G Sbjct: 289 SASLAPSILARLEESFGAPVLEAYAMTE--ATHLMCSNPLPEDGAHKPGSVGK---PVGQ 343 Query: 256 RYIGLEGLDVVSTTDMKPVPADGTTIGEIVMRGNTVMKGYLKNPKANEETFANGWFHSGD 315 L VV +D+ GE+ +RG V KGY NP+AN+ F GWFH+GD Sbjct: 344 ELAILNENGVVQPSDVS---------GEVCIRGPNVTKGYKNNPEANKAAFTFGWFHTGD 394 Query: 316 LGVKHPDGYIQLKDRSKDIIISGGENISSVEIENAVYLHPAVLEASVVARPDDRWGES-P 374 +G DGY+ L R K++I GGE IS +E++ + HP + +A PDD++GE Sbjct: 395 VGFLDSDGYLHLVGRIKELINRGGEKISPIEVDAVLLSHPEICQAVCFGVPDDKYGEEIN 454 Query: 375 CAFVTLKPGVDRSDERRLAEDIMKFCRSKLPAYWIPKSV-VFGPLPKTATGKIQKHLL 431 CA + R ++M+FC+ L A+ +PK V + +PKTATGKIQ+ ++ Sbjct: 455 CAI------IPREGSSIDEAEVMRFCKKNLAAFKVPKKVFITDSVPKTATGKIQRRIV 506 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29266 (341 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2866 186 2e-49 >Contig2866 Length = 330 Score = 186 bits (471), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 107/303 (35%), Positives = 155/303 (51%), Gaps = 12/303 (3%) Query: 29 YYDDTCPNASSIVRGVIQEAFISDVRIGASLIRLHFHDCFVNGCDGSLLLDNTETIVSEK 88 +Y D+CP A IVR ++ + S +R FHDC V CD SLLLD+T +SEK Sbjct: 35 FYSDSCPQAEEIVREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRSLSEK 94 Query: 89 DAIPNANSTRGFEVVDSIKTALESSCPGIVSCADILAIAAEASVCMSGGPSWTVLLGRRD 148 + + + R F ++ IK ALE CPG+VSC+DIL ++A V GGP + GRRD Sbjct: 95 E-MDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLGGPFIPLKTGRRD 153 Query: 149 SRIANQSGANTALPNPRQNITTLKAVFEAVGLNTTTDLVALSGAHTFGRGACRFFSDRIY 208 R + LP+ ++++T+ F A+G++T +VAL GAH+ GR C R+Y Sbjct: 154 GRRSRAEILEEYLPDHNESMSTVLEKFSAMGIDTPG-VVALLGAHSVGRTHCVKLVHRLY 212 Query: 209 NFSGTESPDPSLNSSYLETLSALCPQ---DGDGTVLANLDPTTPDGFDKNYFSNLQENRG 265 DP+LN ++ + CP D D TP FD NY+ N+ +N+G Sbjct: 213 -----PEVDPALNPDHVPHMLKKCPDAIPDPKAVQYVRNDRGTPMIFDNNYYRNILDNKG 267 Query: 266 LLQSDQELFSTTGSDTIDIVNLFASNETAFFESFVESMIRMGNISPLTGTEGEIRLDCRK 325 L+ D +L T T V A ++ FF+ F + + +PLTG +GEIR C Sbjct: 268 LMMVDHQL--ATDKRTKPYVKKMAKSQDYFFKEFTRAFTILSENNPLTGDKGEIRQQCNV 325 Query: 326 VNN 328 N Sbjct: 326 ANK 328 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14866265 (539 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51049 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56745 (547 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13708 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 90 6e-21 >Contig3037 Length = 313 Score = 90.1 bits (222), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 48/88 (54%), Positives = 63/88 (71%), Gaps = 5/88 (5%) Query: 34 KLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLKKKLMRMGIDPNNHR-LGE-RASGTSK 91 KLH+LLGN+WSLIAGRLPGRTDNE+KNYWN+H+K+KL+ G+DP HR L E A+ T+ Sbjct: 80 KLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRGLDPQTHRPLNEAGAAATAA 139 Query: 92 SFESRDQTSN---PLISAADNNAVLDST 116 + SR N P +S N+++D T Sbjct: 140 TAASRLDFRNGSPPFLSVEKINSLMDQT 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34171 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27048 (386 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28701 (382 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53094 (331 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5776 192 3e-51 >Contig5776 Length = 289 Score = 192 bits (487), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 105/262 (40%), Positives = 144/262 (54%), Gaps = 9/262 (3%) Query: 29 LKQNYYANICPNVENIVRGVVNMKFKQTFVTVPATLRLFFHDCFVQGCDASVIISSTGSN 88 L ++Y + CP +++IVR + FK+ LRL FHDCFVQGCD SV++ + S Sbjct: 36 LSWSFYDSSCPKLDSIVRKQLKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLDGSASG 95 Query: 89 TAEKDHPDNLSLAGDGFDTVIKAKAEVDKNPTCRNKVSCADILTMATRDVIALSGGPSYA 148 +E+ P NLSL F + + V + C VSCAD+ +A RD + LSGGP Y Sbjct: 96 PSEQQAPPNLSLRAKAFQIINDLREIV--HSKCGRVVSCADLTALAARDAVFLSGGPEYE 153 Query: 149 VELGRLDGLR-STSASVNGKLPQPTFNLDKLNSLFAANGLSQTDMIALSAAHTLGFSHCS 207 V LGR DGL +T LP PT N KL + A L TD++ALS HT+G HC+ Sbjct: 154 VPLGRKDGLNFATRNETLANLPAPTSNTTKLLTDLAKKNLDATDVVALSGGHTIGLGHCT 213 Query: 208 KFANRIYNFSRENPVDPTLDKTYAAQLQSMCPKNVDPRIAIDMDPTTPKKFDNVYYQNLQ 267 F R+Y D ++DKT+A L+ +CP D +D +P FDN YY +L Sbjct: 214 SFTGRLYPTQ-----DASMDKTFANDLKQVCPA-ADTNATTVLDIRSPDTFDNKYYVDLM 267 Query: 268 QGKGLFTSDEVLFTDSRSKPTV 289 + LFTSD+ L+TD R++ V Sbjct: 268 NRQCLFTSDQDLYTDKRTRDIV 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2866265 (276 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 72 4e-15 >89552756 Length = 189 Score = 71.6 bits (174), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 61/205 (29%), Positives = 101/205 (49%), Gaps = 33/205 (16%) Query: 30 MANGSVASCLRERPPSEPPLDWTTRKRIALGSARGLSYLHDHCDPKIIHRDVKAANILLD 89 M NGS+ L+++ + +D R IA+ +A G+ YLH I+H D+K N+L++ Sbjct: 1 MVNGSLKQFLQKK---DRTIDRRKRLIIAMDAAFGMEYLHGK---NIVHFDLKCENLLVN 54 Query: 90 ----EEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKS---SEKTDVFGY 142 + +GD GL+K+ + T V+ VRGT+ +APE LS GKS +EK DV+ + Sbjct: 55 MRDPQRPVCKIGDLGLSKV--KQQTLVSGGVRGTLPWMAPELLS-GKSHMVTEKIDVYSF 111 Query: 143 GIMLLELITGQRAFDLARLANDDDVMLLDWVXXXXXXXXXXXXVDPDLQTNYVEAEVEQL 202 GI++ EL+TG + A+ + P + T + + E + L Sbjct: 112 GIVMWELLTGDEPYTDMHCAS-------------IIGGIVNNTLRPQIPT-WCDPEWKSL 157 Query: 203 IQVALLCTQGSPMERPKMSEVVRML 227 ++ C P +RP SE+ + L Sbjct: 158 MES---CWGSEPAQRPSFSEISQKL 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26058 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5049 60 1e-11 >Contig5049 Length = 364 Score = 60.5 bits (145), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 50/179 (27%), Positives = 94/179 (52%), Gaps = 6/179 (3%) Query: 121 ERLQVTDMGLSAISK-CLNLEILHILRTPECTNLGLVSVAGNCKLLRKLHIDGWRTNRIG 179 ++ Q+ D + +I+ C +L++L + ++ + T+ L ++A C L +L+I G + Sbjct: 109 DKPQLEDNAVESIANFCHDLQVLDLSKSFKLTDRSLYALAHGCPNLMRLNISG--CSAFS 166 Query: 180 DEGLIAVAKQCTNLQELVLIGVNPTSS--SITAVASNCQKLERLALCGSQTIGDKEISSI 237 D L +A C ++ L L G + +S ++ A+ C +L+ L L + +GD + S+ Sbjct: 167 DIALEYLAGFCPKMKVLNLCGCSRAASDRALQAIGRYCSELQCLNLGWCEEVGDVGVMSL 226 Query: 238 AAKCTALRKLCIKGC-PISDHGMEALAWGCPNLVKVKVKKCPGVTCEAVDSLRARREAL 295 A C LR + + GC I+D + ALA CP+L + + C +T +A+ SL A+ Sbjct: 227 AYGCPDLRTVDLCGCVQITDDSVVALANKCPHLRSLGLYYCQNITDKAMYSLAQSLAAM 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2674 (389 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22173 (531 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77980463 243 2e-66 >77980463 Length = 260 Score = 243 bits (619), Expect = 2e-66, Method: Compositional matrix adjust. Identities = 120/262 (45%), Positives = 162/262 (61%), Gaps = 7/262 (2%) Query: 268 NLMMVGDGMGATVITGNRSYIDGWTTYASATFAVKGKGFIARDMTFENTAGPEKHQAVAL 327 N+M +GDG T ITG++++ DG + +AT V G FIA+DM FEN+AG + HQA+AL Sbjct: 3 NVMFIGDGPTKTKITGDKNFADGTHPFRTATVVVIGDYFIAKDMGFENSAGAKGHQAMAL 62 Query: 328 RSDSDLSVYYRCSMRGYQDTLYPHTNRQFYRECRISGTVDFIFGDATVVFQNCQILVKKG 387 R SD S++Y C M GYQ+TL+ T RQFYR+C ISG VD IFGDA VVFQNC+++++K Sbjct: 63 RVQSDQSIFYNCQMDGYQNTLFTQTYRQFYRDCTISGAVDIIFGDAAVVFQNCKMIIRKP 122 Query: 388 LPNQKNTITAQGRKDPAQPTGFSIQFSNISADSDLLASVNSTLSYLGRPWKQYSRTIIMK 447 + K T+TAQ R D QPT Q S ISAD + ++LGRP YSRT++M+ Sbjct: 123 EGDDKATVTAQERSDKRQPTAIVFQNSTISADKEY----KDKTAFLGRPAHTYSRTVVMQ 178 Query: 448 SYISDAIRPEGWLEWNGDFALDTLYYGEYMNYGPSAGLGSRVQWPGFHLLNNSAQAANFT 507 S I D I PEGW W G + ++GE+ N G + RV W F ++ QA F+ Sbjct: 179 SQIDDVISPEGWTPWTGQSNTEECWFGEFSNRGSGSATNKRVSW--FKMVARD-QADEFS 235 Query: 508 VTEFIAGNLWLPSTGVKYSAGL 529 + + G W+ +GV Y AGL Sbjct: 236 ASSLLFGENWIKPSGVPYEAGL 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9766265 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19510 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158359626 304 3e-85 >158359626 Length = 291 Score = 304 bits (779), Expect = 3e-85, Method: Compositional matrix adjust. Identities = 155/242 (64%), Positives = 182/242 (75%), Gaps = 20/242 (8%) Query: 12 ACCGSKKFAEEMTSSGPFANLDQAIDAARDIWFNKVDVNGWLEAFAAHPQIGQNPSAKHP 71 ACCGS +FA+EM + PF++L++A+ ARD+WFNKVDV GWL+AF+AHPQIG +P + Sbjct: 13 ACCGSTQFAKEMAKASPFSSLEEAVTVARDVWFNKVDVTGWLQAFSAHPQIGHSPPSSS- 71 Query: 72 SDTSAQWSKGEQSTALQTATDSSLQELSDWNARYWKKFGFVFLICASGRTASEILAELKR 131 TSAQWSKGEQSTA+ TAT SSLQELS WNARY +KFGFVFLICASG++ ILAELK+ Sbjct: 72 HPTSAQWSKGEQSTAIATATSSSLQELSQWNARYREKFGFVFLICASGKSTDGILAELKK 131 Query: 132 RYPNRPIVEFEIAAQEQMKVTELRLAKLFSTQVKAASISTQNPETAAKKAGEDRVSIIGA 191 RYPNRPIVEFEIAA+EQMK+TELRLAKLFST+ K S NP AAKK Sbjct: 132 RYPNRPIVEFEIAAKEQMKITELRLAKLFSTKEKVPSTGNVNPSVAAKKV---------- 181 Query: 192 HLTATSEASAGKTPQISPRTRPPITTHVLDVARGSPAAGIEVRLEMWKGNQPRPLFGKED 251 EA +TP RTRPPITTHVLD++RGSP AGIEV LEMWKG+QP P+FG+ Sbjct: 182 ------EAVKTETPT---RTRPPITTHVLDISRGSPGAGIEVCLEMWKGHQPHPVFGEST 232 Query: 252 EG 253 G Sbjct: 233 TG 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1799 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11167 (492 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1285 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57051 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31880 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3724 157 7e-41 >Contig3724 Length = 251 Score = 157 bits (396), Expect = 7e-41, Method: Compositional matrix adjust. Identities = 77/85 (90%), Positives = 83/85 (97%) Query: 165 TCPIDTLKLGACVDLLGGLVHIGLGDPVANECCPVLSGLVELEAAVCLCTTLKIKLLNLN 224 TCPIDTLKLGACVDLLGGLVHIGLGDPV NECCPVLSGLVELEAAVCLCT LKIKLLNLN Sbjct: 167 TCPIDTLKLGACVDLLGGLVHIGLGDPVVNECCPVLSGLVELEAAVCLCTALKIKLLNLN 226 Query: 225 IFVPLALQLLITCGKTPPPGYTCTV 249 IFVP+ALQLL+TCGK+PPPG+TC++ Sbjct: 227 IFVPIALQLLVTCGKSPPPGFTCSI 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21666261 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62748 (238 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158350790 264 4e-73 >158350790 Length = 240 Score = 264 bits (674), Expect = 4e-73, Method: Compositional matrix adjust. Identities = 132/214 (61%), Positives = 151/214 (70%), Gaps = 23/214 (10%) Query: 26 ADNEEEDPGLVMNFYKDTCPQAEDVIREQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDAX 85 A++ EEDPGLVMNFY D+CPQAE+++REQV+LLYKRHKNTAFSWLRNIFHDCAVQSCDA Sbjct: 22 AESNEEDPGLVMNFYSDSCPQAEEIVREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDAS 81 Query: 86 XXXXXXXXXXXEKETDRSFGLRNFRYLDRF-AAIGIDTPGLVALLGAHSVGRTHCVKLVH 144 EKE DRSFG+RNFRY++ A+ + PG+V+ Sbjct: 82 LLLDSTRRSLSEKEMDRSFGMRNFRYIEEIKEALERECPGVVS----------------- 124 Query: 145 RLYPEVDPVLNTDHVEHMLHKCPDAIPDPKAVQYVRNDRGTPMKLDNNYYRNILDNKGLL 204 +L E ++ IPDPKAVQYVRNDRGTPM DNNYYRNILDNKGL+ Sbjct: 125 -----CSDILVLSAREGVVRLGGPFIPDPKAVQYVRNDRGTPMIFDNNYYRNILDNKGLM 179 Query: 205 IVDHQLATDKRTKPYVKKMAKSQDYFFKEFCRAI 238 +VDHQLATDKRTKPYVKKMAKSQDYFFKEF RA Sbjct: 180 MVDHQLATDKRTKPYVKKMAKSQDYFFKEFTRAF 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18033 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52183 (405 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51307 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2427 439 e-126 >Contig2427 Length = 260 Score = 439 bits (1130), Expect = e-126, Method: Compositional matrix adjust. Identities = 203/253 (80%), Positives = 230/253 (90%) Query: 6 VVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV 65 ++C ASL SL + A+IPG Y+GG WQ AHATFYGGSDASGTMGGACGYGNLYSQGYGV Sbjct: 8 LLCIASLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGYGV 67 Query: 66 NTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSDNGGWC 125 NTAALSTALFNNGLSCGACFE+KC +DP WC +G PSI +TATNFCPPN+A PSDNGGWC Sbjct: 68 NTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGGWC 127 Query: 126 NPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGMRFTINGFRYFNLVLITNVAG 185 NPPR HFDLAMPMFLKIAEY+AGIVPV++RRVPC K+GG+RFTING +YFNLVL+TNVAG Sbjct: 128 NPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNVAG 187 Query: 186 AGDIVRASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPAHW 245 AGDIV SVKG+ TGWM +SRNWGQNWQSN+VLVGQ+LSFRV GSDRR+ST++N+APA+W Sbjct: 188 AGDIVSVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTYNVAPANW 247 Query: 246 QFGQTFSGKNFRV 258 QFGQT+SGKNFRV Sbjct: 248 QFGQTYSGKNFRV 260 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15978 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38640 (513 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2428 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6806 (388 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158357520 87 2e-19 >158357520 Length = 260 Score = 86.7 bits (213), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 66/247 (26%), Positives = 109/247 (44%), Gaps = 28/247 (11%) Query: 62 SCEFSDGKWVYDL-SYPLYDSSCPYLSTPVTC----QKNGRPDSDYEKWRWKPHGCSIPR 116 SC++SDG W+YD + P YD +C + C + NGR + KWRWKP+GC +P Sbjct: 18 SCDYSDGAWIYDPNASPKYDHTCKEIFKGWNCISGNKSNGR---ELTKWRWKPNGCDLPT 74 Query: 117 FDALHFLGRMRRKRIMLVGDSIMRNQWESLVCLVQGVIPTGRKTVTYDGPSMAFHALDFE 176 FD + FL R I +GDS+ RN + +L C ++ V +K + G F L + Sbjct: 75 FDPVRFLHMYRNTSIGFIGDSLNRNMFVALFCSLKRVSSEVKKWRPF-GADRGFTFLQYN 133 Query: 177 TSIEFCWAPFLVELKKGPQNKRILHLDLIEENAKYWRGV--------------DVLVYDS 222 ++ + L + N L+ + Y V D+L++++ Sbjct: 134 VTLAYHRTNLLARYGRWSANANGGVLESLGYKEGYRVDVDIPADTWAESLSFHDILIFNT 193 Query: 223 AHWWTHSDKWSSWD----YYMEANTVLRSMNPMVAYQKGLTTWAKWVDLNLDPHKTRVIF 278 HWW K+ + ++ V+ + P V + L +V+ + P + F Sbjct: 194 GHWWWAPAKFDPINSPLLFFENGQPVVPPVLPDVGFDMVLKHMVMFVEKRMKPGAIK-FF 252 Query: 279 RSVSPRH 285 R+ SPRH Sbjct: 253 RTQSPRH 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47074 (437 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4811 598 e-173 >Contig4811 Length = 440 Score = 598 bits (1542), Expect = e-173, Method: Compositional matrix adjust. Identities = 295/411 (71%), Positives = 327/411 (79%), Gaps = 2/411 (0%) Query: 29 KCE-TPDQGSTLQVLHVYSPCSPFRPKEPLSWEESVLQMQAKDKARLQFLSSLV-ARKSV 86 KC T D GS LQV HVYSPCSPFRP + LSWEE VLQ AKD+ARLQFL+SL A+KS+ Sbjct: 30 KCSATNDHGSDLQVFHVYSPCSPFRPAQTLSWEEDVLQTLAKDQARLQFLASLAGAKKSI 89 Query: 87 VPIASGRQIVQNPTYIVRAKIGTPAQTMLMAMDTSSDVAWIPCNGCLGCSSTLFNSPAST 146 VPIASGRQI+Q+PTYIVRAKIGTP QT+LMA+DTSSD AW+PCNGC+GCSS +FNS ST Sbjct: 90 VPIASGRQIIQSPTYIVRAKIGTPPQTLLMAVDTSSDAAWVPCNGCVGCSSNVFNSLKST 149 Query: 147 TYKSLGCQAAQCKQVPKPTCGGGVCSFNLTYGGSSLAANLSQDTITLATDAVPGYSFGCI 206 T+KS+GC A QCKQ P P+C G CSFN+TYGGSS+A+NLS DT TLA D VP Y+FGCI Sbjct: 150 TFKSVGCGAPQCKQAPNPSCLGSTCSFNMTYGGSSIASNLSTDTFTLANDVVPAYTFGCI 209 Query: 207 QKATGGSXXXXXXXXXXXXXXXXXXXTQNLYQSTFSYCLPSFKSLNFSGSLRLGPVGQPK 266 QK TG S TQNLY+STFSYCLP +KSLNFSGSLRLG VGQP Sbjct: 210 QKTTGSSVPPQGLLGLGRGPLSLLSQTQNLYKSTFSYCLPGYKSLNFSGSLRLGTVGQPI 269 Query: 267 RIKYTPLLKNPRRPSLYFVNLMAXXXXXXXXXXXXXSFTFNPSTGAGTIFDSGTVFTRLV 326 +IKYTPLLKNPRR SLY+VNL A + FNP+TGAGT+ DSGTVFTRLV Sbjct: 270 KIKYTPLLKNPRRASLYYVNLNAIRVGRRIVDIPPSALAFNPTTGAGTVIDSGTVFTRLV 329 Query: 327 TPAYIAVRDAFRNRVGRNLTVTSLGGFDTCYTVPIAAPTITFMFTGMNVTLPPDNLLIHS 386 TPAY AVR+ FR RVGR L VT+LGGFDTCYT PI PTITFMFTGMNVTLP DN++I S Sbjct: 330 TPAYEAVRNEFRRRVGRKLLVTTLGGFDTCYTAPIVVPTITFMFTGMNVTLPADNVVIRS 389 Query: 387 TAGSTTCLAMAAAPDNVNSVLNVIANLQQQNHRLLYDVPNSRLGVARELCT 437 TAGSTTCLAMAAAPDNVNSVLNVIAN+QQQNHR+L DVPNSRLGVARE CT Sbjct: 390 TAGSTTCLAMAAAPDNVNSVLNVIANMQQQNHRVLIDVPNSRLGVAREQCT 440 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21354 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22056 (487 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12166257 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 135 2e-34 >Contig2950 Length = 216 Score = 135 bits (339), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 77/209 (36%), Positives = 126/209 (60%), Gaps = 19/209 (9%) Query: 8 LLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQ 67 L KV+++GDSGVGK++L++++ +FS + K+TIG +F T+ + +D++ QIWDTAGQ Sbjct: 12 LFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQ 71 Query: 68 ERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKV 127 ER++++ A+YRGA +LVYDV +F+N+ W +E N +++GNK Sbjct: 72 ERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKEL----RDHTDSNIVIMLVGNKA 127 Query: 128 DVDGGNSRVVSDKKARAWCASKGNIPYFETSAKEGINVEEAF--------QCIAKNALKT 179 D+ + R VS + A+A+ A + N + ETSA E +NVE AF Q +++ AL+ Sbjct: 128 DLR--HLRAVSVEDAKAF-AERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEV 184 Query: 180 GEE-EEIYLPDTIDVGSS---SQQRSSGC 204 G++ + TI+VG S + +GC Sbjct: 185 GDDPAAVPKGQTINVGGKDDVSAIKKAGC 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41852 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50199 (415 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10257 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3724 99 2e-23 >Contig3724 Length = 251 Score = 99.0 bits (245), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 47/63 (74%), Positives = 55/63 (87%) Query: 147 QQTCPIDTLKLGACVDLLGGLVHIGIRSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLN 206 + TCPIDTLKLGACVDLLGGLVHIG+ + CCPVL GLV+L+AAVCLCTA+K+KLLN Sbjct: 165 KDTCPIDTLKLGACVDLLGGLVHIGLGDPVVNECCPVLSGLVELEAAVCLCTALKIKLLN 224 Query: 207 VNI 209 +NI Sbjct: 225 LNI 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5906 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46095 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 204 3e-55 >158372667 Length = 230 Score = 204 bits (519), Expect = 3e-55, Method: Compositional matrix adjust. Identities = 106/183 (57%), Positives = 130/183 (71%), Gaps = 4/183 (2%) Query: 1 MAFNKLTDSGSSTPAGLVAAALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLL 60 MA +KL G+ T L A+ H + V +S G +ISGGH+NPAVT G GGHITL Sbjct: 40 MATDKL---GADTTVALFFIAITHALVVAVMISAG-HISGGHLNPAVTLGLLAGGHITLF 95 Query: 61 RGILYWIAQLLGSVVACLLLKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYA 120 R +LYWI QLL + +C LLK+ TGGL T SL+SGV +++EI++TF L++TVYA Sbjct: 96 RSVLYWIDQLLAAAASCYLLKYLTGGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYA 155 Query: 121 TAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWSWANHWVYWA 180 T VDPKKG+L + P GF+VGANILAGGAF GASMNPA SFGPA+VSW W +HWVYW Sbjct: 156 TMVDPKKGSLDGLGPTLTGFVVGANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWV 215 Query: 181 GPL 183 GPL Sbjct: 216 GPL 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2096 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 60 7e-12 >158372667 Length = 230 Score = 60.1 bits (144), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 41/111 (36%), Positives = 59/111 (53%), Gaps = 8/111 (7%) Query: 30 INAVASGYSKLAGLGAEIVGTFVLVYTVLSA-TDAKRNARDSHVPILAPLPIGFAVFLVH 88 I+++ASG G+ EI+ TF L++TV + D K+ + D L P GF V Sbjct: 126 IHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDG----LGPTLTGFVVGANI 181 Query: 89 LATIPITGTGINPARSLGAAIIYNRGNAWDDMWIFWVGPFIGATLATLYHQ 139 LA +G +NPARS G A++ W D W++WVGP IG LA ++ Sbjct: 182 LAGGAFSGASMNPARSFGPALVSWD---WTDHWVYWVGPLIGGGLAGFIYE 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7366262 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13274 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20752 (307 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13591 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5185 219 8e-60 >Contig5185 Length = 232 Score = 219 bits (559), Expect = 8e-60, Method: Compositional matrix adjust. Identities = 106/181 (58%), Positives = 127/181 (70%), Gaps = 4/181 (2%) Query: 27 QPHRLERKWTFWFD-NQSKPKQGAA--WGTSLRKAYTFETVEEFWCLYDQIFKPSKLPAN 83 Q H LE WTFWFD SKP + WG+SLR YTF TVEEFW +Y+ I PSKL Sbjct: 53 QQHPLEHSWTFWFDIPSSKPGKSKQEDWGSSLRPIYTFSTVEEFWGIYNNIRHPSKLNVG 112 Query: 84 ADFHLFKAGVEPKWEDPECANGGKWTVASSRKGNLDTMWLETLMALIGEQFDEADEICGV 143 DFH FK +EPKWEDP CANGGKWT+ + KG D WL TL+ALIGEQFD DEICG Sbjct: 113 TDFHCFKNKIEPKWEDPVCANGGKWTL-TFPKGKSDNSWLHTLLALIGEQFDHGDEICGA 171 Query: 144 VASVRQRQDKLALWTKTATNEAAQMSIGRKWKEVIDVTDKITYSFHDDSRRERSVKVRYN 203 V +VR RQ+K+++WTK A NEAAQMSIG++WK +D + I + FH+D+RRER+ K Y Sbjct: 172 VVNVRGRQEKISIWTKNAENEAAQMSIGKQWKSFLDSNENIGFIFHEDARRERNPKNSYT 231 Query: 204 V 204 V Sbjct: 232 V 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17425 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2603 112 1e-27 >Contig2603 Length = 401 Score = 112 bits (281), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 69/106 (65%), Positives = 78/106 (73%), Gaps = 5/106 (4%) Query: 6 MALVKPISKF-STSTP---NPRAPYSKVFRISMSATSQPSTGKRPSKKAAKTAIKETLLT 61 MALVKP++ F + +TP N R+ S + +M S S+ + K A K AIKETLL Sbjct: 1 MALVKPMTNFGNVTTPKFGNTRSSSSGKWS-TMIRMSSSSSTTKKGKGAPKKAIKETLLA 59 Query: 62 PRFYTTDFDEMETLFNTEINKNLNQTEFEALLQEFKTDYNQTHFVR 107 PRFYTTDFDEMETLFNTEIN NLNQ EFEALLQEFKTDYNQTHFVR Sbjct: 60 PRFYTTDFDEMETLFNTEINNNLNQAEFEALLQEFKTDYNQTHFVR 105 Score = 103 bits (256), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 58/74 (78%), Positives = 66/74 (89%) Query: 99 DYNQTHFVRKLDRMVEINQQLIAVGESDDIPVVKNLKKIPLIAGLASEILAAYLMPPVES 158 D F RKLDRMVEINQ+LIAVGESDDIP+VKNL +IP++A LASE+LAAYLMPP+ES Sbjct: 328 DVENPEFKRKLDRMVEINQKLIAVGESDDIPLVKNLNRIPIVAALASELLAAYLMPPIES 387 Query: 159 GSVDFAEFEPQLVY 172 GSVDFAEFEPQ+VY Sbjct: 388 GSVDFAEFEPQVVY 401 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv927 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49339 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2666262 (383 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15037 (398 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22651 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61295 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22560 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37239 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 84 7e-19 >Contig3804 Length = 391 Score = 84.3 bits (207), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 36/58 (62%), Positives = 44/58 (75%) Query: 54 YRGVRMRTWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNSAILNFPE 111 YRG+R R WGKW +EIR+PRK R+WLGTF+T E AARA+D A I+G A +NFPE Sbjct: 118 YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26961 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14030 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18823 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18824 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17597 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57243 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50164 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11919 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21920 (109 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2737 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35366259 (371 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36473 (67 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3577 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15312 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1759 228 1e-62 >Contig1759 Length = 269 Score = 228 bits (581), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 109/135 (80%), Positives = 122/135 (90%) Query: 11 QRPILVAASVGSYGAYLADGSEYSGHYGAAVTLETLKDFHRRRVQVLAESGADLIAFETI 70 + P+LVAASVGSYGAYLADGSEYSG+YG AV+LETLKDFH+ RVQ+LA SGADLIAFETI Sbjct: 135 RHPVLVAASVGSYGAYLADGSEYSGNYGDAVSLETLKDFHKERVQILANSGADLIAFETI 194 Query: 71 PNKLEAKAYAELLDEVNIKIPAWFSFTSLDGINVVSGDSLIECASIADSCKQVVAVGINC 130 PNKLEAKAYAELL+E I IPAWF+F S DGINVVSGDS+ ECASIA++CKQVVAVGINC Sbjct: 195 PNKLEAKAYAELLEEEAIDIPAWFTFASKDGINVVSGDSIFECASIANACKQVVAVGINC 254 Query: 131 TPPRFIHGLILLIQK 145 TPPRFI GLI I++ Sbjct: 255 TPPRFIQGLISSIRR 269 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31219 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8820 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3139 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33548 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48206 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10966264 (513 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31981 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2138 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv569 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28791 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32375 (334 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10294 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20032 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12295 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21042 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6266261 (425 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47042 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9212 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43299 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57609 (568 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19151 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53716 (254 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28883 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55264 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8059 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37676 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14923 (117 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29537 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17700 (423 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8462 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5162 98 5e-23 >Contig5162 Length = 448 Score = 98.2 bits (243), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 43/69 (62%), Positives = 52/69 (75%) Query: 150 FAFMTKSEVDHLEDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPSIVI 209 T SE+D L+DGYRWRKYGQK VK +P PRSYY+CT++ C V+K VER+S D VI Sbjct: 372 IVVQTTSEIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTSTGCPVRKHVERASHDMRAVI 431 Query: 210 TTYEGQHCH 218 TTYEG+H H Sbjct: 432 TTYEGKHNH 440 Score = 68.6 bits (166), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Query: 162 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPSIVITTYEGQHCH 218 +DGY WRKYGQK VK S PRSYY+CT C KK+VERS D I Y+G H H Sbjct: 216 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITQIVYKGSHNH 271 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35126 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48987 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15880 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26272 (357 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57896440 65 6e-13 >57896440 Length = 244 Score = 65.1 bits (157), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Query: 113 DYYEVLGLEKSCTVEDIRKAYRKLSLKVHPDKNKA--PGAEEAFKAVSKAFQCLSNEESR 170 DYY++L +EKS T ++++KAYRKL++K HPDKN AE FK +S+A++ LS+ + R Sbjct: 4 DYYKLLQVEKSATEDELKKAYRKLAMKWHPDKNPTNKKEAETKFKQISEAYEVLSDPQKR 63 Query: 171 KKYDLVGSD 179 YD G + Sbjct: 64 AIYDQYGEE 72 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49124 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13327 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46771 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17532 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15181 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43278 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52403 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3410 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32048 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10640 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33277 (254 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56385 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25666263 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16336 (400 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 446 e-127 >Contig2005 Length = 422 Score = 446 bits (1146), Expect = e-127, Method: Compositional matrix adjust. Identities = 243/411 (59%), Positives = 285/411 (69%), Gaps = 35/411 (8%) Query: 1 MAGICCGVVGESKTQAAIEXXXXXXXXXXXXXXHLKFVAGVSVP---TPEKSRKRQKLEV 57 MAGICCG+VGES+T A IE +K +A + T + RKRQKL++ Sbjct: 1 MAGICCGLVGESETAAPIEPSSRTSRRRRLDILPIKCIAADQMAVQQTADNGRKRQKLDL 60 Query: 58 YDKTASEAARECENALENCKVQEDESVELKGGVSVQVEQDQLV----------------- 100 +R+ E+A E K + +E E GG + ++ ++V Sbjct: 61 L----RALSRDAESAAE--KARGEEKREKSGGATGGLDDGEVVITRGESKALHAGNQVVV 114 Query: 101 -----QECPKFGMTSVRGRRRDMEDAVSIHPSFWGQDAQNCTGLHYYGVYDGHGCSHVAM 155 QE P+FG TSV GRRRDMEDAVSIHP + D + G H+YGVYDGHGCSHVA+ Sbjct: 115 PPRVVQEPPRFGSTSVCGRRRDMEDAVSIHPKLF-NDGSDSDGCHFYGVYDGHGCSHVAL 173 Query: 156 KCKDRMHEIAKEEIE--RCGQSWEQVMERSFSRMDKEVVEWCNGQWSSNCRCELRTPQCD 213 KCKDR+HEI K+++E R Q W+ MERSFS+MD+EV + NCRCEL+TPQCD Sbjct: 174 KCKDRLHEIVKQDLESQRVVQ-WKDTMERSFSKMDEEVQAGNRALQNPNCRCELQTPQCD 232 Query: 214 AVGSTAVVAIVTPEKVVVSNCGDSRAVLCRNGVAIPLSSDHKPDRPDELLRIQAAGGRVI 273 AVGSTAVVA+VTPEK++VSNCGDSRAVLCR G A+PLSSDHKPDRPDELLRI+AAGGRVI Sbjct: 233 AVGSTAVVAVVTPEKIIVSNCGDSRAVLCRKGAAVPLSSDHKPDRPDELLRIEAAGGRVI 292 Query: 274 YWDVPRVLGVLAMSRAIGDNYLKPYVISEPEVTTWDRSPEDECLILASDGLWDVVSNDTA 333 YWD PRVLGVLAMSRAIGDNYLKPYVISEPEVT DR+ EDECLILASDGLWDVVSNDTA Sbjct: 293 YWDGPRVLGVLAMSRAIGDNYLKPYVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTA 352 Query: 334 CGVARMCLNAQAPPSPPVSPETGAGIGAGGESSDKACLDASMLLTKLALAR 384 CGV RMCL AQ P + G + G +SDKAC DAS+LLTKLALAR Sbjct: 353 CGVVRMCLRAQKTPGASSGGDVADGESSAGVNSDKACADASILLTKLALAR 403 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46390 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54022 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14573 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3908 131 4e-33 >Contig3908 Length = 246 Score = 131 bits (329), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 71/186 (38%), Positives = 97/186 (52%) Query: 12 VHQALGGGSVADFLLWRRWCGAAVCLVSASSLWFLFERAGYXXXXXXXXXXXXXXXXXXX 71 VH GGG +AD LWR + L A+ +W LFE Y Sbjct: 52 VHHVFGGGKLADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFL 111 Query: 72 WAKSASILNRPLPPLPDMEISEESVVKAADVIRVWINYALSVARDIAVGRNVKLFLQVAF 131 W+ +N+ P +P+++I E+++++ I IN AL V RDIA G+++K FL V Sbjct: 112 WSNGLGFINKSPPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDIASGKDLKQFLSVIA 171 Query: 132 GLWVVSYIGSLFNFLTLVYIGVVLSLSVPVLYDKYQDHIDDKLRVTHRVVQTQYKKIDDK 191 GLWVVS +G NFLTL+YI +VL SVPV Y+KY ID ++ QY D K Sbjct: 172 GLWVVSILGKSCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKAMFEIKKQYAVFDAK 231 Query: 192 ILRKIP 197 +L KIP Sbjct: 232 VLSKIP 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26683 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv966263 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47838 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9548 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4260 90 3e-21 >Contig4260 Length = 247 Score = 89.7 bits (221), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 41/54 (75%), Positives = 49/54 (90%) Query: 37 QLYFGLLVFVGYMVVDAQDIIEKAHLGDRDYVKHSLLLFTDFAAVFVRILIIMV 90 +LYFGL++FVGYMVVD Q++IE+AH GD DYVKH+L LFTDF AVFVRILIIM+ Sbjct: 180 ELYFGLMIFVGYMVVDTQEMIERAHHGDLDYVKHALTLFTDFIAVFVRILIIML 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51475 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1146 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3066260 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33091 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17978 (673 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57824 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36934 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8066264 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17705 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3610 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35614 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51521 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24500 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16664 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35865 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31250 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39436 (356 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21069 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv345 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39452 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36906 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 224 2e-61 >Contig3037 Length = 313 Score = 224 bits (572), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 97/125 (77%), Positives = 115/125 (92%) Query: 2 RKPCCDKQDTNKGAWSKQEDQKLIDYIRKNGEGCWRTLPQAAGLLRCGKSCRLRWINYLR 61 R PCC+K TNKGAW+K+EDQ+LIDYIR +GEGCWR+LP+ AGLLRCGKSCRLRWINYLR Sbjct: 3 RSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLR 62 Query: 62 PDLKRGNFAEDEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLRRKLINMGID 121 PDLKRGNF E+E++LIIKLH+LLGN+WSLIAGRLPGRTDNE+KNYWN+H++RKL+ G+D Sbjct: 63 PDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRGLD 122 Query: 122 PNNHR 126 P HR Sbjct: 123 PQTHR 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39143 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2866 (318 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 117 6e-29 >Contig4694 Length = 351 Score = 117 bits (294), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 81/284 (28%), Positives = 141/284 (49%), Gaps = 26/284 (9%) Query: 24 IKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKCMEQRFKELVAAKALEGV-QTE-I 81 I +AC+NWGFF+++NHG+ E + VE + + + +E++ K K + G TE Sbjct: 53 IGNACKNWGFFQVINHGVPLEMREKVETTARKFFAQPLEEKRKIRRDEKCVVGYYDTEHT 112 Query: 82 KDM-DWESTF-FLRH----LPVSNVSD----------FPDLDEEYRKVMKDFAXXXXXXX 125 K++ DW+ + FL +P S D +P+ E R+VM+D++ Sbjct: 113 KNVRDWKEVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREVMEDYSQEVEKLS 172 Query: 126 XXXXXXXXXXXXXXXGYLKKAFHGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGIIL 185 K F K ++++YPPCP P+L G+ H D G + + Sbjct: 173 LKLMGLIALSLGLPEDRFKGYF---KDQTSFIRLNHYPPCPSPELALGVGRHKDGGALTV 229 Query: 186 LFQDDTVSGLQLLK--DGQWVDVPPMRHSIVVNLGDQLEVITNGKYKSVLHRVVAQTDGN 243 L QD+ V GL++ + DG+W+ V P ++ ++N+GD ++V +N +Y+SV HRV+ ++ Sbjct: 230 LAQDE-VGGLEVKRKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHRVMVNSEKE 288 Query: 244 RMSIASFYNPGNDAVIYPAPALLEKEAENDQVYPKFVFDDYMKL 287 R S+ F NP + + P L K +N Y + + ++ L Sbjct: 289 RFSVLFFLNPAHYTEVKPLEELTNK--QNPAKYTPYSWGKFLTL 330 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21962 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666258 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4613 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4074 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13570 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8475 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4344 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48246 (109 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6654 (311 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52540 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89551566 359 e-102 >89551566 Length = 208 Score = 359 bits (921), Expect = e-102, Method: Compositional matrix adjust. Identities = 169/171 (98%), Positives = 169/171 (98%) Query: 24 TGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY 83 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY Sbjct: 8 AGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY 67 Query: 84 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 143 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR Sbjct: 68 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 127 Query: 144 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFVESPALAPPEVQIDM 194 KKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQIDM Sbjct: 128 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDM 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13242 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 151 2e-39 >Contig1666 Length = 421 Score = 151 bits (382), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 77/161 (47%), Positives = 103/161 (63%), Gaps = 14/161 (8%) Query: 19 FRFYPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKASFG--EQEWYFFSP 76 FRF+PTDEELV +YLK+K + I+ VD+YK +PW+LP K+ + EWYFFS Sbjct: 13 FRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLKSRDTEWYFFSL 72 Query: 77 RDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWI 136 DRKY N +R NRA GYWK TG D+PV S ++ VG+KK LVF+ G+ PKG +TNW+ Sbjct: 73 LDRKYGNSSRTNRATEKGYWKTTGKDRPVCHS--SRAVGMKKTLVFHSGRAPKGARTNWV 130 Query: 137 MHEYRLADNKVNTKPPGCDMGNKKNSLRLDDWVLCRIYXKN 177 MHEYRL + ++ K + D +VLCRI+ K+ Sbjct: 131 MHEYRLDNQEL----------EKAGIVEKDAYVLCRIFQKS 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53586 (298 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16598 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60416 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28799 (443 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22451 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61348 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43883 (313 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5881 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19291 (79 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25162 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27770 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25266258 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30774 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38247 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49187 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61685 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19425 (280 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27366265 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27702 (449 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1900 804 0.0 >Contig1900 Length = 451 Score = 804 bits (2077), Expect = 0.0, Method: Compositional matrix adjust. Identities = 381/430 (88%), Positives = 393/430 (91%) Query: 1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGK 60 MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD TVG G DAFNTFFSETGAGK Sbjct: 1 MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK 60 Query: 61 HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120 HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD Sbjct: 61 HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 120 Query: 121 RVRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTIYPSPQVSTA 180 R+RKLADNCTGLQGFLVFNAV VDYGKKSKLGFT+YPSPQVST+ Sbjct: 121 RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS 180 Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXXXXXX 240 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA 240 Query: 241 XXRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300 RFDGA+NVD+TEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSS Sbjct: 241 SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS 300 Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP 360 Query: 361 TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420 TVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE Sbjct: 361 TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420 Query: 421 AREDLAALEK 430 AREDLAALEK Sbjct: 421 AREDLAALEK 430 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57944 (398 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31386 (341 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8066257 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2876 325 1e-91 >Contig2876 Length = 258 Score = 325 bits (834), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 164/254 (64%), Positives = 194/254 (76%), Gaps = 2/254 (0%) Query: 8 REENVYMAKLAEQAERYEEMVEFMXXXXXXXXXXXXXXXXRNLLSVAYKNVIGARRASWR 67 R+ VY AKLAEQAERY+EMVE M RNLLSV YKNVIGARRASWR Sbjct: 4 RDNYVYTAKLAEQAERYDEMVEAMTKVAKLDVELTIEE--RNLLSVGYKNVIGARRASWR 61 Query: 68 IISSIEQKEESRGNEDHVAIIKDYRATIEAELSKICDGILSLLESHLIPSAVIAESKVFY 127 I+SSIEQKEE +GN+ +V+ IK+YR +EAELS IC I+ +++ HL+PS ES VF+ Sbjct: 62 ILSSIEQKEEGKGNDINVSRIKEYRNKVEAELSSICSDIMRVIDEHLLPSCSGFESTVFF 121 Query: 128 LKMKGDYHRYLAEFKTGPGRKEAAESTLLAYKSAQDIALAELAPTHPIRLGLALNFSVFY 187 KMKGDY+RYLAEFKTG RKE A+ ++ AY++A A +L PTHPIRLGLALNFSVFY Sbjct: 122 YKMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFY 181 Query: 188 YEILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGD 247 YEILNSP+RAC+LAKQAFDEAISELDTL EESYKDSTLIMQLLRDNLTLWTSDI +D + Sbjct: 182 YEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGVE 241 Query: 248 DIKEASKRESGEGQ 261 + ++A G+ Sbjct: 242 EGQKADSSAKAGGE 255 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24047 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14066262 (475 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12480 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2709 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89551566 362 e-102 >89551566 Length = 208 Score = 362 bits (928), Expect = e-102, Method: Compositional matrix adjust. Identities = 178/198 (89%), Positives = 180/198 (90%) Query: 24 TGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY 83 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY Sbjct: 8 AGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY 67 Query: 84 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 143 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR Sbjct: 68 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 127 Query: 144 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVHIDXXXXXXXXXX 203 KKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEV ID Sbjct: 128 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDMATQLQHEAE 187 Query: 204 XXXXXSQPLPDDDDDAFE 221 +QPLPDDDDDAF+ Sbjct: 188 LNAAAAQPLPDDDDDAFD 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2810 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34343 (364 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20639 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27166265 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59577 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18266257 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4492 363 e-103 >Contig4492 Length = 495 Score = 363 bits (931), Expect = e-103, Method: Compositional matrix adjust. Identities = 182/219 (83%), Positives = 194/219 (88%) Query: 1 MHGGGPEVVAGKPLDRAYLTENVALVEAGCVNLARHISNTRAYGVNVVVAVNMFSTDSEA 60 MHGGGP+VVAGKPL+ AY TENVALVEAGCVNLARHI+NT+AYGVNVVVAVN FSTDS+A Sbjct: 273 MHGGGPDVVAGKPLNSAYTTENVALVEAGCVNLARHITNTKAYGVNVVVAVNKFSTDSDA 332 Query: 61 ELNAVKNAALFAGAYDAVVCTHHAHGGRGAVDLGIAVQRACETVAQPLKFLYPLDXXXXX 120 ELNAV+NAAL AGAYDAV+CTHHAHGG+GAVDLGIAVQ+ACE V QPLKFLYPLD Sbjct: 333 ELNAVRNAALAAGAYDAVICTHHAHGGKGAVDLGIAVQKACENVTQPLKFLYPLDFSIKE 392 Query: 121 XXXXXXXXYGASGVEYSEQAEKQIEMYSRQGFSNLPICMAKTQYSFSHTASVKGAPTGFV 180 YGASGVEYSEQAEKQI MYSRQGFS LPICMAKTQYSFS A+ KGAP+ FV Sbjct: 393 KIEAIARSYGASGVEYSEQAEKQIVMYSRQGFSGLPICMAKTQYSFSDKATEKGAPSNFV 452 Query: 181 LPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYEIDL 219 LPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFY+IDL Sbjct: 453 LPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDL 491 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3156 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3413 185 1e-49 >Contig3413 Length = 153 Score = 185 bits (469), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 81/148 (54%), Positives = 110/148 (74%), Gaps = 1/148 (0%) Query: 2 STPARKRLMRDFKRLQQDPPAGISGAP-HDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 S+ A+ RLM D K + +PP G S +P D+N+ +W+A IFGPD+TPW+GG F L L F+ Sbjct: 3 SSSAQLRLMSDLKTIINEPPEGCSASPMSDDNLFVWSATIFGPDETPWEGGVFSLRLTFS 62 Query: 61 EEYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS 120 E YP KPP VRF S MFHPN+Y DG++C+DI+Q+ WSP ++V+ ILTS+QSLL DPNP+S Sbjct: 63 ERYPEKPPRVRFTSEMFHPNVYHDGALCMDIIQDAWSPCHNVSTILTSVQSLLTDPNPSS 122 Query: 121 PANSEAARMFSENKREYNRRVREIVEQS 148 PAN EAA+++ + + YN+RVR S Sbjct: 123 PANPEAAQLYQHDIKAYNKRVRRCARNS 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24641 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19385 (57 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32731 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv464 (382 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59553 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9025 (428 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66022 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3516 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61830 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30486 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27563 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25025 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55974 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4766 110 4e-27 >Contig4766 Length = 180 Score = 110 bits (274), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 52/109 (47%), Positives = 69/109 (63%), Gaps = 2/109 (1%) Query: 12 TIDVHAAKDLINSGYRYLDVRTVEEFKKGHADVENILNIPYLFTTPEGRVKNPEFLEQVQ 71 ++ V A +L+ +G+ YLDVRT EEF GH +NIPYL+ G KNPEF+++V Sbjct: 70 SVPVRVAHELLLAGHHYLDVRTPEEFSAGHPS--GAVNIPYLYRVGSGMSKNPEFVKEVS 127 Query: 72 FACSKEDHLIVGCQSGVRSLAATSVLVSAGFKDVKDIGGGYLAWVQNGL 120 K D +IVGCQ G RS+ A + LV+AGF + D+ GGY W QNGL Sbjct: 128 SHFRKHDEIIVGCQLGKRSMMAATDLVAAGFTGITDMAGGYATWTQNGL 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48158 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30821 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40027 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21575 (337 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1279 225 2e-61 >Contig1279 Length = 257 Score = 225 bits (574), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 103/126 (81%), Positives = 109/126 (86%) Query: 51 MYQRPDMVTPGVDPQGQPLDPRKIQXXXXXXXXXXXXXXSKYGEIESLNICDNLADHMVG 110 MYQRPDM+TPGVD QGQP+DPRK+Q SKYGEIESLN+CDNLADHMVG Sbjct: 1 MYQRPDMITPGVDAQGQPIDPRKMQSHFEEFYEDLFQELSKYGEIESLNVCDNLADHMVG 60 Query: 111 NVYVQFREEEHAANALRNLNGRFYAGRPIIVDFSPVTDFREATCRQYEENICNRGGYCNF 170 NVYVQFREEEHAANAL+NL GRFYAGRPIIVDFSPVTDFREATCRQYEEN CNRGGYCNF Sbjct: 61 NVYVQFREEEHAANALKNLTGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNF 120 Query: 171 MHLKKI 176 MHLK+I Sbjct: 121 MHLKRI 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27480 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77982401 91 2e-21 >77982401 Length = 185 Score = 90.5 bits (223), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 40/89 (44%), Positives = 61/89 (68%) Query: 1 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY 60 MVGLD +GKTTI+ ++ + PT+GFN++T+ Y+ + +WDVGGQ IR WR+Y Sbjct: 21 MVGLDNSGKTTIVLRINGEDTSVVSPTLGFNIKTLTYQKYTLNIWDVGGQKTIRSYWRNY 80 Query: 61 FQNTQGLIFVVDSNDRDRVVEARDELHKI 89 F+ T GL++VVDS+D R+ + + EL + Sbjct: 81 FEQTDGLVWVVDSSDLRRLDDCKMELDNL 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8676 (391 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158358365 183 1e-48 >158358365 Length = 266 Score = 183 bits (464), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 99/260 (38%), Positives = 137/260 (52%), Gaps = 3/260 (1%) Query: 15 LDQTPTWAVAGICAVMIIISIVLEKVLHRVGKWFTERRKRALFEALEKVKAELMVLGFIS 74 L+ TPTW VAG+C V++++S+ +E+ LH++GK R+ AL+EAL+K+K ELM+LGFIS Sbjct: 10 LEYTPTWVVAGVCFVIVLLSLCVERGLHKLGKCLQHERQDALYEALQKLKEELMLLGFIS 69 Query: 75 LLLTFGQNFIVKICIPEKAADTMLPCPYNGEKDXXXXXXXXXXLLWYNHRLLAAATYSSS 134 LLLT Q I +ICIP A MLPC + RLL+ AT Sbjct: 70 LLLTVSQRSISRICIPAHVATHMLPCKRETAEHNTPAHYFLNQATNNGRRLLSEATSDHC 129 Query: 135 CKEGYEPIISVNGLHQLHILIFFLAVFHVLYSAITMMLGRLKIRGWKQWEEETSTHDYEF 194 +G P++S+ GLH LHI IF LAV HV++ TM+LG +IR WK+WE+ + Sbjct: 130 QLKGKVPLLSLEGLHHLHIFIFVLAVVHVIFCVSTMVLGGARIRQWKRWEDSIQK---DR 186 Query: 195 SNDAARFRLTHETSFVRAHTSFWTRIPFFFYVGCXXXXXXXXXXXXDYLTLRNGFITVHL 254 + A H +W R ++ DY+ LR GFI H Sbjct: 187 RSGVAHVSHHHHEFLKERADGYWRRAAIIGWMIAFCKQFYGSVTKSDYIALRQGFIKEHC 246 Query: 255 APGSKFNFQKYIKRSLEDDF 274 F+F KY+ R+LE DF Sbjct: 247 PGNPNFDFHKYMMRTLEIDF 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56231 (362 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25966261 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37379 (504 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4717 229 2e-62 >Contig4717 Length = 244 Score = 229 bits (585), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 112/206 (54%), Positives = 138/206 (66%), Gaps = 2/206 (0%) Query: 77 KEKDRIDMLPGQPHVGFSQYGGYVTIDESKGKALYYYFAEAXXXXXXXXXXXWLNGGPGC 136 ++ DR+ LPGQP V F QY GYVT++E+ G+AL+Y+F EA WLNGGPGC Sbjct: 36 QKADRVIGLPGQPPVKFDQYAGYVTVNETHGRALFYWFFEAVKTPQDKPLVLWLNGGPGC 95 Query: 137 SSLAYGAMQELGPFRVHSEGK-TLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDYRNG 195 SS+ YGA +ELGPF K L N Y WN AN+LFLESP GVGFSY+NTT D Sbjct: 96 SSIGYGASEELGPFFPQKGAKPKLKYNPYTWNNAANLLFLESPVGVGFSYTNTTKDISQL 155 Query: 196 GDRKTAKDNYAFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKADGPI-I 254 GD TA+D++ FL+NW +RFP+YK DFYI+GESY GHYVPQL+ + NK A I Sbjct: 156 GDTITAEDSHKFLINWFKRFPQYKSHDFYITGESYGGHYVPQLSELVYDRNKNASKETYI 215 Query: 255 NLKGIIIGNAVINDETDELGMYQYFG 280 N KG +IGNA I+DETD+ G+ G Sbjct: 216 NFKGFMIGNAAIDDETDQKGLIDMLG 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55708 (453 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44608 (373 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23856 (418 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30318 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv161 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58658 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23575 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3840 266 6e-74 >Contig3840 Length = 186 Score = 266 bits (681), Expect = 6e-74, Method: Compositional matrix adjust. Identities = 131/182 (71%), Positives = 146/182 (80%), Gaps = 2/182 (1%) Query: 1 MRTLCDACESAAAILFCAADEAALCRACDEKVHMCNKLASRHVRVGLADPSDVPRCDICE 60 MRTLCDACESAAAI+FCAADEAALCRACDEKVH+CNKLASRHVRVGLA PS VPRCDICE Sbjct: 1 MRTLCDACESAAAIVFCAADEAALCRACDEKVHLCNKLASRHVRVGLATPSAVPRCDICE 60 Query: 61 NAPAFFYCEVDGTSLCLQCDMIVHVGGKRTHGRYLLLRQRVEFPGDKPGRLEELRLQSG- 119 NAPAFFYCE+DG+SLCLQCDM+VHVGGKRTHGRYL+LRQRV+FPGDKP E Sbjct: 61 NAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHGRYLVLRQRVQFPGDKPSSNGEDPASQPP 120 Query: 120 -EPGEARREQNWPPMMTLRETQPNHMASSVPMLENNTHGDGKMDNKLIDLNARPQRVHGQ 178 + GE RR Q+ P MT+ + NH AS V + + N G KMDNKLIDLN +P R+HGQ Sbjct: 121 IDQGETRRVQHQQPRMTIGDNHQNHRASPVRLADANDDGHVKMDNKLIDLNMKPNRMHGQ 180 Query: 179 TS 180 S Sbjct: 181 AS 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35193 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8116 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8566262 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49777 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21507 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1891 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3623 (481 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4717 219 3e-59 >Contig4717 Length = 244 Score = 219 bits (557), Expect = 3e-59, Method: Compositional matrix adjust. Identities = 110/202 (54%), Positives = 130/202 (64%), Gaps = 8/202 (3%) Query: 73 GLPGQPSGVLFKQYAGYVTVNELKGRNLFYYFAEAAEDPSSKPLLLWLNGGPGCSSLGVG 132 GLPGQP V F QYAGYVTVNE GR LFY+F EA + P KPL+LWLNGGPGCSS+G G Sbjct: 43 GLPGQPP-VKFDQYAGYVTVNETHGRALFYWFFEAVKTPQDKPLVLWLNGGPGCSSIGYG 101 Query: 133 AMVEIGPF----GVKPDGKTLYLRPYAWNKVANTLFLESPVGVXXXXXXXXXXXXXXXDK 188 A E+GPF G KP L PY WN AN LFLESPVGV D Sbjct: 102 ASEELGPFFPQKGAKPK---LKYNPYTWNNAANLLFLESPVGVGFSYTNTTKDISQLGDT 158 Query: 189 RTAQDTYAFLINWFRRFPHYKNRDFYIMGESYAGFYIPELADTIIRRNMKADSSSIIHLK 248 TA+D++ FLINWF+RFP YK+ DFYI GESY G Y+P+L++ + RN A + I+ K Sbjct: 159 ITAEDSHKFLINWFKRFPQYKSHDFYITGESYGGHYVPQLSELVYDRNKNASKETYINFK 218 Query: 249 GIMIGNGIMNDMTDNRGFYDYL 270 G MIGN ++D TD +G D L Sbjct: 219 GFMIGNAAIDDETDQKGLIDML 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6066265 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30299 (117 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56365 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1787 (583 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30250 (404 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3406 491 e-141 >Contig3406 Length = 450 Score = 491 bits (1263), Expect = e-141, Method: Compositional matrix adjust. Identities = 256/387 (66%), Positives = 290/387 (74%), Gaps = 6/387 (1%) Query: 21 AEFSGLRNSSACLSFNRKTSD-DFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR 79 AEFSGLR SS+CL++ + VA Q + S S KG T AKLKVAINGFGR Sbjct: 36 AEFSGLR-SSSCLTYASNGREASLFDAVAAQLTPQTSGSAPV-KGETVAKLKVAINGFGR 93 Query: 80 IGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDG 139 IGRNFLRCWHGRKDSPL+VIVVND+GGVK ASHLLKYDS+LGTF+AD+K V ++ ISVDG Sbjct: 94 IGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKADIKIVDNETISVDG 153 Query: 140 KVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIP 198 K IK+VS+R+PL LPW ++ ID+VIEGTGVFVD GAGKHIQAGAKKV+ITAP KG DIP Sbjct: 154 KPIKVVSNRDPLKLPWAEMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP 213 Query: 199 TYVVGVNADEYNHD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXX 257 TYVVGVN +Y H I+SNASCTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQ Sbjct: 214 TYVVGVNEKDYGHSVADIVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLL 273 Query: 258 XXXXXXXXXXXXXXXNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNXXXXXXXXXX 317 NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPN Sbjct: 274 DASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINV 333 Query: 318 SKKTF-AEEVNAGFRDSAEKELQGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXXGDDMV 376 +KK AE+VN FR +A+ L+GIL+VCD PLVSVDFRC GDDMV Sbjct: 334 AKKGITAEDVNGAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMV 393 Query: 377 KVIAWYDNEWGYSQRVVDLADIVANKW 403 KV+AWYDNEWGYSQRVVDLA +VA+KW Sbjct: 394 KVVAWYDNEWGYSQRVVDLAHLVASKW 420 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43574 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2868 (513 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3579 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36782 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18425 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 82 2e-18 >158372667 Length = 230 Score = 81.6 bits (200), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 50/99 (50%), Positives = 66/99 (66%), Gaps = 6/99 (6%) Query: 1 MPKIAFGRFDDSFSLASFKAYLAEFHSTILFVFAGVGSVMAYNKLTSDAALDPAGLVAVA 60 M KIAFG ++ ++A + EF +T LF+FAGVGS MA +KL +D + L +A Sbjct: 1 MAKIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKLGADTTV---ALFFIA 57 Query: 61 VAHGFALFVAVAISA-NISGGHVNPAVTFGLVVGGQITI 98 + H AL VAV ISA +ISGGH+NPAVT GL+ GG IT+ Sbjct: 58 ITH--ALVVAVMISAGHISGGHLNPAVTLGLLAGGHITL 94 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32211 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5147 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3566 112 8e-28 >Contig3566 Length = 175 Score = 112 bits (281), Expect = 8e-28, Method: Compositional matrix adjust. Identities = 62/165 (37%), Positives = 98/165 (59%), Gaps = 12/165 (7%) Query: 2 ETTERPVLVIGIDDSSHSFYALEWTLDHFFSSPQTKPFKLVIVYARPPASSVVGFAGP-- 59 E+ E+PV+V +D+S S YAL W +D+ S T L+I A+PP ++ + FA P Sbjct: 12 ESGEKPVMV-AVDESECSHYALMWVIDNLKESINTNS-PLLIFMAQPPPANNITFAAPLG 69 Query: 60 -------GLPDIIAHVDSDLKKAAARIVDKAKQMCNSKSVEDVTVSVMEGDARSIICDAV 112 P+ ++ + +K ++++AK +C S V TV+ + GDA++ IC AV Sbjct: 70 SARMYCPPTPEFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEI-GDAKTAICAAV 128 Query: 113 NIHHASILVVGSHGYGALKRAVLGSVSDYCAHHAHCTVMIVKKPK 157 H+ +LV+G G G +KRA+LGSVS+YC +A C V++VKKP+ Sbjct: 129 LKHNVKLLVLGERGLGKIKRAILGSVSNYCVLNAKCPVLVVKKPQ 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9940 (456 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47129 (614 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8620 (351 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14939 (456 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3617 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3886 149 2e-38 >Contig3886 Length = 243 Score = 149 bits (375), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 80/199 (40%), Positives = 125/199 (62%), Gaps = 3/199 (1%) Query: 26 VYFAPAPTFYRIYKRKSAEGFHSLPYIVALFSAMLWLYYAL--LKKDAFLLITINSFGCA 83 ++ +P TF RI K +S E F +PY++ L + +L +Y L + + L+ TIN G Sbjct: 20 LFLSPTITFKRIVKNRSTEQFSGIPYVMTLLNCLLSAWYGLPFVSPNNILVSTINGTGAV 79 Query: 84 IESFYILLYFFYAPMQAKKQTLKVVISLNVGVFSILVVLIQFLLKGSNRINVFGWICASF 143 IES Y+L++ +AP + K + L + + + VFSI+ ++ F L G++R G+ A F Sbjct: 80 IESVYVLIFIAFAPKKEKAKILGL-FTFVLAVFSIVALVSVFALHGNSRKLFCGFAAAIF 138 Query: 144 SVAVFAAPLSIVAKVIRTKSVEFMPFSLSFFLTLSAIMWFAYGLLKNDPCVAIPNILGFI 203 S+ ++ +PLSI+ V++TKSVEFMPF +S F+ L WF YGLL +DP VA+PN G Sbjct: 139 SIVMYGSPLSIMRTVVKTKSVEFMPFFMSLFVFLCGTSWFVYGLLGHDPFVAVPNGFGCA 198 Query: 204 LGLVQMVLYGFYRNAGKEK 222 LG +Q++LY FYR+ K++ Sbjct: 199 LGALQLILYFFYRDIKKQQ 217 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7681 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35730 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17866264 (310 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2078 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7645 (492 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52045 (256 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16991 (380 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29350 (351 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52599 (379 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19263 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3316 (531 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21685 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19366264 (356 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4460 548 e-158 >Contig4460 Length = 431 Score = 548 bits (1413), Expect = e-158, Method: Compositional matrix adjust. Identities = 259/341 (75%), Positives = 293/341 (85%) Query: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPHKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 T+KIIAEYIWIGGSG+D+RSK+RT+S PV P +LPKWNYDGSSTGQAPG+DSEVILYPQ Sbjct: 75 TDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGDDSEVILYPQ 134 Query: 76 AIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHNAAKIFSHPEVLAEETWYGIEQEYTLL 135 AIFKDPFR GNNILV+CD+YTP GEPIPTNKRH AA++FS+ +V+ E WYGIEQEYTLL Sbjct: 135 AIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAQVFSNQKVIDEVPWYGIEQEYTLL 194 Query: 136 QNSVKWPIXXXXXXXXXXXXXXXXXXXADKAFGRDIVDSHYKACLYAGINISGINGEVMP 195 Q+SVKWP+ ADK+FGRDI D+HYKACLYAGINISG NGEVMP Sbjct: 195 QSSVKWPLGWPVGGYPGPQGPYYCGAGADKSFGRDISDAHYKACLYAGINISGTNGEVMP 254 Query: 196 GQWEFQVGPAVGISAGDELWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYSTK 255 GQWE+QVGP+VGI AGD +W +RYILERITE AGVV+S DPKPI+GDWNGAG HTNYSTK Sbjct: 255 GQWEYQVGPSVGIEAGDHIWASRYILERITEQAGVVLSLDPKPIEGDWNGAGCHTNYSTK 314 Query: 256 SMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGASI 315 SMR +GG+E+IKKAI L LRHKEHI+AYGEGNERRLTG HET +IN F WGVANRGASI Sbjct: 315 SMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGLHETQNINKFSWGVANRGASI 374 Query: 316 RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAESTILWKP 356 RVGRDTEKEGKGY EDRRPASNMDPY VT+++AE+TILW+P Sbjct: 375 RVGRDTEKEGKGYLEDRRPASNMDPYTVTALLAETTILWEP 415 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32155 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44223 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6766262 (451 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv351 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89557288 60 9e-12 >89557288 Length = 216 Score = 60.5 bits (145), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 37/124 (29%), Positives = 69/124 (55%), Gaps = 2/124 (1%) Query: 4 EKASSDVPAVEKKRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFK-SQLQQS 62 E+ ++ +++ + ++DF + +GRG FG V + REK + + A+K L K L++ Sbjct: 94 EQKETEYMHLQRHKMGVDDFQLLTIIGRGAFGEVRICREKSTGQVYAMKKLKKLEMLRRG 153 Query: 63 QVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERR 122 QVEH ++ E + + + I++LY F D++ +YLI+EY G++ L + +E Sbjct: 154 QVEH-VKAERNLLAEVDSAYIVKLYCSFQDEEFLYLIMEYLPGGDMMTLLMRKDILTEDE 212 Query: 123 AATY 126 A Y Sbjct: 213 ARFY 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2430 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3834 324 3e-91 >Contig3834 Length = 273 Score = 324 bits (831), Expect = 3e-91, Method: Compositional matrix adjust. Identities = 160/221 (72%), Positives = 178/221 (80%) Query: 44 AIGRSGFVVLASKGANNRPLTGXXXXXXXXXXXXXXXXXTVPQESLSRHKYTNDCESAIN 103 ++ S V ASK +N+RPLTG T+PQ SL+R KY+ D E+A+N Sbjct: 53 SLRSSPAVCAASKSSNSRPLTGVLFEPFEEVKKELDLVPTLPQVSLARQKYSEDSEAAVN 112 Query: 104 EQINVEYNVSYAYHAMYAYFDRDNVALKGLANFFKESSLEEREHAEKLMEYQNKRGGKVK 163 EQINVEYNVSY YHAMYAYFDRDNVAL+GLA FFKESS EER HAEKLMEYQNKRGG+VK Sbjct: 113 EQINVEYNVSYVYHAMYAYFDRDNVALRGLAKFFKESSEEERGHAEKLMEYQNKRGGRVK 172 Query: 164 LQSILMPHSEFDHPEKGDALHAMELALSLEKLTNEKLLHLHSIADRSNDPQLADFIESEF 223 LQSILMP SEFDH EKGDAL+AMELALSLEKLTNEKLL+L +AD++ D QL DF+ESEF Sbjct: 173 LQSILMPVSEFDHAEKGDALYAMELALSLEKLTNEKLLNLQHVADKNKDVQLTDFVESEF 232 Query: 224 LIEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLNGGVVA 264 L EQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLL+ V A Sbjct: 233 LAEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHDEVAA 273 Database: strawberry.as.orf Posted date: Mar 27, 2017 5:37 AM Number of letters in database: 104,044 Number of sequences in database: 444 Lambda K H 0.323 0.131 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 444 Number of Hits to DB: 72,629,807 Number of extensions: 3040353 Number of successful extensions: 9211 Number of sequences better than 1.0e-10: 452 Number of HSP's gapped: 8707 Number of HSP's successfully gapped: 531 Length of database: 104,044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 130 (54.7 bits)