BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36536 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17782 104 5e-25 >Cs17782 Length = 216 Score = 104 bits (259), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 55/129 (42%), Positives = 82/129 (63%), Gaps = 11/129 (8%) Query: 5 GGSAGSCYYSVLGIRRDASSSDIRTAYRKLALKWHPDRWAK--NQALAGEAKRRFQQIQE 62 G S +Y+VLG+ ++ +++++R AY+KLAL+WHPDR + N EAK++FQ IQ Sbjct: 4 GEEKSSNFYAVLGLNKECTATELRNAYKKLALRWHPDRCSASGNAKFVDEAKKKFQTIQH 63 Query: 63 AYSVLSDASKKSMYDAGFY--DPMEEDQDFCDFMQEMVSMM-----NNVGDEPDSVEDLQ 115 AYSVLSDA+K+ +YD G Y D ++ DF+ EM +MM N G+E + E+LQ Sbjct: 64 AYSVLSDANKRLLYDVGVYDSDDDGDNNGMGDFLNEMAAMMSQTQTNENGEE--TFEELQ 121 Query: 116 KMFVDMVSG 124 +F +M G Sbjct: 122 NLFEEMFQG 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41993 (429 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27855 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34062 (303 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69121 189 3e-50 >Cs69121 Length = 366 Score = 189 bits (481), Expect = 3e-50, Method: Compositional matrix adjust. Identities = 99/271 (36%), Positives = 151/271 (55%), Gaps = 4/271 (1%) Query: 34 STTVGDVVLKGVNYASGGGGILNYTGKIFGGRINLDAQLDNFANTRQDIISRIG-APAAL 92 S G +L+GVNYAS GI TG+ G RI+ Q+ N+ NT Q +++ +G A Sbjct: 97 SAARGQDILRGVNYASAAAGIREETGRQLGDRISFSGQVKNYQNTVQQVVNLLGNQDQAA 156 Query: 93 KLFQRSLFSVTIGSNDFINNYLTPILSAAEQKLVSPQTFVGTMISRFRLQLTRLYSLGAR 152 R ++S+ +GSND++NNY P+ + ++ +P+ + +I ++ QL LY+ GAR Sbjct: 157 NYLSRCIYSIGLGSNDYLNNYFQPLYYSTGRQY-TPEQYADLLIQQYTQQLQALYNYGAR 215 Query: 153 RIIVANVGPIGCIPYQRDTTPGVGDDCASLPNQMAQLFNTRLKSLVAELSTSLEGSKFVY 212 + ++ VG IGC P Q G C N +FN +L+ LV + + + +KF+Y Sbjct: 216 KFVLIGVGQIGCSPNQLAQNSPDGRTCVKRVNDANVIFNNKLRGLVDQFNNNDSDAKFIY 275 Query: 213 ADVYNIVDDIIQNYESFGFENANSSCCYIAGRFGGLIPCGPPSKVCSDRSKYVFWDPYHP 272 + Y I DI N +GF N+ CC + GR G I C P C +R +YVFWD +HP Sbjct: 276 INAYGIFQDITANPARYGFRVTNTGCCGV-GRNNGQITCLPLQNPCPNRREYVFWDAFHP 334 Query: 273 SDAANEIMATRLLGGDS-DDIWPMNIRQLIQ 302 ++AAN I+ATR S D +P++IR+L Q Sbjct: 335 TEAANTIIATRSYSAQSPSDAYPIDIRRLAQ 365 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6871 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12666265 (1221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41067 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46148 304 3e-85 >Cs46148 Length = 148 Score = 304 bits (778), Expect = 3e-85, Method: Compositional matrix adjust. Identities = 145/148 (97%), Positives = 147/148 (99%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRAKYETTARSWTQKYAMG 148 PEIAHMYK+D+AKYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKSDKAKYEATARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30371 (362 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23723 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs72108 275 3e-76 >Cs72108 Length = 189 Score = 275 bits (703), Expect = 3e-76, Method: Compositional matrix adjust. Identities = 126/178 (70%), Positives = 157/178 (88%), Gaps = 1/178 (0%) Query: 1 MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKP 60 M+F GT KCK C+KTVY V+ LSADG YHK+CFKCSHCKGTL +SNYSSM+GVLYCKP Sbjct: 1 MSFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFEQLFKESGNFSKNFQTSAKPADKLN-ELSRAPSKLSSMFSGTQDKCSACRKTVYPLEK 119 HFEQLFKESGNF+KNFQ+ AK A+KL EL+R+PSK +SMFSGTQ+KC++C KTVYPLEK Sbjct: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCASCSKTVYPLEK 120 Query: 120 VTLEGESYHKSCFKCAHGGCPLTHSSYAALNGVLYCKHHFSQLFMEKGNYSHVLEAAT 177 V +E ++YHK+CFKC+HGGC ++ S+YAAL G+LYCKHHFSQLF EKG+Y+H++++A+ Sbjct: 121 VAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSAS 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33773 (104 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26492 74 3e-16 >Cs26492 Length = 262 Score = 74.3 bits (181), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 33/92 (35%), Positives = 55/92 (59%) Query: 3 QDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFG 62 Q R R FR+G L+ TD+ RG+D+ V+++I+++ P SET++HR GR+GR G Sbjct: 100 QSQRERTLSAFRDGRFNILIATDVAARGLDVPNVDLIIHYELPNTSETFVHRTGRTGRAG 159 Query: 63 HLGLAVNLITYEDRFNLYRIEQELGTEIKQIP 94 G A+ + T + + IE+++G Q+P Sbjct: 160 KKGSAILIYTDQQARQVKSIERDVGCRFTQLP 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47924 (371 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11117 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13016 (651 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48719 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22278 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15561 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs173106183 116 3e-28 >Cs173106183 Length = 286 Score = 116 bits (290), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 67/163 (41%), Positives = 89/163 (54%), Gaps = 8/163 (4%) Query: 2 EWFFFCPRDRKYPNGSRTNRATRAGYWKATGKDRKVVACQSTVIGYRKTLVFYRGRAPLG 61 EW+FF PRDRKYPNG+R NRAT +GYWKATG D K + S +G +K LVFY+GR P G Sbjct: 64 EWYFFSPRDRKYPNGTRPNRATVSGYWKATGTD-KAIYGGSKYLGVKKALVFYKGRPPKG 122 Query: 62 DRTDWVMHEYRLCDDPSQGSGFQGA-----FALCRVVKKNDPTQKSS-DFHGEAKGKQVG 115 +TDW+MHEYRL D Q G+ + LCR+ KK +S D E V Sbjct: 123 IKTDWIMHEYRLNDPTRQPYKHNGSMKLDDWVLCRIYKKRQTGSRSVLDAKVEEDQSCVD 182 Query: 116 SSSSNGDFTSAAISNEILSISDNIPSQASHAY-NESNYSSPMA 157 G + A +++ + P S A+ E Y +P++ Sbjct: 183 QLGKTGGYVEHANASDEQKLMVKFPRTCSLAHLVELEYFAPIS 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55076 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42061 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7724 249 1e-68 >Cs7724 Length = 276 Score = 249 bits (636), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 117/168 (69%), Positives = 135/168 (80%) Query: 17 ASGNEVQQVTMKVLSAENDDHGGVIVEMKEAMDFEAFVSLLRASIAHWRQQGKRGVWIKM 76 AS N K L+ ND++GGV+V+M E MD + F SLL++SI+HWRQQ K+GVWIK+ Sbjct: 3 ASVNSSSATVNKFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQAKKGVWIKL 62 Query: 77 PIELVNLVEAAVKEGFWYHHAERKYLMLVYWIPEGPNTIPPNATHRVGVGAFVLNEKGEM 136 PIEL NLVE AVKEGFW+HHAE YLMLVYWIP G NT+P NA+HRVGVGAFV+N K E+ Sbjct: 63 PIELANLVEPAVKEGFWFHHAEPNYLMLVYWIPGGANTLPANASHRVGVGAFVMNGKREV 122 Query: 137 LVVQEKSGRFRGTGIWKFPTGVVDEGEDICDAAVREVKEETGTKPQVI 184 LVVQE SGRFRGTGIWKFPTGVVDEGEDIC AAVREVKEET + + Sbjct: 123 LVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFV 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18597 (309 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666260 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51183 (643 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20266261 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6911 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46936 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58456 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 186 9e-50 >Cs47542 Length = 355 Score = 186 bits (473), Expect = 9e-50, Method: Compositional matrix adjust. Identities = 88/170 (51%), Positives = 121/170 (71%), Gaps = 1/170 (0%) Query: 1 MAKNLKVDPGQLMNMFEKGRQQIRMNYYPPCVHASKVIGVTPHSDICGLTLLAQVNEVQG 60 M K L + +L FE G Q +RMNYYPPC KV+G+TPHSD LT+L Q+NEV+G Sbjct: 183 MGKVLNIKDEELREFFENGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEG 242 Query: 61 LQIKKNGKWIPIRPVPGAFIVNIGDILEIMSNGEYKSIEHRAVVNPETERLSIAAFHSPS 120 LQIK +GKWIPI P+P AFIVNIGD LEI++NG Y+SIEHRA+VN ERLSIA F++ Sbjct: 243 LQIKNDGKWIPITPLPNAFIVNIGDTLEIITNGTYRSIEHRAIVNSLQERLSIATFYTKR 302 Query: 121 VETIIGPLPELVKENG-AIYKSVSREEYYKFAFSRKLDGKSIISHMKLEN 169 ++ I P L+ E A+++ V+ EEY++ ++R+L GKS + ++++N Sbjct: 303 LDGEIYPASSLISEKTPALFRRVTVEEYFRNRYARELRGKSQLDDLRIQN 352 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25326 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47788 85 2e-19 >Cs47788 Length = 104 Score = 85.1 bits (209), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 44/76 (57%), Positives = 52/76 (68%), Gaps = 2/76 (2%) Query: 21 EGSEGFSLCNMSEDDLMTCKPAVSK--PSPVDPSPECCKALSGADLTCLCSYKNSETLPF 78 E S SLC MS+ L CKP V++ P+ PS +CCKAL+GADL CLC YK S L Sbjct: 21 ESSRALSLCKMSDAGLEACKPYVTQDAPNTAAPSAQCCKALAGADLQCLCGYKGSPMLKA 80 Query: 79 LGIDPDLAMALPSKCN 94 GIDPDLA+ALP+KCN Sbjct: 81 FGIDPDLALALPAKCN 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13566256 (272 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54613 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38743 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14266265 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33129 286 8e-80 >Cs33129 Length = 225 Score = 286 bits (733), Expect = 8e-80, Method: Compositional matrix adjust. Identities = 137/196 (69%), Positives = 168/196 (85%), Gaps = 1/196 (0%) Query: 1 MAEELKLFRTWSSVFALRIVWALKIKGVQYETIFEDLSNKSPSLLQYNPVHKKVPVLVHN 60 MAEE+KL +TWSS F LR W LK+KGVQ++ I EDLSNKSP LLQ NPV+KKVPVL+HN Sbjct: 1 MAEEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHN 60 Query: 61 GKPIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDNKVLTSIVWGVFFKERKE 120 GKPI+ESLVILEY+DETW++ PLLPEDPYERA ARFWAKFG++KVL SI W F K+ KE Sbjct: 61 GKPISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSI-WNAFIKQGKE 119 Query: 121 QEEAMLEAMEHLQFLEDELNGKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVDEDK 180 QEEA+ A+E L+FLE+EL GKRFFGGE+IG DLALGWLAN+I +FEEV G+K++++++ Sbjct: 120 QEEAIGLAIETLKFLEEELKGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKER 179 Query: 181 FPLLAAWMQEYADSPI 196 PLLAAWMQE A++P+ Sbjct: 180 VPLLAAWMQEVAEAPV 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57098 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38863 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48983 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4947 (441 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2422 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24203 (439 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11070 (295 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25906 125 7e-31 >Cs25906 Length = 242 Score = 125 bits (313), Expect = 7e-31, Method: Compositional matrix adjust. Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 5/98 (5%) Query: 36 SADGYASEGFV----PGSSSSRERKKGTPWTEEEHRMFLLGLQKLGKGDWRGISRNYVIS 91 +A GY S+G + + +ERKKG WTEEEHR FL+GL+KLGKGDWRGISR +V + Sbjct: 94 TAVGYLSDGLIMIPPTSNHQHQERKKGVAWTEEEHRKFLMGLEKLGKGDWRGISRKFVST 153 Query: 92 RTPTQVASHAQKYFIR-QTNVSRRKRRSSLFDIVADES 128 RTPTQVASHAQKYF+R ++++++KRRSSLFD++ S Sbjct: 154 RTPTQVASHAQKYFLRLASDLNKKKRRSSLFDMIGIRS 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15700 (307 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17598 108 8e-26 >Cs17598 Length = 108 Score = 108 bits (270), Expect = 8e-26, Method: Compositional matrix adjust. Identities = 53/109 (48%), Positives = 65/109 (59%), Gaps = 1/109 (0%) Query: 199 MQHRVHLDQSIELIGMXXXXXXXXXXXXXAVRPRGLPVVDDWECLKSMVVVFETRCGSLT 258 M HR+H+D SI+LIG VRP G P+VDDW CLKS+V FE+ CG+L+ Sbjct: 1 MSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFESHCGALS 60 Query: 259 QYGMKHMRAFANICNNGISLTAMEEACRTACSSHTILDQWSPTIRGYSA 307 QYGMKHMR+ ANICN GI M EA AC + W +G+SA Sbjct: 61 QYGMKHMRSLANICNTGIGKEKMAEASAQACEN-IPSGPWRSLDKGFSA 108 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17841 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44799 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59000 82 3e-18 >Cs59000 Length = 168 Score = 82.4 bits (202), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 37/42 (88%), Positives = 41/42 (97%) Query: 103 PRKPRVKLGDIMGILNKRAIEASEKERPVPDLRTGDIVEIKL 144 PRKPRVKLGDIMGILNKRA+EASE ERP+PD+RTGD+VEIKL Sbjct: 110 PRKPRVKLGDIMGILNKRAVEASESERPIPDIRTGDVVEIKL 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25307 (113 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40056 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6059 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38831 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3514 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57270 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs89949 79 5e-17 >Cs89949 Length = 240 Score = 79.0 bits (193), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 70/221 (31%), Positives = 100/221 (45%), Gaps = 22/221 (9%) Query: 31 SRATYYGSPDCLGTPTGACGFGEYGRSVNGGNVGAVSR-LYRNGTGCGACYQVRC-KVPN 88 + AT+YG D GT GACG+G G N A+S L+ NG CGAC+Q+ C P Sbjct: 27 AHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFQIMCANDPQ 86 Query: 89 LCADNGMKVVVTDH-GEGDYTD-----FILSPRGFSMLARPNMAADLFAYGVVGIEYRRV 142 C + V T+ G + D F LS F +A+ + G+V + YRRV Sbjct: 87 WCLRGSIIVTATNFCPPGGWCDPPNHHFDLSQPVFQHIAQ-------YRAGIVPVIYRRV 139 Query: 143 PCQYPGSNIFFKVHEHSRFPDYLAIVMLYQAGLSDITAVDIWQEDCQEWKGMRKSYGAVW 202 C+ G I F ++ HS F +++ G D+ AV I + W+ M +++G W Sbjct: 140 RCKRNGG-IRFTINGHSYFN---LVLITNVGGAGDVHAVSI-KGSRTRWQPMSRNWGQNW 194 Query: 203 DMANPPKGPVGLRFQVSGRGGQKWVQLMNVIPSDWKAGVAY 243 + G L F V+ G V NV P +W G Y Sbjct: 195 QSNSYLNGQ-SLSFVVTTSNGHSVVSY-NVAPPNWSFGQTY 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49087 (362 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54021 323 1e-90 >Cs54021 Length = 255 Score = 323 bits (829), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 159/254 (62%), Positives = 183/254 (72%) Query: 1 MAKSPEEEHPVKAFGWAARDHSGHLSPFNFSRRATGEEDVRFKVLYCGICHSDLHSIKNE 60 M ++PE+EHP AFGWAA+D SG LSPF+FSRRATGE+DV FKV +CGICHSDLH IKNE Sbjct: 1 MGQAPEQEHPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNE 60 Query: 61 WGNAAYPMVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCLVGACHSCESCSDDLENYCSKL 120 WGN YP+VPGHEIVGVVTEVGSKV KFKVGDKVGVGC+VG+CHSC+SC+ DLENYC K+ Sbjct: 61 WGNTIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCHSCDSCAIDLENYCPKV 120 Query: 121 ILTYNMPYHDGTRTYGGYSDTMVAPERYVVRIPDNMXXXXXXXXXXXXITVYSPLKYFGF 180 I+TY YHDGT TYGGYSD MVA E +VVRIP+ ITVYSPL+++G Sbjct: 121 IMTYANKYHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGL 180 Query: 181 TQPGMXXXXXXXXXXXXXXXXXXXXXXXXXTLISTSPSKKKEAIEHLGADSFLVSRDPEQ 240 +PGM PSKK EAIE LGA+ FLVSRD + Sbjct: 181 DKPGMHVGCXRLGRSRPCRPSIRKGYGGSGDCDQYPPSKKSEAIERLGAEFFLVSRDQNE 240 Query: 241 MQAAMGTMDGILDT 254 MQAA+GTMDGI+DT Sbjct: 241 MQAALGTMDGIIDT 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3108 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68684 240 8e-66 >Cs68684 Length = 213 Score = 240 bits (613), Expect = 8e-66, Method: Compositional matrix adjust. Identities = 116/161 (72%), Positives = 131/161 (81%) Query: 75 IFPGLLKLGHRAKSKPQDSEVNLAAEAFTSFKHLLLPVTDRNPYLSEGTRQXXXXXXXXX 134 +FP ++GH+AK K +SE+N AEAFT+FKHLLLP+TD+NPYLSEGTRQ Sbjct: 53 LFPRFRRIGHKAKVKSPESEINSVAEAFTNFKHLLLPITDQNPYLSEGTRQAAATTAALA 112 Query: 135 KKYGADITVVVIDEKQKESIPEHDTQLSSIRWHLSEGGFQEFRVLERLGEGSSKPTAIIG 194 KKYGADITVVVIDE+QKES+PEH+ +LSSIRWHLSEGGFQEFR+LERLGEGSSKPTAIIG Sbjct: 113 KKYGADITVVVIDERQKESLPEHENRLSSIRWHLSEGGFQEFRLLERLGEGSSKPTAIIG 172 Query: 195 EXXXXXXXXXXXXSMEAIHSKHVDANLLAEFIPCPVLLLPL 235 + SMEAIHSKHVDANLLAEFIPCPVLLLPL Sbjct: 173 DVADELNLDLVIISMEAIHSKHVDANLLAEFIPCPVLLLPL 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56909 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48703 (273 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28997 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52491 95 6e-22 >Cs52491 Length = 193 Score = 94.7 bits (234), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 64/194 (32%), Positives = 96/194 (49%), Gaps = 14/194 (7%) Query: 1 MGLWEAFLNWLRSL-FFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKV 59 M L + F L SL +++E ++ +GL NAGKT+L++++ + PT ++ Sbjct: 1 MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQ-PTQHPTSEEL 59 Query: 60 TKGNVTIKLWDLGGQPRFRTMWERYCRAVSAIVYVVDAADPDNIGISKSELHDLLSKPSL 119 + G + K +DLGG R +W+ Y V A+VY+VDA D + SK EL LLS +L Sbjct: 60 SIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEAL 119 Query: 120 NGIPLLVLGNKIDKPGALSKHALTEEMGLKSITD------------REVCCFMISCKNST 167 +P L+LGNKID P A S+ L +GL + T R + FM S Sbjct: 120 ANVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVNLMDSSVRPLEVFMCSIVRKM 179 Query: 168 NIDSVIDWLVKHSK 181 WL ++ K Sbjct: 180 GYGDGFKWLSQYIK 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14352 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11568 133 8e-34 >Cs11568 Length = 204 Score = 133 bits (334), Expect = 8e-34, Method: Compositional matrix adjust. Identities = 63/87 (72%), Positives = 67/87 (77%) Query: 11 VDYACTPEEVQQHFQSCGTVNRVTILTDKYGQPKGFAYXXXXXXXXXXXXXXXNESELHG 70 VDY+CTPEEVQQHFQSCGTVNRVTI TDK+GQPKG+AY NESELHG Sbjct: 83 VDYSCTPEEVQQHFQSCGTVNRVTIRTDKFGQPKGYAYVEFLQSEAVQEALHLNESELHG 142 Query: 71 RQLKVLAKRTNVPGMKQFRPRRFNPYM 97 RQLKV KRTNVPGMKQ RPRR NP+M Sbjct: 143 RQLKVTVKRTNVPGMKQHRPRRPNPFM 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41345 (44 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31026 (316 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 188 6e-50 >Cs66150 Length = 305 Score = 188 bits (478), Expect = 6e-50, Method: Compositional matrix adjust. Identities = 101/243 (41%), Positives = 138/243 (56%), Gaps = 4/243 (1%) Query: 23 LSSNYYDKTCPDVESTVTNAVRQAVMADKKVAAALLRMHFHDCFIRGCDASVLLNSVNKN 82 LS ++Y TCP+V +T+ + +++A +D ++ A+L+R+HFHDCF+ GCDAS+LL+S N Sbjct: 34 LSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLDSTNTI 93 Query: 83 TAEK-DGPANGSLHAFFVIDNAKKALEALCPGVVSCXXXXXXXXXXXXXXXGGPTWEVPK 141 +EK P N S F VIDN K A+E CP VVSC GGP+W VP Sbjct: 94 DSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSGGPSWAVPL 153 Query: 142 GRKDGRIS-RASETSQLPSPTFNISQLKQSFSQRGLSLD-DLVALSGGHTLGFSHCSSFQ 199 GR+D R + RA LP P + +LK SF GL+ DLVALSG HT G + C F+ Sbjct: 154 GRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFGRAQCQFFR 213 Query: 200 SRIRNFNATHDIDPTMHPSLAASLRSVCPKKNNVKNAGATMDPSPTTFDNTYYKLILQGR 259 R+ +FN T DPT+ + LR +CP+ N +P FDN Y+ L+GR Sbjct: 214 GRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKYFS-NLRGR 272 Query: 260 SLF 262 F Sbjct: 273 KAF 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1415 (55 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41190 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19558 (341 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24531 255 4e-70 >Cs24531 Length = 314 Score = 255 bits (652), Expect = 4e-70, Method: Compositional matrix adjust. Identities = 123/268 (45%), Positives = 162/268 (60%), Gaps = 3/268 (1%) Query: 32 ISFDQGYTHLFGEGNLVRSSDGRSVRLLLDRYTGSGFISANLYNHGFFSANIKLPSEYTA 91 +S DQG++ FG N+ R ++G L LD+ +GSG +S N Y HGFFSA IKLPS ++ Sbjct: 46 VSVDQGFSTFFGGSNVKRINNGSMATLALDKSSGSGLVSRNKYYHGFFSAAIKLPSGLSS 105 Query: 92 GVVVAFYTSNGDVFEKTHDELDFEFLGNVKGKPWRFQTNVYGNGSTSRGREERYRLWFDP 151 GVV+AFY SN D + HDE+D E LG+ K W QTN+Y NG S GREE++ WFDP Sbjct: 106 GVVLAFYLSNADSYPHNHDEIDIELLGHDKRNDWVLQTNIYANGGVSTGREEKFYFWFDP 165 Query: 152 SKEFHRYSILWTAKNIIFYVDEVPIREVIRNEAMGGDYPSKPMALYATIWDASNWATSGG 211 + + H YSI+W + +I+F VD VP+RE A YPSKPM++Y TIWD S WAT GG Sbjct: 166 TAQHHYYSIIWNSHHIVFLVDNVPVREFPNTGAFSSVYPSKPMSVYVTIWDGSQWATHGG 225 Query: 212 KYKVDYNYAPFVSEFSDFVLDGCPADPLQLASAAGCSDKDAELESNDYSAITPLRRISMR 271 KY V+Y YAPFV ++ + GC A A+ + L+ D T L + + Sbjct: 226 KYPVNYKYAPFVVSLAEMEMAGCVLSNSASAPASCSKGSASSLDPVDGQKFTTLSKQQVA 285 Query: 272 KF---RQKYMYYSYCYDTLRYATPLPEC 296 R+K M+YSYC DT R+ PEC Sbjct: 286 ALDWSRRKLMFYSYCKDTTRFKVMPPEC 313 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59307 (344 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57632 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56933 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29283 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56715 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17952 (330 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19419 (179 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36008 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58213 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14854 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59214 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 117 9e-29 >Cs30681 Length = 257 Score = 117 bits (293), Expect = 9e-29, Method: Compositional matrix adjust. Identities = 69/179 (38%), Positives = 96/179 (53%), Gaps = 12/179 (6%) Query: 2 RVQIALDAARGIEYIHEHTKTHYVHRDIKTSNILLDGAFRAKISDFGLAKLVGKTGEGEA 61 R++IA DAARG+ Y+HE + RD K+SNILLD + AK+SDFGLA+L G Sbjct: 23 RLKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHV 82 Query: 62 SATRVVGTFGYLAPEYLSDGLATTKSDVYAFGIVLFEIISGKEAVTRTEGMVMKNPERRS 121 S T VVGT GY APEY+ G T KSD+++FG+ L+E+I+G+ + R R Sbjct: 83 S-TAVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRN---------RPK 132 Query: 122 LASIMLAALRNSPNXXXXXXXKDCIDPNLMDLYPHDCLYKMAMLAKQCVDHDPILRPDM 180 +L +R P+ +DP L Y K+A +A +C+ RP M Sbjct: 133 SEQKLLEWVR--PHLTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKGRPKM 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27259 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25240 (605 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57878 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15372 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs40321 61 1e-11 >Cs40321 Length = 204 Score = 61.2 bits (147), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 45/155 (29%), Positives = 71/155 (45%), Gaps = 15/155 (9%) Query: 4 ERNSEIEDIHNAARSGDL----LKLQSICSSNPLAVNSRDKHSRTPLHLAAWAGQTQVVT 59 E + D+ AA+ GD+ L L ++ S V RD T LHL G V Sbjct: 33 ETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRD----TALHLTCLYGYLPCVQ 88 Query: 60 YLCKHKXXXXXXXXXXXXXIHFAAQKGHLEVVRTLLSSGASVKAITR-------KGMTPL 112 L + +H A G +E+V+ L++S + + + R +G TPL Sbjct: 89 LLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPL 148 Query: 113 HYAAQGSHLDLAKYLVRKGGSLSAKSKAGKTPLDL 147 H+AA+G H+D+ + L+ G S + + GKTP +L Sbjct: 149 HHAARGEHVDVIRLLLASGASPTKANLYGKTPSEL 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26411 (179 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12908 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40104 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs77012 128 3e-32 >Cs77012 Length = 108 Score = 128 bits (322), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 64/112 (57%), Positives = 75/112 (66%), Gaps = 7/112 (6%) Query: 42 MCKGMVIKRIQASISTE---KFIYLGDGSGDFCPSLKLGSGDYVMPRKNFPLWDLICRNP 98 MCKG+VI+RIQAS+S E K IYLGDGSGD+CPSLKL GD+VMPRKNFPLWDLI RNP Sbjct: 1 MCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNP 60 Query: 99 NLIKAEVHEWSDXXXXXXXXXXXIKKIXXXXXXXXXXXXXQLISVDCKFETM 150 LIKAE+HEW+D + I QL+S DCK +T+ Sbjct: 61 MLIKAEIHEWTDGEELEQILLHLVNTI----GSTNNNNSAQLLSADCKLQTI 108 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4966260 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54718 (350 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93563 300 2e-83 >Cs93563 Length = 164 Score = 300 bits (767), Expect = 2e-83, Method: Compositional matrix adjust. Identities = 142/163 (87%), Positives = 152/163 (93%) Query: 188 RDFEVMKKTHYYLVDTSVIIPGAAVSELQFNIIHEEPFIVHDLKVIPLPVWHGPGYRSLG 247 RDFEVMKKTHYYLVDTS IIPGAAVSELQFNII EEPF V DLK+ PLPVWHG GYRSLG Sbjct: 2 RDFEVMKKTHYYLVDTSGIIPGAAVSELQFNIIDEEPFTVQDLKITPLPVWHGAGYRSLG 61 Query: 248 FRFGNICYISDVSEIPEETYPLLKNCEILVLDALRPDRSSATHFGLPRALDEVRKIQPKR 307 FRFGNICYISDVSEIPEETYP L++CEIL++DALRPDRSS+THFGLPRAL+EVRKIQPKR Sbjct: 62 FRFGNICYISDVSEIPEETYPFLQDCEILIMDALRPDRSSSTHFGLPRALEEVRKIQPKR 121 Query: 308 TLFTGMMHLMDHEKVSEDLEKLKKTEGLDVQLSYDGLRVPVTL 350 TLF GMMHLMDHEKV+E+L KL +TEGLDVQLSYDGLRVPV L Sbjct: 122 TLFIGMMHLMDHEKVNEELLKLMETEGLDVQLSYDGLRVPVML 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59883 (485 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53234 (261 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs58194 196 2e-52 >Cs58194 Length = 167 Score = 196 bits (499), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 102/176 (57%), Positives = 112/176 (63%), Gaps = 10/176 (5%) Query: 85 MQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADRKRLFNMINDLPTIFEVVTGTAKKQ 144 MQEKDWLSLVAVHSD+WLLAVAFYFGARFGF K +RK+LF MINDLPTIFEVVTG AK+ Sbjct: 1 MQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKKLFQMINDLPTIFEVVTGNAKQP 60 Query: 145 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYSKTPQKXXXXXXXXXXXXXXX 204 K S P+ Sbjct: 61 KDQSANHNSSKSKSSGKSRPAESQTKAV---------KMSPPPKDDDDSGDEEEEDDEQG 111 Query: 205 XTLCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 260 T CGACG+NY +DEFWICCDICEKWFHGKCVKITPA+AEHIKQYKCPSCS+KR+R Sbjct: 112 AT-CGACGDNYGTDEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSCSSKRAR 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50196 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14166257 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4605 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51506 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65106187 147 1e-37 >Cs65106187 Length = 201 Score = 147 bits (371), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 77/150 (51%), Positives = 108/150 (72%) Query: 52 VESKKLWYLAGPAIFTSLCQYSLGAITQVFAGHVGTLELAAVSVENSVIAGFSFGVMLGM 111 +E K L+ LA PAI + + TQ+F GH+G LELAAVS+ N+ I F++G+MLGM Sbjct: 52 IELKNLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGM 111 Query: 112 GSALETLCGQAFGAGQLDMLGVYMQRSWVILTSTAVLLSFLYIFSARLLKLIGQTEAISK 171 GSA ETLCGQA+GA + DMLGVY+QRS VILT+T + L +YI S ++L L+G++ AI+ Sbjct: 112 GSATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYICSKQILLLLGESSAIAS 171 Query: 172 EAGMFAVWMLPQLFAYAVNFPLAKFLQAQS 201 A +F ++PQ+FAYAVNFP +F + ++ Sbjct: 172 AAAIFVFGLIPQIFAYAVNFPYKRFYRHKA 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9366262 (335 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16926 (379 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25409 70 4e-14 >Cs25409 Length = 359 Score = 70.1 bits (170), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 32/72 (44%), Positives = 40/72 (55%), Gaps = 5/72 (6%) Query: 93 NGQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTXXXXXXXXXXXXX 152 N Q K K YRG+RQR WGKW AEIR P+ R+WLGTF+T Sbjct: 156 NAQVAKPTKL-----YRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAY 210 Query: 153 XIRGKKAKVNFP 164 +RG+ A++NFP Sbjct: 211 KLRGEFARLNFP 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65924 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs173106186 115 5e-28 >Cs173106186 Length = 253 Score = 115 bits (287), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 67/195 (34%), Positives = 107/195 (54%), Gaps = 7/195 (3%) Query: 38 AFFIFGDSLLDPGNNNYINTTTEDQANFRPYGETFFKY-PTGRFSDGRLIPDFIAEYAKL 96 A FGDS +D GNNNY+ T +AN+ PYG F + PTGRF +G+L DF A+ Sbjct: 37 AIITFGDSAVDVGNNNYLATLF--KANYPPYGRDFINHQPTGRFCNGKLATDFTADTLGF 94 Query: 97 PL-IPPYLQP--GNHQFTYGANFASGGAGALDEINQ-GLVVNLNTQLRYFKKVEKHLRQK 152 P YL P GANFAS G+G D + ++L QL+Y+++ + L + Sbjct: 95 KTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKV 154 Query: 153 LGDEESKKLLLEAVYLISIGGNDYISPLFRNYSVFQIYSHRQYLDMVMGNLTVVIQEIYQ 212 G ++S ++ +A+Y++ G D++ + N + ++Y+ QY M++ + I+ +Y Sbjct: 155 AGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYG 214 Query: 213 KGGRKFGFVNMGPLG 227 G RKFG ++ PLG Sbjct: 215 LGARKFGVTSLPPLG 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17361 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45838 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57566 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76629 155 5e-40 >Cs76629 Length = 283 Score = 155 bits (392), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 103/260 (39%), Positives = 145/260 (55%), Gaps = 28/260 (10%) Query: 15 SGKLPDRSNFSQTCNLLSQFLKEKGRFGDLSLGMAGKSETKGRPESFK---SSTMSFELL 71 S LP++S+FSQTC+LLSQ+LKE G FGDLSLG++ E G PE + ++TM+ + Sbjct: 8 SVNLPEKSSFSQTCSLLSQYLKEGGSFGDLSLGISSNIEANGVPEIPRRPAATTMNLFPV 67 Query: 72 NKDKSSEASGQNGGGSSNLKSSDFYPQFAGFGSLASIDEAINMAD--FRKSATTESETSQ 129 + + + S +N N +S + +PQ AGF A ++ NM D K A +T+Q Sbjct: 68 SDNSGQDVSVRNMVAPRNWESMNLFPQQAGF---APKNDTPNMIDSSLNKPAP---QTAQ 121 Query: 130 MTIFYAGQVLVFNDFPAEKAREVMLLAAKGTP-QNTSGFLSTSGPEK-INT-GXXXXXXX 186 MTIFY GQV+ FNDFPA+KA E+M LA+ G+ + + + P + N+ Sbjct: 122 MTIFYGGQVIAFNDFPADKANEIMQLASNGSSLSHGTAYPPMQLPAQGYNSFAASLPKSP 181 Query: 187 XXXXXXXXXXNPQALSSGTFSIPASPAATPN------------PQAPLGSELPIARRNSL 234 P+ L+ + S+P + PN P P +LPIARRNSL Sbjct: 182 VESTPPVSPGPPKILTEPSCSVPPRSNSIPNFGNNLIPECAQPPSRPC--DLPIARRNSL 239 Query: 235 HRFLEKRKDRVNSKAPYQVN 254 HRFLEKRKDR+ ++APYQVN Sbjct: 240 HRFLEKRKDRIVARAPYQVN 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58784 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41509 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17782 63 1e-12 >Cs17782 Length = 216 Score = 63.2 bits (152), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 29/35 (82%), Positives = 33/35 (94%) Query: 73 MAAGEEKSNDFYAVLGLKKECTASELRNAYKRLAL 107 MA GEEKS++FYAVLGL KECTA+ELRNAYK+LAL Sbjct: 1 MANGEEKSSNFYAVLGLNKECTATELRNAYKKLAL 35 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30393 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs100106185 162 2e-42 >Cs100106185 Length = 135 Score = 162 bits (410), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 86/135 (63%), Positives = 106/135 (78%), Gaps = 2/135 (1%) Query: 28 IDKFAFPSRSHH--THEHKGLSTIPTDIMDTPKEYLFYMDVPGLCKSDIQVTVEDDNTLV 85 ++KF PSRS H T++ KG+S+IP DI+D+PK+Y+F+MDVPG KSDIQVTVED+ TLV Sbjct: 1 MEKFTTPSRSPHQETNKSKGVSSIPVDILDSPKDYIFFMDVPGRPKSDIQVTVEDERTLV 60 Query: 86 IRSHXXXXXXXXXXXXCKYVRLERRAPQKLMRKFRLPENANTSAISAKCENGALTVVIEK 145 IRS+ CK +RLERR PQKL+RKF+LPE+AN SAISAKCENG LT+V+EK Sbjct: 61 IRSNGKRKREDGEEEGCKCIRLERRVPQKLLRKFKLPEDANVSAISAKCENGVLTIVVEK 120 Query: 146 HPPPPKSKTVEVTIA 160 PPPPK KTVEV I+ Sbjct: 121 LPPPPKPKTVEVAIS 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13185 (413 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs102609 339 2e-95 >Cs102609 Length = 213 Score = 339 bits (870), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 173/210 (82%), Positives = 191/210 (90%) Query: 201 MGLFLQKTNIIRDYLEDINEIPKSRMFWPREIWSKYVNKLEDLKEEENSIKAVQCLNDMV 260 MGLFLQKTNIIRDYLEDINEIPK RMFWPREIWSKYVNKLEDLK EENS KAVQCLNDMV Sbjct: 1 MGLFLQKTNIIRDYLEDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMV 60 Query: 261 TNALIHMEDCLKYMSALQSPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAK 320 TNAL+H+EDCLKYMSAL+ AIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAK Sbjct: 61 TNALMHVEDCLKYMSALRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAK 120 Query: 321 VIDRTKTMSDVYGAFFDFSCMLKSKVDKNDPNATKALSRLEAVQKICRESGALTKRKSYV 380 VIDRT M+DVY AF+DFS +LK K++KNDPNATK LSR+EA+QK C +SG L KRKSY+ Sbjct: 121 VIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYI 180 Query: 381 IRSEPRYNSALIVAFFIILSIIFAYLSANR 410 I+SE RY+S +IV FFIIL+IIF+YLS+ R Sbjct: 181 IQSELRYSSTMIVIFFIILAIIFSYLSSTR 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19104 (398 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103630 630 0.0 >Cs103630 Length = 345 Score = 630 bits (1624), Expect = 0.0, Method: Compositional matrix adjust. Identities = 303/330 (91%), Positives = 319/330 (96%), Gaps = 1/330 (0%) Query: 14 VLDKSDWVKGQTLRQSSVSVIRCLPTAPSGLTIRAGSYADELVKTAKTIASPGRGILAMD 73 VLDKS+WVKGQ +RQS+VSV R LP+ PS LTIRAGSYADELVKTAKT+ASPGRGILAMD Sbjct: 15 VLDKSEWVKGQAIRQSTVSV-RSLPSGPSALTIRAGSYADELVKTAKTVASPGRGILAMD 73 Query: 74 ESNATCGKRLASIGLENTEANRQAYRTLLVTVPGLGNHISGAILFEETLYQSTTDGKKMV 133 ESNATCGKRLASIGLENTEANRQAYRTLLVT PGLG +ISGAILFEETLYQSTTDGKKMV Sbjct: 74 ESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMV 133 Query: 134 DVLVEQKIVPGIKVDKGLVPLVGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIP 193 DVLVEQ IVPGIKVDKGLVPL GSNDESWCQGLDGLASR+AAYYQQGARFAKWRTVVSIP Sbjct: 134 DVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 193 Query: 194 NGPSALALKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIERTFEVAQKVWAEVFFY 253 NGPSALA+KEAAWGLARYAAI+QDNGLVPIVEPEILLDG+HGI+RTFEVA+KVWAEVFFY Sbjct: 194 NGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHGIDRTFEVAKKVWAEVFFY 253 Query: 254 LAENNVMFEGILLKPSMVTPGAECKDRATPEQVADYTLKLLKRRIPPAVPGIMFLSGGQS 313 LAENNVMFEGILLKPSMVTPGAECK++ATP+QVA+YTLKLL RRIPPAVPGIMFLSGGQS Sbjct: 254 LAENNVMFEGILLKPSMVTPGAECKEKATPQQVAEYTLKLLHRRIPPAVPGIMFLSGGQS 313 Query: 314 EVEATLNLNAMNQGPNPWHVSFSYARALQN 343 EVEATLNLNAMNQGPNPWHVSFSYARALQ Sbjct: 314 EVEATLNLNAMNQGPNPWHVSFSYARALQT 343 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64951 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49738 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49284 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36137 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12366263 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41528 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15164 (302 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24787 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23931 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 66 4e-13 >Cs36939 Length = 275 Score = 65.9 bits (159), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 25/40 (62%), Positives = 34/40 (85%) Query: 77 LIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKL 116 +II L +LLGN+W+ IA LP RTDN+IKNYWNTH+++K+ Sbjct: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKV 40 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5051 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64486 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18866260 (386 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2047 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19544 (354 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs40321 61 2e-11 >Cs40321 Length = 204 Score = 60.8 bits (146), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 42/119 (35%), Positives = 64/119 (53%), Gaps = 8/119 (6%) Query: 238 ASVGDVEGLKNALASGADKDEEDSEGR-TALHFACGYGEVKCAQILVEAGATVDALDKNK 296 A +GDV L+ AL + + +E E R TALH C YG + C Q+L+E GA+++A D++ Sbjct: 45 AQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDG 104 Query: 297 NTALHYAAGYGRKECVALLLENGAAV-----TLQNMD--GKTPIDVAKLNSQHEVLKLL 348 LH A G E V LL+ + + L+ +D G TP+ A +V++LL Sbjct: 105 AIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLL 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41361 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44142 76 2e-16 >Cs44142 Length = 180 Score = 75.9 bits (185), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 35/62 (56%), Positives = 44/62 (70%) Query: 100 MLSARNLSITWSSNTLYWSWKPLLQSRFAETVELRTICWLEIQGKISTSVLSPKTTYRAY 159 M+SAR+L I WSS + YW W + ++RF E EL +CWLEI+GKIST LSP T Y AY Sbjct: 1 MISARDLLIIWSSTSAYWRWISIPEARFPEVAELIRVCWLEIRGKISTRSLSPGTLYTAY 60 Query: 160 LI 161 L+ Sbjct: 61 LV 62 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19697 (335 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35496 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50341 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 160 6e-42 >Cs30681 Length = 257 Score = 160 bits (406), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 81/172 (47%), Positives = 106/172 (61%) Query: 2 DCARALEFLHEHAVPSIIHRDFKPSNILLDQNFRAKVSDFGLAKTSSDKINSQIPTRVIG 61 D AR L +LHE II RDFK SNILLD+ + AK+SDFGLA+ S + T V+G Sbjct: 29 DAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPSDGLSHVSTAVVG 88 Query: 62 TTGYLAPEYASSGKLTTKSDVYSYGVVLLELLTGRVPLDTKRPPGEDVLVSWALPRLTNR 121 T GY APEY +G+LT KSD++S+GV L EL+TGR PLD RP E L+ W P LT+ Sbjct: 89 TIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRNRPKSEQKLLEWVRPHLTDA 148 Query: 122 QKLVEMVDPALQGHYSKKDLXXXXXXXXVCVQHEADYRPLMTDVVQSLIPLV 173 +K ++DP L+G YS K C+ +A RP M++VV+ L +V Sbjct: 149 KKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKGRPKMSEVVEVLNKIV 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46672 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19217 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26557 328 2e-92 >Cs26557 Length = 185 Score = 328 bits (842), Expect = 2e-92, Method: Compositional matrix adjust. Identities = 155/185 (83%), Positives = 175/185 (94%) Query: 1 MEQSSAVKCPSISYHLAGTKKIQQELAKPNVLERFLENKDDIAKLRKCFAGLWSLDDSNI 60 MEQSSAVKCPSISYHLAGTKKIQQELAKPNVLERFL+NK+DIAK+RKCFAGLWSLDDS Sbjct: 1 MEQSSAVKCPSISYHLAGTKKIQQELAKPNVLERFLDNKEDIAKVRKCFAGLWSLDDSEN 60 Query: 61 IKEAIERPEVFVMKPQREGGGNNIYGDDVRETLLRLQKEGTEEDAAYILMQRIFPNVSPT 120 + +AIE PE++VMKPQREGGGNNIYG+DV+ETLLRL+K+GT+EDAAYILMQRIFP+VS T Sbjct: 61 VSKAIENPELYVMKPQREGGGNNIYGEDVKETLLRLKKDGTDEDAAYILMQRIFPSVSLT 120 Query: 121 FLMREGICYKDHAISELGIYGAYLRNKEKVIINDQCGHLMRTKVSSSNEGGVAAGFAVLD 180 FLMR+GIC+KDHAISELGIYGAYLR KEKVI+N+Q G+LMRTKV+SSNEGGVAAGFAV Sbjct: 121 FLMRDGICHKDHAISELGIYGAYLRIKEKVIMNEQSGYLMRTKVASSNEGGVAAGFAVWX 180 Query: 181 SIYLT 185 +YLT Sbjct: 181 RLYLT 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9908 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6720 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14589 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74879 90 4e-21 >Cs74879 Length = 127 Score = 90.1 bits (222), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 1/70 (1%) Query: 26 MRVTRSIMIIKPPGFQNGSPPVSPAGSTPPVSPFS-GGKESFRFRRRSTSDAYEKGNGVG 84 M+VTRSIMI+KPPG+Q+GSPPVSPAGSTPPVSPFS GG++SFRFRRRS SDAYEK N VG Sbjct: 58 MKVTRSIMIVKPPGYQSGSPPVSPAGSTPPVSPFSAGGRDSFRFRRRSASDAYEKRNEVG 117 Query: 85 PRSPRPPYDV 94 RSP PYDV Sbjct: 118 LRSPTTPYDV 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31134 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21166264 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60385 221 4e-60 >Cs60385 Length = 165 Score = 221 bits (563), Expect = 4e-60, Method: Compositional matrix adjust. Identities = 107/163 (65%), Positives = 126/163 (77%), Gaps = 1/163 (0%) Query: 1 MSTGELLSIEPQELQFPFELRKQISCSLQLSNKTDNYVAFKVKTTNPKKYCVRPNTGVVM 60 MSTG+L++I+P EL+FPFEL+KQ SCS+QL+NKTD +VAFKVKTTNPKKYCVRPNTG+++ Sbjct: 1 MSTGDLVNIQPSELKFPFELKKQSSCSMQLTNKTDKFVAFKVKTTNPKKYCVRPNTGIIL 60 Query: 61 PRSTCDVIVTMQAQRETPQDMQCKDKFLLQSAIASPGATAKDITSDMFNKEAGNRVEECK 120 PR++C V VTMQAQ+E P D QCKDKFLL S +A GATAKDI DMF KE G VEE K Sbjct: 61 PRTSCAVTVTMQAQKEAPPDFQCKDKFLLLSVVAPDGATAKDIGPDMFTKEDGKVVEEFK 120 Query: 121 LRVAYVXXXXXXXXVREGSEEGSSPRASVSDNGNINASEFTAV 163 LRV Y+ V EGSEEGSSPRA +NGN + S F V Sbjct: 121 LRVVYI-PANPPSPVPEGSEEGSSPRAFSQENGNHHNSSFDDV 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56209 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6137 (314 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2398 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80386 115 3e-28 >Cs80386 Length = 279 Score = 115 bits (289), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 54/76 (71%), Positives = 58/76 (76%), Gaps = 1/76 (1%) Query: 73 PRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVFAAGLTQRFCQQCSRFHLLSEFDNGK 132 PRCQ EGC DL+ AK Y+ RHKVC HSK+ V AGL QRFCQQCSRFH L EFD GK Sbjct: 91 PRCQVEGCKVDLSDAKAYYSRHKVCGMHSKSPVVTVAGLEQRFCQQCSRFH-LPEFDQGK 149 Query: 133 RSCRKRLADHNRRRRK 148 RSCR+RLA HN RRRK Sbjct: 150 RSCRRRLAGHNERRRK 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27467 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36395 64 8e-13 >Cs36395 Length = 380 Score = 64.3 bits (155), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 36/102 (35%), Positives = 48/102 (47%), Gaps = 3/102 (2%) Query: 18 YAENHTVGGSSGW--DTGVDYSTWASGETFTVGDYLVFTYGS-THSVDEVSKSSYDSCAT 74 +A VGG GW + G +Y+ W+ F V D L F Y + SV V+K YDSC T Sbjct: 22 HALKFNVGGKHGWVTNPGENYNKWSGRNRFLVNDTLFFKYKKGSDSVLLVNKDDYDSCNT 81 Query: 75 SNPTKSYTGGSNTIALTTAGSLYFLCPTTGHCSQGMKLAITV 116 P G + L +G YF+ HC +G KL + V Sbjct: 82 KKPLLKLDSGDSEFKLDRSGPFYFISGNHDHCQKGQKLIVVV 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1166261 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13800 (57 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14448 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27445 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv146 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28408 (382 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17966265 (389 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104090 277 1e-76 >Cs104090 Length = 227 Score = 277 bits (709), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 121/146 (82%), Positives = 136/146 (93%) Query: 238 DKRFKTLPPSESLPRNETVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLF 297 DKRFKTLP +E+LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPPRYRDSVRAITPGLPLF Sbjct: 74 DKRFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLF 133 Query: 298 LYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPMEEDSFR 357 LYNY+THQLHG+FEA FGG+NIDPTAWEDKKC GESRFPAQVR+ RK+C+ +EED+FR Sbjct: 134 LYNYTTHQLHGIFEATGFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFR 193 Query: 358 PVLHHYDGPKFRLELNVPEALSLLDI 383 PVLHHYDGPKFRLEL+VPE L L+D+ Sbjct: 194 PVLHHYDGPKFRLELSVPETLDLMDL 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5766256 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6567 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27615 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10166263 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39122 (231 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22123 (266 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65230 (281 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76516 270 2e-74 >Cs76516 Length = 291 Score = 270 bits (689), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 125/250 (50%), Positives = 162/250 (64%), Gaps = 18/250 (7%) Query: 46 GQLLSLSLDQASGSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGSTHDEIDFE 105 G L L+LD SG+GF SK +YLFG++ +Q+KLV G+SAGTVTA+Y+SS G H+E DFE Sbjct: 42 GDTLKLNLDNYSGAGFASKSKYLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFE 101 Query: 106 FLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFHTYSIIWTARHIIFLVDNVPIR 165 FLGN +G+PY++ TNV+ G GNREQ+ LWFDPT+ FHTYS++W R ++FLVD PIR Sbjct: 102 FLGNTTGEPYLVQTNVYVNGVGNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIR 161 Query: 166 LFKNAESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFRANXXXX 225 + N E G+PFPK+Q M +YSS+WNADDWAT+GG VKTDWS APF A Y+ F + Sbjct: 162 VHTNLEHKGIPFPKDQAMGVYSSIWNADDWATQGGRVKTDWSHAPFIASYKGFDIDACEC 221 Query: 226 XXXXXXXXXXX-----------------XELDSYSRRRLRWVQKNFMIYNYCTDLKRFPQ 268 EL+ + +L WV+ N +IY+YCTD RFP Sbjct: 222 PASVAGADNAKKCSSSAEKRFWWDEPTLSELNVHQSHQLMWVRANHLIYDYCTDTSRFP- 280 Query: 269 GVPAECKRSR 278 +P EC R Sbjct: 281 AIPTECVHHR 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37201 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21621 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36319 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24025 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32139 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35079 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv91 (337 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23428 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28566264 (336 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34229 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74474 63 4e-12 >Cs74474 Length = 137 Score = 62.8 bits (151), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 32/104 (30%), Positives = 53/104 (50%) Query: 85 QGILPTNIFGFSIQRISLSCFEISETVVNDLITNMANLWNNWIHMIRLLAGGGDWNTFFK 144 LP IF ++ ++I S F +S+ L ++A+ WN I +++ L+ G DW F K Sbjct: 8 HSFLPEKIFEYTFEKIPASSFHLSDEKSLRLAHSVASSWNTSITVLKSLSKGNDWMLFLK 67 Query: 145 VAIPLYFLKLILSQCXXXXXXXXXXXXFTSFFVYEQYEEEMDGL 188 AIPL L L+ + F F++YE+ E+E+D + Sbjct: 68 AAIPLLILSLLGAISLQSLFIKGIPLAFVIFYMYEKKEQEIDSI 111 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52489 (331 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33766 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21066261 (516 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52807 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36576 (514 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16354 (432 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12724 (298 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54530 111 1e-26 >Cs54530 Length = 247 Score = 111 bits (277), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 77/224 (34%), Positives = 111/224 (49%), Gaps = 18/224 (8%) Query: 76 AEFVGTFILIFAATAGPIVNQKYSGV-----ETLIGNAACAGLAVMIVILSTGHISGAHL 130 AEF+ T + +FA I K + L+ A C G A+ + + +ISG H+ Sbjct: 22 AEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICHGFALFVAVAVGANISGGHV 81 Query: 131 NPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKAVFHPFMSGGVTVPSVSIG--- 187 NP++T A + Y AQ+ SI ASF LK V +GG+ VP+ ++ Sbjct: 82 NPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVV-----TGGLAVPTHNVAAGV 136 Query: 188 ---QAFALEFLITFNLLFXXXXXXX--XXXXXGELAGIAVGATVMLNILVAGPSSGGSMN 242 + +E +ITF L++ G +A IA+G V NIL AGP SGGSMN Sbjct: 137 GAIEGVVMEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMN 196 Query: 243 PVRTLGPAVAAGNYRAIWIYLVAPTLGAVAGAAIYTAVKLRADE 286 P R+ GPAVA+GN++ WIY V P +G IY V + ++ Sbjct: 197 PARSFGPAVASGNFQDNWIYWVGPLIGGGLAGLIYGNVFMHSEH 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26150 (179 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44338 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4666256 (369 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3467 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36106190 337 1e-94 >Cs36106190 Length = 283 Score = 337 bits (863), Expect = 1e-94, Method: Compositional matrix adjust. Identities = 163/227 (71%), Positives = 185/227 (81%), Gaps = 1/227 (0%) Query: 1 MATFLFLYITILTVMGVKKSPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT 60 +AT LFLY+++ TV+G KK C VG+ GIAWAFGGMIF LVYCTAGISGGHINPAVT Sbjct: 48 VATLLFLYVSVATVIGHKKQSDACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVT 107 Query: 61 FGLLLARKLSLTRAIFYIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTKGDG 120 FGL LARK+SL RA+ Y++ QCLGAICG G+VK F Y LGGGAN V SGY KG Sbjct: 108 FGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFM-KHEYNSLGGGANTVASGYNKGSA 166 Query: 121 LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA 180 LGAEI+GTFVLVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+VHLATIPITGTGINPA Sbjct: 167 LGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA 226 Query: 181 RSLGAAIIFNREHAWDDMWIFWVGPFIGAALAAMYQQIVIRAIPFKS 227 RS GAA+I+N + AWDD WIFWVGPF+GA AA Y Q ++RA K+ Sbjct: 227 RSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKA 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv273 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61701 (91 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17363 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17305 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5117 (304 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10510 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31695 (388 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14550 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14766260 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104648 425 e-121 >Cs104648 Length = 236 Score = 425 bits (1092), Expect = e-121, Method: Compositional matrix adjust. Identities = 207/236 (87%), Positives = 221/236 (93%) Query: 1 MLGVFSSSIMSPPDELVAAGCRTPSPKITAEALMNRFIQGNPSAVSVHVGDHVQLAYTHH 60 MLGVFSS+I+SPP+ELVAAG RTPSPK T+ AL++RF+Q N SAVSV VGD+V LAYTH Sbjct: 1 MLGVFSSAIVSPPEELVAAGSRTPSPKTTSTALVDRFLQTNSSAVSVQVGDNVTLAYTHQ 60 Query: 61 NESPLLPRSFAVKDEIFSLFEGALDNLGSLRQQYGLAKSANEVVLVIEAYKALRDRAPYP 120 NESPL RSFAVKDEIF LFEGALDNLGSLRQQYGLAKSANEV+LVIEAYKALRDRAPYP Sbjct: 61 NESPLRQRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP 120 Query: 121 PNHVVGHLSGSFAFIVFDKSTSTLFVASDQFGKVPLSWGITADGYVAFADDAELLKGACG 180 PNHVVGHLSG FAFIV+DKSTSTLFVASDQFGKVPL WGITADG+VAFADDA+LLKGACG Sbjct: 121 PNHVVGHLSGYFAFIVYDKSTSTLFVASDQFGKVPLYWGITADGHVAFADDADLLKGACG 180 Query: 181 KSLASFPQGCFFSTAVGELRSFENPKNKITAVPAPDEEIWGATFKVEGPAVFAATK 236 KSLASFPQGCFFSTAVG LRSFENPKNKITAVPA +EEIWGATFKVEGPAVFAAT+ Sbjct: 181 KSLASFPQGCFFSTAVGGLRSFENPKNKITAVPAAEEEIWGATFKVEGPAVFAATE 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2098 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45298 (272 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13235 (522 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14277 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40892 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21866262 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31766264 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31166264 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31266263 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61660 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17266259 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52645 (464 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38923 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57457 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs56792 196 5e-53 >Cs56792 Length = 252 Score = 196 bits (499), Expect = 5e-53, Method: Compositional matrix adjust. Identities = 90/114 (78%), Positives = 102/114 (89%) Query: 1 MYIHNIHKSKHGSDSGTYDTEGRYMPVNLENIFSKYAQTVPEKLTLGELWNMTEGNRAAF 60 +YIHNIH+SKHGSDSGTYDTEGRY PVNLEN+FSKYA+TVP+KLTLGE+WN+TEGNR AF Sbjct: 138 IYIHNIHRSKHGSDSGTYDTEGRYTPVNLENMFSKYARTVPDKLTLGEVWNLTEGNRLAF 197 Query: 61 DFFGGIASKLEWGLLYVLARDEEGFLSKEAVRRVFDGSLFEYCAKAQMGYEGKM 114 D FG +A+KLEW LLY+LARDEEG LSKEAVRR FDGSLFEYCA+ + E KM Sbjct: 198 DLFGWVAAKLEWILLYILARDEEGLLSKEAVRRCFDGSLFEYCARMNLVGEDKM 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3484 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11600 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8908 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18590 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs97445 258 5e-71 >Cs97445 Length = 230 Score = 258 bits (658), Expect = 5e-71, Method: Compositional matrix adjust. Identities = 123/173 (71%), Positives = 135/173 (78%) Query: 3 FIAISESDIKFIVQDVRSKDGVVFHYGFIXXXXXXXXXXXXXXXXXXXHVDESRRKLNSR 62 FI +++SD KFIVQDVRS+DG+VFHYG VDESRRKLNSR Sbjct: 58 FIIVADSDFKFIVQDVRSRDGIVFHYGVFENSGGEFETELEKGKEVRLWVDESRRKLNSR 117 Query: 63 LHSAGHLLDICMRTVGLGNLEPGKGYHFPDGPFVEYKGVVPQNELQGKQKELELDANALI 122 LHSAGHLLD+CM+ VGLG+LEPGKGYHFPDGP+VEYKG VPQNELQ K KELEL+ANALI Sbjct: 118 LHSAGHLLDVCMQKVGLGHLEPGKGYHFPDGPYVEYKGSVPQNELQSKTKELELEANALI 177 Query: 123 SRGGKVSAVVLPYAEAVELCGGCLPDYIPKSSNPRILKLGDNPGCPCGGTHVS 175 SRGGKV VLPY EA LCGGCLP YIP+ S PRI+KLGDNPGCPCGGT VS Sbjct: 178 SRGGKVMVAVLPYEEASMLCGGCLPHYIPQGSTPRIVKLGDNPGCPCGGTQVS 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29575 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9986 105 2e-25 >Cs9986 Length = 197 Score = 105 bits (262), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 4/140 (2%) Query: 15 NYGQIANNLPSPDDVVPLVRSIGASRVKLYDADPKVLRAFANTGVEFIVGLGNEYLSKMR 74 NYG++ANNLPSP+ VV L++S G RVK YD D VL A AN+ + +V NE LSK Sbjct: 12 NYGRVANNLPSPEKVVELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAA 71 Query: 75 DPDKALA--WVKANVQAHLPDTNITCITVGNEILTFNDTSLNDNLLPAMQGVHAVLVNLG 132 D++ WV+AN+ + P T I + VGNE+ + + L+PAM+ V+ LV Sbjct: 72 A-DQSFTDNWVQANISKYYPATKIEAVAVGNEVFA-DPKNTTPFLVPAMKNVYNSLVKYK 129 Query: 133 LDKQVSVTTAHSLAILETSY 152 LD V V++ +L L+ SY Sbjct: 130 LDSNVKVSSPIALGALQNSY 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30088 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47367 228 3e-62 >Cs47367 Length = 140 Score = 228 bits (580), Expect = 3e-62, Method: Compositional matrix adjust. Identities = 108/140 (77%), Positives = 123/140 (87%) Query: 1 MITAGADFMLIPSRFEPCGLIQLHAMRYGTVPICAATGGLVDTVKEGFTGFHMGPFNVEC 60 MI AGADF+LIPSRFEPCGLIQLHAMRYGTVPI A+TGGLVDTV+EGFTGF MG F+V+C Sbjct: 1 MIIAGADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDC 60 Query: 61 DRIDPADVDAVAITVKRALATYGTAALGEMIQNCMALDLSWKGPSKNWEELLLSLGPAGC 120 + +DP DV AV+ TV+RALATYGT AL EM++N MA DLSWKGP+K WEE LL+L AG Sbjct: 61 EAVDPVDVAAVSTTVRRALATYGTQALAEMMKNGMAQDLSWKGPAKKWEETLLNLEVAGS 120 Query: 121 QPGIEGEEIAPLAKENVATP 140 +PGI+GEEIAPLAKENVATP Sbjct: 121 EPGIDGEEIAPLAKENVATP 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14266263 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61491 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30966264 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47574 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs58462 195 3e-52 >Cs58462 Length = 290 Score = 195 bits (496), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 94/214 (43%), Positives = 138/214 (64%), Gaps = 30/214 (14%) Query: 2 VELFKNYGSTLAGLRALGYNIDADDYHSFVHGRLPYELIKPDSQLRSLLRSIALRKIILT 61 V L+K YG+TLAGLRA+GY D DD+HS+VHGRLPY ++KPD LR+LL S+ +RK+I T Sbjct: 61 VSLYKFYGTTLAGLRAIGYQFDCDDFHSYVHGRLPYMMLKPDPVLRNLLLSLPIRKVIFT 120 Query: 62 NSDRNHAIKVLDRLGLQDCFDQIICFETMNP----------NLPKSTR------LDEF-- 103 N+D+ HA +VL RLGL+DCF++II FET+N + +S R +D++ Sbjct: 121 NADKTHAARVLSRLGLEDCFERIISFETLNSTDKGTVLVDQDASESERPTELFDIDDYCS 180 Query: 104 -----------PVILNPSLDAMKIALDAANVNPPRTLFLDDNVRNIAAGKALGLRTVLVG 152 PV+ P +A + AN+NP +T+F DD++RN+ GK LGL TV VG Sbjct: 181 RPNADLELPRTPVVCKPFEEAFEQVFKIANINPRKTIFFDDSIRNLETGKRLGLHTVWVG 240 Query: 153 KTMKTKEADYVLETVHNLAQVIPEIW-LGGKDGE 185 + + + DY LE++HN+ + +PE+W + G++ E Sbjct: 241 TSHRAEGVDYALESIHNIKEALPELWEVAGENSE 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27366263 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80225 183 1e-48 >Cs80225 Length = 192 Score = 183 bits (464), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 86/114 (75%), Positives = 101/114 (88%) Query: 68 KVSTKFGGVFAFSGPAPERINGRLAMVGFVAAMGAEIWKGEDVFAQISNGGIPWFLGTAV 127 ++ST F VFAFSGPAPERINGRLAM+GFVAA+G EI KG+DVFAQ+S GG WFLGT+V Sbjct: 78 RMSTGFSDVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSYGGDAWFLGTSV 137 Query: 128 VLSLASLIPLFKGVSVESKSKGLMTSDAEMWNGRFAMLGLVALAFTEYLKGGAL 181 +L++ASL+PLFKGVSVESKS G MTSDAE+WNGRF ML LVALAFT+++KGG L Sbjct: 138 LLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFDMLDLVALAFTDFVKGGTL 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11258 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57770 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs85196 240 6e-66 >Cs85196 Length = 149 Score = 240 bits (612), Expect = 6e-66, Method: Compositional matrix adjust. Identities = 115/147 (78%), Positives = 134/147 (91%) Query: 1 MADVLSEEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMIREVDADG 60 MAD L+++QI EFKEAF LFDKDGDGCIT +EL TV+RSL QNPTE ELQDMI EVDADG Sbjct: 1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG 60 Query: 61 NGSIEFAEFLNLMAKKVKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDE 120 NG+I+F EFLNLMA+K+K+TD+EEELKEAF+VFDKDQNG+ISA ELRHVM NLGEKLTDE Sbjct: 61 NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120 Query: 121 EVEQMIREADLDGDGQVNYDEFVKMMM 147 EV++M READ+DGDG +NY+EFVK+MM Sbjct: 121 EVDEMXREADVDGDGXINYEEFVKVMM 147 Score = 60.5 bits (145), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Query: 1 MADVLSEEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMIREVDADG 60 M D SEE E KEAF +FDKD +G I+ EL V+ +L + T+EE+ +M RE D DG Sbjct: 77 MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMXREADVDG 133 Query: 61 NGSIEFAEFLNLMAKK 76 +G I + EF+ +M K Sbjct: 134 DGXINYEEFVKVMMAK 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8254 (239 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13666262 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21866260 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22666258 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31266265 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33910 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55468 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49783 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68010 128 3e-32 >Cs68010 Length = 146 Score = 128 bits (322), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 66/147 (44%), Positives = 92/147 (62%), Gaps = 7/147 (4%) Query: 3 MNAFFGGFAAAL--TSDPVWVMNVVPPRKPSTLGVIYDRGLIGVYHDWCEPFSTYPRTYD 60 MNA GF +AL VWVMNVVP + L +I DRG +GV HDWCE F TYPRTYD Sbjct: 1 MNAHSCGFNSALLEKGKSVWVMNVVPTIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTYD 60 Query: 61 LIHVTSIESLIKILGSGKNRCNLVDLMVEMDRILRPEGTVVIRDSPEVIDKIGRIAQAVR 120 L+H E L+ + ++RC+ +D+ E+DRILRPEG V+IRD+ +I+ + ++ Sbjct: 61 LVHA---EGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIESARALTTRLK 117 Query: 121 WTATIHEKEPESHGREKILVATKNFWK 147 W A + E ES+ E++L+ K F+K Sbjct: 118 WDARV--IEIESNSDERLLICQKPFFK 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59326 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58826 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27169 201 8e-54 >Cs27169 Length = 201 Score = 201 bits (510), Expect = 8e-54, Method: Compositional matrix adjust. Identities = 93/114 (81%), Positives = 103/114 (90%) Query: 127 MHPIYRLLHPHFRYTMHINAHARESLINAEGIIESSFSPGKYSVELSSVAYDQQWRFDRE 186 MHPIYRLL PHFRYTM IN AR++L+NA+GIIESSFSPGKYS+E SSVAYD+QWRFD E Sbjct: 1 MHPIYRLLDPHFRYTMEINGLARQALVNADGIIESSFSPGKYSMEFSSVAYDKQWRFDHE 60 Query: 187 ALPADLINRGIAVEDPDAPHGLKLLIEDYPFANDGLILWDALKQWVADYVNYYY 240 ALP DLI+RG+AVEDP APHGLKL IEDYPFANDGL LWDA+KQWV DYVN+YY Sbjct: 61 ALPKDLISRGLAVEDPSAPHGLKLTIEDYPFANDGLDLWDAIKQWVTDYVNHYY 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29881 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25941 (117 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14651 (241 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs3951 296 2e-82 >Cs3951 Length = 185 Score = 296 bits (757), Expect = 2e-82, Method: Compositional matrix adjust. Identities = 142/178 (79%), Positives = 154/178 (86%) Query: 52 MLEMDGEYEGNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFXXXXXXXXXXXX 111 MLEMD EYEGNVEATGEDYSVEP D+RRPFRALLDVGL++TTTGNRVF Sbjct: 1 MLEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD 60 Query: 112 IPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVE 171 IPHSDKRFAGFSKD KQLDAEVHRKYIYGGHV+AYM TL+EDEPEKYQSHF+EYIKKG++ Sbjct: 61 IPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGID 120 Query: 172 PDDIEEMYKKVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS 229 D +E +YKKVHAAIRA+P KK EK PKEHKRYNLKKLTYEERKAKL+ERLNALNS Sbjct: 121 ADGLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNS 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20866257 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs50930 207 2e-56 >Cs50930 Length = 101 Score = 207 bits (527), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 99/101 (98%), Positives = 100/101 (99%) Query: 1 MDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKLATLTGHTYRVLYLAISPDG 60 MDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKLATLTGHT+RVLYLAISPDG Sbjct: 1 MDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKLATLTGHTFRVLYLAISPDG 60 Query: 61 QTIVTGAGDETLRFWNVFPSPKSQNTDSEIGASSLGRTQIR 101 QTIVTGAGDETLRFWNVFPSPKSQNTDSEIGASSLGRT IR Sbjct: 61 QTIVTGAGDETLRFWNVFPSPKSQNTDSEIGASSLGRTTIR 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10885 (306 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4299 198 7e-53 >Cs4299 Length = 133 Score = 198 bits (503), Expect = 7e-53, Method: Compositional matrix adjust. Identities = 93/123 (75%), Positives = 105/123 (85%) Query: 181 MLENDRGDFIGTAAREVEEETGIHLNLQDMVDLTAFLDPSTGCRLFPSPGGCDEEISLFL 240 ML++D+GDF+GTA REVEEETGI L L+DM+DLTAFL PSTGC+ FPS GGCDEEISLFL Sbjct: 1 MLDDDKGDFVGTAVREVEEETGIQLKLEDMIDLTAFLYPSTGCKFFPSAGGCDEEISLFL 60 Query: 241 YKGSVSKETITQLQGKKTGLRERGELIKVHVVPYEKLWRVTADAKTLSAIALYEMAKKEG 300 Y+G V KE I QLQGK+TGLR+ GELIKV VVPY +LWR T DAK L+AIALYEMA KE Sbjct: 61 YRGRVDKEIIMQLQGKETGLRDHGELIKVRVVPYRELWRTTPDAKVLTAIALYEMASKEE 120 Query: 301 LLP 303 LLP Sbjct: 121 LLP 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21879 (355 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59112 171 9e-45 >Cs59112 Length = 265 Score = 171 bits (434), Expect = 9e-45, Method: Compositional matrix adjust. Identities = 95/271 (35%), Positives = 139/271 (51%), Gaps = 14/271 (5%) Query: 9 VESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIXXXXXXXXXXX 68 + SLS S +IP E++RP++E + P++PTIDL D Sbjct: 9 IASLSHSN-GTIPAEFVRPEKEQPASATY-----HGPAPEIPTIDLDD------PVQDRL 56 Query: 69 XXXLKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQASGKIAGYG 128 + +A+ EWG+ + NHGI DLI +++ G+ FF LP EEKE Y+ + + GYG Sbjct: 57 VRSIAEASREWGIFQVTNHGIPSDLIGKLQAVGKEFFELPQEEKEVYSRPADAKDVQGYG 116 Query: 129 SKLANNASGQLEWEDYFFHLIFPEDKRDMTIWPKTPSDYVPATCEYSVKLRSLATKIXXX 188 +KL G+ W D+ FH ++P + WP P Y EY+ +R + K+ Sbjct: 117 TKLQKEVEGKKSWVDHLFHRVWPPSSINYRFWPNNPPSYRAVNEEYAKYMREVVDKLFTY 176 Query: 189 XXXXXXXXXXXXXXXXXXMEELLLQKKINYYPKCPQPELALGVEAHTDVSALTFILHNMV 248 +++ KINYYP CP+P+LALGV AHTD+SALT ++ N V Sbjct: 177 LSLGLGVEGGVLKEAAGG-DDIEYMLKINYYPPCPRPDLALGVVAHTDLSALTVLVPNEV 235 Query: 249 PGLQLFYEGKWVTAKCVPNSIIMHIGDTIEI 279 PGLQ+F + +W+ AK +P H G IEI Sbjct: 236 PGLQVFKDDRWIDAKYIPTLSSSHRG-QIEI 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48314 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs61991 166 7e-44 >Cs61991 Length = 244 Score = 166 bits (419), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 80/89 (89%), Positives = 86/89 (96%) Query: 1 MQMEKNRINKDGEIVISSTKTRTQKGNIEDALGKLQAIIDAASYVPPPPSEEQKKKIAKL 60 MQMEKNRINKDGEIVISSTKTRTQKGNIEDALGKLQAIIDAASYVPPPPSEE+KK + KL Sbjct: 151 MQMEKNRINKDGEIVISSTKTRTQKGNIEDALGKLQAIIDAASYVPPPPSEEKKKXMTKL 210 Query: 61 AAIGEQKRLQNKKVLSQKKAFRRSRDSWD 89 AAIGEQKRL++KK +S+KKAFRRSRDSWD Sbjct: 211 AAIGEQKRLKSKKAVSEKKAFRRSRDSWD 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34770 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78954 182 3e-48 >Cs78954 Length = 207 Score = 182 bits (461), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 113/186 (60%), Positives = 134/186 (72%), Gaps = 17/186 (9%) Query: 26 ASASRSFNTNAQVADYNDGE----------DRRTVSRPRYSPSNLFSDVFDPFSRTRSLS 75 SASR FNTNA V Y+DG R+ R R + FSDVFDPFS TRSLS Sbjct: 29 TSASRFFNTNA-VHQYDDGGDDRDLDIDRRSARSFPRRR---DDFFSDVFDPFSPTRSLS 84 Query: 76 QVLNLMDQFMENPLVAASRGMGAVSRRGWDVKEEKDALFVRMDMPGLGKEDVKVSVEQNT 135 QVLN MDQ ENP + +RG G RRGWD KE DAL + +DMPGLGKEDV+VS+EQNT Sbjct: 85 QVLNFMDQMTENPFFSGTRG-GL--RRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNT 141 Query: 136 LIIKGEGGKELENDETGRKYTSRIDLPANLYKFDEIKAEMKNGVLKVVVPKVKEDGKKDA 195 L+I+GEGGKE E++E+ R+YTSRIDLP LY+ D+IKAEMKNGVLKV VPKVKE+ + D Sbjct: 142 LVIRGEGGKEGEDEESVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADV 201 Query: 196 FQVNIN 201 FQV ++ Sbjct: 202 FQVKVD 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45203 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29966 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52071 135 6e-34 >Cs52071 Length = 230 Score = 135 bits (339), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 65/146 (44%), Positives = 101/146 (69%), Gaps = 2/146 (1%) Query: 1 MNQARSIRWNVSASGARPNPQGSFRYGSINVTDVYVLKNKPPVTIDGKMRTTLSGISFVN 60 +NQARSIR N++ASG RPNPQGS+ YG IN++ L++ ++GK R ++ +SF+ Sbjct: 84 LNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAG-QVNGKQRYAVNSVSFIP 142 Query: 61 PTTPIRLADQFKVKGVYKL-DFPKTPLTGSPRMETSVINGTYRGFMEVILQNNDTKMQSY 119 TP++LAD FK+ GV+++ P G+ ++TSV+ +RGF+E++ QN++ +QS+ Sbjct: 143 ADTPLKLADYFKIGGVFRVGSIQDQPTGGNIYLDTSVMGADFRGFIEIVFQNHENIVQSW 202 Query: 120 HMNGYAFFVVGMDYGEWTENSRGTYN 145 H++GY F+VVGM+ G WT SR YN Sbjct: 203 HIDGYNFWVVGMNGGVWTPASRNEYN 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51062 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18416 (340 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs75520 109 4e-26 >Cs75520 Length = 260 Score = 109 bits (273), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 53/112 (47%), Positives = 70/112 (62%), Gaps = 6/112 (5%) Query: 158 KSAVGTPAYIAPEVLSRKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEDPRNFRKTIGRI 217 K++ G+P Y APEV+S K Y G DVWSCGV LY + G PF+D P F+K G I Sbjct: 8 KTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALPCGTLPFDDENIPNLFKKIKGGI 67 Query: 218 MSVQYSIPDYVHVSAECRQLLSRIFVANPAKRITIPEIKQHPWFLKNFPKEL 269 Y++P H+S R L+ R+ + +P KRITIPEI+QHPWF + P+ L Sbjct: 68 ----YTLPS--HLSPGARDLIPRMLIVDPMKRITIPEIRQHPWFQAHLPRYL 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59103 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24317 (608 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10347 (316 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24788 (318 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66003 (440 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11566258 (537 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33343 110 5e-26 >Cs33343 Length = 298 Score = 110 bits (274), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 48/58 (82%), Positives = 56/58 (96%) Query: 142 TITKQRERWTEEEHNRFLEALKLYGRAWQRIEEHIGTKTAVQIRSHAQKFFSKLEKEA 199 TITKQRERWTEEEH +FLEALKL+GRAW++IEEH+GTKTAVQIRSHAQKFFSK+ +E+ Sbjct: 5 TITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRES 62 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28035 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6753 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv318 (316 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30007 (8 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17326 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15084 70 5e-15 >Cs15084 Length = 178 Score = 70.5 bits (171), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 41/114 (35%), Positives = 56/114 (49%), Gaps = 13/114 (11%) Query: 1 MDLLPLIAYLLEQNIRILLYSGDQDAKVPFTQTRLITNNLAKDLKLVPFTKYGTWYDKEQ 60 + +LP I L+ I + +YSGD D VP R N L +K T + Y + + Sbjct: 74 LTVLPSIQELMTSGISVYIYSGDTDGTVPTISIRYSINKLGAKVK----TAWYPCYIQGE 129 Query: 61 VGGWSQSFGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPP 114 VGG+ + L TF T+RGA H VP + P++AL F SFL G PP Sbjct: 130 VGGYVVGYQNL---------TFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPP 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3309 (273 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs87691 427 e-122 >Cs87691 Length = 293 Score = 427 bits (1098), Expect = e-122, Method: Compositional matrix adjust. Identities = 217/275 (78%), Positives = 223/275 (81%), Gaps = 2/275 (0%) Query: 1 MLGNPLNFSGXXXXXXXXXXX-XXFKTVALFSXXXXXXXXXXX-XXVSPADEELAKWYGP 58 MLGNPLN S FK VALFS VSP +EELAKWYGP Sbjct: 19 MLGNPLNVSSAVRTSAPGASNPSTFKPVALFSKKKAAPPAKSKPVAVSPVNEELAKWYGP 78 Query: 59 DRRIFLPEGLLDRSEIPAYLTGEVPGDYGYDPFGLSKKPEDFAKYQAYELIHARWAMLGA 118 DRRIFLPEGLLDRSEIP YLTGEVPGDYGYDPFGLSKKP+DF+KYQAYELIHARWAMLGA Sbjct: 79 DRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGA 138 Query: 119 AGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIFXXXXXXXXXXXX 178 AGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL+F Sbjct: 139 AGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVGGA 198 Query: 179 XYYRIINGLDLEDKLHPGGPFDPLGLANDPDQAALLKVKEIKNGRLAMFAMLGFFIQAYV 238 YYRI NGLDLEDKLHPGGPFDPLGLA DPDQ ALLKVKEIKNGRLAMFAMLGFF+QAYV Sbjct: 199 EYYRITNGLDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYV 258 Query: 239 TGEGPVENLAAHLSDPFGNNLLTVIAGTAERAPTL 273 TGEGPVENLA HLSDPF NNLLTVI+G AERAPTL Sbjct: 259 TGEGPVENLAKHLSDPFANNLLTVISGNAERAPTL 293 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54730 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54691 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59349 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4621 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36823 (337 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9665 79 6e-17 >Cs9665 Length = 130 Score = 79.0 bits (193), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 44/130 (33%), Positives = 67/130 (51%), Gaps = 1/130 (0%) Query: 159 KYTGDNAVVKVLRNSQILEFCIKLAIHKRLIAAHIKGRPPSYYIIGGFVFTAVSVPYLRS 218 K + ++V+VLR+ + EF I L + L+ H + PSYYI G VF ++ PYL Sbjct: 2 KKPNEKSLVRVLRDGKEHEFSITLRPLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYL-H 60 Query: 219 EYGKDYEFDAPVKLLDKHLYSMAQSVDEXXXXXXXXXXXDINIGYEEIVNTQVLSFNGKP 278 EYG+D+ +P +L ++ L + + E DIN GYE + QV NG Sbjct: 61 EYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVE 120 Query: 279 VKNLKSLATM 288 ++NLK L + Sbjct: 121 IENLKHLCQL 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41756 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103630 202 2e-54 >Cs103630 Length = 345 Score = 202 bits (515), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 103/182 (56%), Positives = 123/182 (67%), Gaps = 1/182 (0%) Query: 1 MTCYKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEGNRRALRELLF 60 +T G Y DEL+ A + +PG+GILA DES T GKRLASI +EN E NR+A R LL Sbjct: 44 LTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLV 103 Query: 61 CTPGALQYLSGVILFEETLYQKTASGKPFVDVMKEGGVLPGIKVDKGTVVLTGTDGETTT 120 PG QY+SG ILFEETLYQ T GK VDV+ E ++PGIKVDKG V L G++ E+ Sbjct: 104 TAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWC 163 Query: 121 QGLDGLGERWAKYYAAGARFAKWRAVLKIGPTEPSELAIHENAYGLARYAMICPEMALSP 180 QGLDGL R A YY GARFAKWR V+ I P PS LA+ E A+GLARYA I + L P Sbjct: 164 QGLDGLASRTAAYYQQGARFAKWRTVVSI-PNGPSALAVKEAAWGLARYAAIAQDNGLVP 222 Query: 181 LL 182 ++ Sbjct: 223 IV 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19566262 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14466256 (321 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48995 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs173106183 193 2e-51 >Cs173106183 Length = 286 Score = 193 bits (490), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 99/164 (60%), Positives = 117/164 (71%), Gaps = 11/164 (6%) Query: 14 LPPGFRFHPTDEELVVQYLKRKAYSCPLPASIIPEVDVCKADPWDLPGDL---EQERYFF 70 LPPGFRFHPTDEEL+V YL+ +A S P P SIIPEVD+ K DPW LP E+E YFF Sbjct: 9 LPPGFRFHPTDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEFGEKEWYFF 68 Query: 71 STREAKYPNGNRSNRATVSGYWKATGIDKQIVASKGNQVVGMKKTLVFYRGKPPHGSRTD 130 S R+ KYPNG R NRATVSGYWKATG DK I G++ +G+KK LVFY+G+PP G +TD Sbjct: 69 SPRDRKYPNGTRPNRATVSGYWKATGTDKAIYG--GSKYLGVKKALVFYKGRPPKGIKTD 126 Query: 131 WIMHEYRLVGAETTPQRKSSTTQSSMAQAENWVLCRIFLKKRGT 174 WIMHEYRL P R+ SM + ++WVLCRI+ KKR T Sbjct: 127 WIMHEYRL----NDPTRQPYKHNGSM-KLDDWVLCRIY-KKRQT 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54266 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62107 (104 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22814 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11397 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16567 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33921 (137 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40396 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv511 (309 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32044 (601 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32531 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12766262 (668 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20757 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34244 (91 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55636 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs61199 80 8e-18 >Cs61199 Length = 399 Score = 79.7 bits (195), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 47/117 (40%), Positives = 57/117 (48%), Gaps = 13/117 (11%) Query: 2 RVVFLGTHGS-RKECAGTGVFLPRRVGN---PPEMRKKSGCSTALLPARVVQALNLKLDD 57 R VF+ G R+ CAGTGVFLPRR GN P + RKKSG +P A+N Sbjct: 292 RPVFVAGSGCVRRGCAGTGVFLPRRYGNINNPHDSRKKSGSPNGFVPTTTTPAMNF---- 347 Query: 58 VGSQTQLHPRFNGSFAPDVDAAVKLRSSYGFACEQRRAFRAQPVMNHEIRLPQEWTY 114 RFN SF P+ A + Q+R R + NHEI LP+EWTY Sbjct: 348 -----HAQQRFNCSFGPNYVADAIIARRNALITLQKRGLRQEAARNHEIHLPKEWTY 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12663 (314 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50868 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104240 387 e-110 >Cs104240 Length = 255 Score = 387 bits (995), Expect = e-110, Method: Compositional matrix adjust. Identities = 186/248 (75%), Positives = 209/248 (84%), Gaps = 2/248 (0%) Query: 1 MGLLSNRVDKENLKPGDHIYSWRTAYIYSHHGIYVGNNEVIHFTRHGQEXXXXXXXXXXX 60 MGLLSNR+DKE+LKPGDHIYSWR AY+Y+HHGIY+G+++VIHFTR GQE Sbjct: 1 MGLLSNRIDKESLKPGDHIYSWR-AYVYAHHGIYIGDDKVIHFTRQGQEVGTGTVIDVLL 59 Query: 61 XXXXPARRHQVPCPTCTPPEGGHGVVSSCLNCFLAGGILYRFEYSVSSALFLAKARGGTC 120 R PCPTC E GHGVV SCLNCFL+GG LYRFEY VS ALFL KARGGTC Sbjct: 60 VSSGTTRL-PTPCPTCASNEVGHGVVLSCLNCFLSGGNLYRFEYGVSPALFLGKARGGTC 118 Query: 121 TLAVSDPNEIVVHRATYLLNNVFGCYNVFKNNCEDFAIYCKTGLLVIDQGTIGRSGQAVS 180 TLAV+DP+++V+HRA YLL N FGCYNVFKNNCEDFAIYCKTGLLV+DQGT+G+SGQAVS Sbjct: 119 TLAVADPDDVVIHRAKYLLENGFGCYNVFKNNCEDFAIYCKTGLLVVDQGTMGQSGQAVS 178 Query: 181 IIGGPLAAVLSTPLRLVTTNIYGMAATAVGVYCASRFAADIGMRKDVAKVEVEDLTRRLA 240 IIGGPLAAVLSTPLRLVTTN+YGMAATAV VYCASR+AADIGMR+DV K+ EDLTRRLA Sbjct: 179 IIGGPLAAVLSTPLRLVTTNVYGMAATAVTVYCASRYAADIGMRRDVVKISAEDLTRRLA 238 Query: 241 TGLIQVIE 248 TGL+QV+E Sbjct: 239 TGLLQVLE 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44349 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56723 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5751 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67005 59 7e-12 >Cs67005 Length = 126 Score = 59.3 bits (142), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 26/49 (53%), Positives = 38/49 (77%) Query: 1 MTISDGNFAVTDVNGSVIIKVKGTLLSLRDHRVLLDAAGKPIVSLQSKM 49 +T++DG+FAVTD+N +++ KVK L+SL D R LLD AG PIV++ K+ Sbjct: 65 LTLTDGSFAVTDINDNLMFKVKEKLISLHDKRTLLDPAGNPIVTITEKV 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17283 (403 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18472 736 0.0 >Cs18472 Length = 412 Score = 736 bits (1900), Expect = 0.0, Method: Compositional matrix adjust. Identities = 358/412 (86%), Positives = 377/412 (91%), Gaps = 14/412 (3%) Query: 6 MALVKPISKFST--STPNPRAPYSKV---------FRISMSATSQ---PSTGKRPSKKAA 51 MALVKPISKFST +T PR Y K I MSATS+ +T ++PSKK+ Sbjct: 1 MALVKPISKFSTIATTTKPRFSYPKATCTSLSTRFCTIKMSATSEQAAAATAQKPSKKSN 60 Query: 52 KTAIKETLLTPRFYTTDFDEMETLFNTEINKNLNQTEFEALLQEFKTDYNQTHFVRNKEF 111 KTAIKETLLTPRFYTTDFDEMETLFNTEINK LNQ EFEALLQEFKTDYNQTHFVRNKEF Sbjct: 61 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEF 120 Query: 112 KEAADKIQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR 171 KEAADK+QGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR Sbjct: 121 KEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR 180 Query: 172 HAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKEN 231 HAGFLNKGLSDFN ALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLK N Sbjct: 181 HAGFLNKGLSDFNYALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKAN 240 Query: 232 PEYQLYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLN 291 PE+Q YPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLN Sbjct: 241 PEFQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLN 300 Query: 292 DCQRTDFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINQQLI 351 DCQRT FYEGIGL+TKEFDMHVIIETNRTTARIFPAVLDVENPEFKR+LDRMVEIN++L+ Sbjct: 301 DCQRTAFYEGIGLDTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRRLDRMVEINERLL 360 Query: 352 AVGESDDIPVVKNLKKIPLIAGLASEILAAYLMPPVESGSVDFAEFEPQLVY 403 AVG +DDIP+VKNLK+IPLIA LASE+LA YLMPPV+SGSVDFAEFEP+LVY Sbjct: 361 AVGATDDIPLVKNLKRIPLIAALASELLATYLMPPVDSGSVDFAEFEPELVY 412 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26959 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23746 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33140 108 5e-26 >Cs33140 Length = 153 Score = 108 bits (271), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 57/152 (37%), Positives = 85/152 (55%), Gaps = 4/152 (2%) Query: 4 NENLPPNVIKQLAKELKNLDETPPEGIKVVVNDDDFSTIFADVEGPAGTPYENGVFRMKL 63 N NLP +IK E + L P GI ++D+ + GP +PYE GVF+++L Sbjct: 3 NSNLPRRIIK----ETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLEL 58 Query: 64 LLSHDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLIEPF 123 L ++P + PK FLTKI+HPNI G IC++ LK W+P+L +R VL+ ++ LL P Sbjct: 59 FLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 118 Query: 124 PESALNEQAGKMLLENYEEYARHARIYTGIHA 155 P+ L+E K N E A+ +T ++A Sbjct: 119 PDDPLSENIAKHWKTNEAEAVETAKEWTRLYA 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46022 (288 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60106184 76 5e-16 >Cs60106184 Length = 168 Score = 75.9 bits (185), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 35/77 (45%), Positives = 51/77 (66%) Query: 205 RIYVGNLSWGVDDLALETLFSEQGKVTEARVIYDRETGRSRGFGFVTYNSAEEVNRAIES 264 R +VG L+W D +L F G + E+++I DRETGRSRGFGFVT+ + + AIE Sbjct: 9 RCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEG 68 Query: 265 LDGVDLNGRSIRVTMAE 281 ++G +L+GR+I V A+ Sbjct: 69 MNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16682 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5689 (447 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17848 (307 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs71525 312 3e-87 >Cs71525 Length = 310 Score = 312 bits (799), Expect = 3e-87, Method: Compositional matrix adjust. Identities = 194/312 (62%), Positives = 218/312 (69%), Gaps = 9/312 (2%) Query: 1 MPRYDDRYGNTRLYVGRLSSRTCTRDLESLFSRYGRVRDVDMKHDFAFVEFSDPRDADDA 60 MPRYDDRYG TRLYVGRL+SRT +RDLE +FSRYGR+RDVDMK DFAFVEFSDPRDADDA Sbjct: 1 MPRYDDRYGGTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADDA 60 Query: 61 RYNLNGRDFDGSRIIVEFAKXXXXXXXXXXXEYLGRGPPPGSGRCFNCGIDGHWARDCKA 120 RY+LNGRD DGSRIIVEFA+ EYLGRGPPPGSGRCFNCGIDGHWARDCKA Sbjct: 61 RYSLNGRDVDGSRIIVEFAR-GGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA 119 Query: 121 GDWKNKCYRCGERGHIERNCQNSPRKLSRHGRSYSRSPVRSRHGXXXXXXXXXXXXXXXX 180 GDWKNKCYRCGERGHIERNCQNSP+KL R RSYSRSP R Sbjct: 120 GDWKNKCYRCGERGHIERNCQNSPKKL-RRPRSYSRSPSPRRGRSRSRSYSRGRSDSRSR 178 Query: 181 XXXXXXXXXIERDKRSGSPR-YRSPEPKRRSTPTSKPRKRSPTPEDSRPQERISPNVYKR 239 ++R+ SPR RSP+ +R S P+SK RKRSPTP++ PQ++ SP+ R Sbjct: 179 SPVKRDRSVERFERRTRSPRDSRSPKRRRNSPPSSKGRKRSPTPDERSPQDQRSPSPRDR 238 Query: 240 EQP---EYSQSPREKSRSPVSSERDSPVARRYRSPSDANGRSRSQ--SPRDERSPLDEDE 294 Q EYS SPR KSRSPV + + P R YRSP + NGRSRS+ SP D+ Sbjct: 239 RQANGSEYSGSPRGKSRSPV-DDAEGPEDRNYRSPPEENGRSRSRSLSPVPRDDRSPIDD 297 Query: 295 DNNSGSPRGSES 306 D+N G PRGSES Sbjct: 298 DDNHGDPRGSES 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61068 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56585 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59703 361 e-102 >Cs59703 Length = 424 Score = 361 bits (927), Expect = e-102, Method: Compositional matrix adjust. Identities = 186/301 (61%), Positives = 212/301 (70%), Gaps = 16/301 (5%) Query: 1 MANPRLRLLLPWRKFSKRDWXXXXXXXXX----------XXXXXXXXXXKTIAPLDLVDL 50 MAN RLR LL W K++ DW + DLVDL Sbjct: 1 MANQRLRALLRWTKWA--DWAIAAVGFTIIIFVLTFFFDSSSTDGAASSVNLPASDLVDL 58 Query: 51 TLVRHAKDKGAVCLDGSAPGYHFRSGFGSGSNNWVLHIEGGGWCNTVASCLIRKTTALGS 110 TL+ +AKD+GA+CLDGS PGYHF+ GFGSGSNNW+LHIEGGGWCNT+ SC RKTTALGS Sbjct: 59 TLLHNAKDRGALCLDGSLPGYHFQKGFGSGSNNWLLHIEGGGWCNTIESCSTRKTTALGS 118 Query: 111 SNYMERQVRFSGILSHDSSQNPDFFDWNKVKLRYCDGASFAGNSQ---KNETQLFFRGQR 167 SN+MERQV FSGILS D SQNPDFF WNKVK+ YCDGASFAG + KN T LFFRGQ Sbjct: 119 SNFMERQVSFSGILSSDPSQNPDFFSWNKVKIHYCDGASFAGRPESEFKNGTNLFFRGQL 178 Query: 168 IWEAVMDELLSIGLSNAKQVLLSGCSAGGLATLIHCDDFRGILPKDATVKCLADAGFFLD 227 IWEA+MDELLS+G+SNAKQ L+GCSAGGLA +IHCDDFR LP+ ATVKCLADA FFLD Sbjct: 179 IWEALMDELLSVGMSNAKQAFLTGCSAGGLAAVIHCDDFRERLPQHATVKCLADASFFLD 238 Query: 228 EKDVTGNRRIRSFYSDVVHLQGVANSLDKDCVGRMEPSQAVFLSSRIYQEHKNPSFPCQP 287 E DV GNR +RSFY DV HLQGVA SLDK+C+ RM S +F I + + P F P Sbjct: 239 ESDVQGNRTMRSFYDDVFHLQGVAKSLDKNCLSRMGNSSCLFPREFI-KNIRTPVFIVNP 297 Query: 288 S 288 + Sbjct: 298 A 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61022 (296 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65006 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25533 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68106183 139 1e-35 >Cs68106183 Length = 160 Score = 139 bits (351), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 87/167 (52%), Positives = 101/167 (60%), Gaps = 15/167 (8%) Query: 1 MEGKKRAGXXXXXXFATDLFGXXXXXXXXXXXTGIFASIFSTSSKVLGRESLRPDLTKKK 60 MEG+K+ G +LFG SIFS SKVLGRESL + +KK Sbjct: 1 MEGRKQTGSSSS--LTNELFGSKESSSSSGIF----GSIFSPPSKVLGRESLHSESMEKK 54 Query: 61 QDSGNEVWNAKPGTTE-------NALQQSEGESQSISNRDTGSFYQEQRVQPCHLSSSIY 113 DS E WN KP T +A + E ESQ + +D S YQ+QRVQPCHLSSSIY Sbjct: 55 HDSSKEAWNTKPTTPVLLLSFPGDASRSYETESQGTAYKDMSSMYQDQRVQPCHLSSSIY 114 Query: 114 YGGQDIYF-HPQNSQSSGMPSMLKKDSGEDDTGSASRGNWWQGSLYY 159 YGGQD+Y P NSQ G+ S+ KKD GEDD+GSASRGNWWQGSLYY Sbjct: 115 YGGQDVYSPRPPNSQGPGVNSVFKKD-GEDDSGSASRGNWWQGSLYY 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35266258 (339 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101535 179 5e-47 >Cs101535 Length = 297 Score = 179 bits (453), Expect = 5e-47, Method: Compositional matrix adjust. Identities = 109/279 (39%), Positives = 150/279 (53%), Gaps = 41/279 (14%) Query: 94 ETGADYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSK-DAPMFVMGVNEKEYKPDIDIV 152 + G D V+E TGVF V+I+AP K D P +V+GVN YKPD I+ Sbjct: 2 DLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPII 61 Query: 153 SNASCTTNCLAPLAKVINDRFG-------------------------------------- 174 SNASCTTNCLAP KV++ +FG Sbjct: 62 SNASCTTNCLAPFVKVLDQKFGKYQKHLQKSSLSLCSDIIHLRKRQKVTQLDDRIFPMCA 121 Query: 175 -IVEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKL 233 I++G MTT H+ T Q+ +D S +D R R+A+ NI+P+STGAAKAV VLPAL GKL Sbjct: 122 GIIKGTMTTTHSYTGDQRLLDA-SHRDLRRARSAALNIVPTSTGAAKAVALVLPALKGKL 180 Query: 234 TGMSFRVPTVDVSVVDLTVRLEKSATYDEVKAAIKEESEGKLKGILGYTEDDVVSTDFIG 293 G++ RVPT +VSVVDL V++ K ++V AA ++ ++ +LK IL ++ +V DF Sbjct: 181 NGIALRVPTPNVSVVDLVVQVSKITFAEDVNAAFRDSADNELKCILXVCDEPLVXVDFXC 240 Query: 294 DSRSSIFDAKAGIALNANFLKLVSWYDNEWGYSSRVIDL 332 S D+ + + K+ +WYDN WGYS R +D Sbjct: 241 SDVFSNRDSSLTLVMGDXMXKVXAWYDNXWGYSQRXVDF 279 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34696 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1033 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20220 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31684 (312 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32143 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43458 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46148 72 2e-15 >Cs46148 Length = 148 Score = 72.4 bits (176), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 14/153 (9%) Query: 11 LQKQLRDLCKRPVDGFSAGLVDESNVFEWSVSIIGPPDTLYDGGFFNAIMSFXXXXXXXX 70 + K+L+DL K P SAG V E ++F W +I+GPPD+ Y GG F + F Sbjct: 6 ILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKP 64 Query: 71 XXVRFTSDMWHPNVYPDGRVCISILHPPGEDPNGYELASERWTPVHTVEXXXXXXXXXXX 130 V F + ++HPN+ +G +C+ IL E+W+P T+ Sbjct: 65 PKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLT 111 Query: 131 XPNDESPANIEAAKEWREKRDEFKKKVSRCVRK 163 PN + P E A ++ + +++ +K Sbjct: 112 DPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28772 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6978 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19272 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103996 296 1e-82 >Cs103996 Length = 236 Score = 296 bits (759), Expect = 1e-82, Method: Compositional matrix adjust. Identities = 142/212 (66%), Positives = 167/212 (78%) Query: 4 CEMEKRELKHLGFVRIAAIQALVCVSNLYYYAKQNSGPLRSTVGAVEDAVTAVISPVYDK 63 E +K+EL+HLGF+RIAAIQALVCVS+LY YAK+NSGPLRS VG VE AVTAV+ PVY K Sbjct: 3 TERKKQELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQK 62 Query: 64 FKGVPDHLLVFMDKKVDEVSAKFDKHAPPVAKEVVGQAQCLVLKASKTAQTLVSEAKAGG 123 FKGVPD LLVF+DKKVDE S KFD+HAPP+AK V Q L+ AS+ AQ LVSEA+ GG Sbjct: 63 FKGVPDDLLVFLDKKVDEASRKFDEHAPPLAKRVASQVHSLIETASQKAQNLVSEAQTGG 122 Query: 124 PSAALQHAATAYKLFMLTQLVKLWFILNKVPLFHTVADMAVPTAAHWSDKYNHVVTDMSV 183 P AA+ +AA K ++T VK W+ LN LFHT+ADMAVPTAA WS KYNH+V +M+ Sbjct: 123 PRAAVHYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTK 182 Query: 184 KGYTIFGYFPLVPIDKIAKTFKQSEAGKEMDS 215 KGYT+FGY PLVPID IAK FKQSEA K+ D+ Sbjct: 183 KGYTVFGYLPLVPIDDIAKAFKQSEAPKKEDA 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49699 (91 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28507 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12502 (228 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88194 134 1e-33 >Cs88194 Length = 241 Score = 134 bits (336), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 69/106 (65%), Positives = 78/106 (73%) Query: 87 KRRLTAGQVQFLERNFEVENKLEPERKNQLAKELGLQPRQVAIWFQNRRARFKTKQLEKD 146 KR LT Q QFLE++FEVENKLEPERK QLAK+LGLQPRQVAIWFQNRRAR+KTKQLEKD Sbjct: 5 KRLLTVDQGQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKD 64 Query: 147 YDSLKASYDSLKADYDCIXXXXXXXXXXXXXXXDKALIGEKEGEKT 192 YD L+ SY+SLKADYD + DK + EKE + T Sbjct: 65 YDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKEKESKNT 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16856 (370 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21187 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16315 (306 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59233 (448 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53882 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66069 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30334 (435 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24180 93 6e-21 >Cs24180 Length = 294 Score = 92.8 bits (229), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 69/202 (34%), Positives = 107/202 (52%), Gaps = 14/202 (6%) Query: 165 IGKGSFGEILKA--CWRGTPVAVKRILPSLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLG 222 IG+G++G + KA C +A+K+I D+ + R E++LL +++H NIV+ Sbjct: 10 IGEGTYGVVYKARNCVTNETIALKKIRLEQEDEGVPSTAIR-EISLLKEMQHGNIVRLQD 68 Query: 223 AVTDKKPLMLITEYLRGGDLHQYLKEKGSLS--PSTAITFAMDIARGMAYLHNEPNVIIH 280 V +K L L+ EYL DL +++ + P TF I RG+AY H+ + ++H Sbjct: 69 VVHSEKKLYLVFEYL-DLDLKKHMDSCPDFANDPRLIKTFLYQILRGIAYCHS--HRVLH 125 Query: 281 RDLKPRNVLLVNTGADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEV-FKHRK 339 RDLKP+N LL++ + LK+ DFGL++ + V T E + Y APE+ R Sbjct: 126 RDLKPQN-LLIDRRTNALKLADFGLARAFGIP----VRTFTHEVVTLWYRAPEILLGSRH 180 Query: 340 YDKKVDVFSFAMILYEMLEGDP 361 Y VDV+S I EM+ P Sbjct: 181 YSTPVDVWSVGCIFAEMVNQRP 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16895 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35116 (336 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17966258 (411 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65606 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35611 (383 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59005 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5666259 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs82708 210 2e-56 >Cs82708 Length = 301 Score = 210 bits (534), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 144/313 (46%), Positives = 178/313 (56%), Gaps = 55/313 (17%) Query: 21 SGGAGAAANDIMLFGVRITEGAFRKSASMTNLSQYEQPQDSN------------------ 62 +GG G +IMLFGVR+ + RKS S+ NLSQYEQPQD++ Sbjct: 11 NGGGG----EIMLFGVRVVVDSMRKSVSLNNLSQYEQPQDNSSHCNNNNNNNNNNNKDDV 66 Query: 63 ADAGYAS-DDVVH--ASARSRERKRGVPWTEEEHRLFLLGLQKVGKGDWRGISRNFVKTR 119 A AGYAS DD VH +S SRERKRGVPWTEEEH+LFLLGLQKVGKGDWRGISRNFVKTR Sbjct: 67 AAAGYASADDAVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTR 126 Query: 120 TPTQVASHAQKYFLXXXXXXXXXXXSSLFDITADTFMGSTILEEDQVHQETVSPPQLHSH 179 TPTQVASHAQKYFL SSLFDIT D+ + +T +EE+ V + +P Q + Sbjct: 127 TPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDS-VAATPMEEELVDHQDHNPSQSYPL 185 Query: 180 L-------NGSAGGFPVPTFPVTMAPVVLPVASNGSMEILTLGQSNQ-----AKGPTKXX 227 L + +GGF + + PVVLPV ME LTLGQ++Q A + Sbjct: 186 LPPTPAETSNKSGGFSM----MPALPVVLPVPIENPMENLTLGQNSQRTAGEATRLIRPV 241 Query: 228 XXXXXXXXXXSSKMADLNLNIPSTADXXXXXXXXXXXXXXXXXXXXATRHSSAFQAMSES 287 SS ++DLNLN+ D ++RH SAFQ M ++ Sbjct: 242 PVPVLPAAQPSSTVSDLNLNLNLAVD-----------PPPLSQRESSSRH-SAFQVM-QT 288 Query: 288 FNSSTGDNIISVA 300 FN+ ++IISVA Sbjct: 289 FNNGDSNSIISVA 301 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11099 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41343 236 8e-65 >Cs41343 Length = 166 Score = 236 bits (603), Expect = 8e-65, Method: Compositional matrix adjust. Identities = 112/159 (70%), Positives = 132/159 (83%) Query: 3 GDRKIGVAMDFSSSSKLALQWAIDNLADKGDLLYIIHIKSSSGDESRDVLWTTHGSPLIP 62 +R IGVA+DFS SKLAL+WAIDNL +KGD LYIIHIK DESR++LW+ GSPLIP Sbjct: 4 NNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQDDESRNLLWSDTGSPLIP 63 Query: 63 LTEFRQPEIMKKYGVKTDIEVLDTLDTASRQKEVKIVTKLYWGDARDKLCEAVEDLKLDS 122 L EFR E+MK+Y V D +VLD LD AS+QK V +V KLYWGDARDKLCEAVE +KLDS Sbjct: 64 LEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDS 123 Query: 123 LVMGSRGLSTIRRILLGSVTNYVMTNATCPVTIVKDPSS 161 LVMGSRGL TI+R+LLGSV+N+V+ NA+CPVTIVKDPS+ Sbjct: 124 LVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPSA 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57523 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34185 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48014 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26028 (531 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11919 494 e-142 >Cs11919 Length = 269 Score = 494 bits (1273), Expect = e-142, Method: Compositional matrix adjust. Identities = 231/269 (85%), Positives = 251/269 (93%) Query: 263 LGVEVTVIDPADTEALKSALDKNNVTLFFTESPTNPFLRCVDIELVSELCHRKGALVCID 322 +G+ TVIDPAD E L++AL+ NNV+LFFTESPTNPFLRCVD++LVS+LCH+KGA+VCID Sbjct: 1 MGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCID 60 Query: 323 STFATPLNQKTLSLGADLVLHSATKYIAGHNDVIAGCISGSEKLVSTIRNLHHVLGGVLN 382 TFATPLNQK LSLGADLVLHSATK+I GHNDV+AG ISGSEKLV+ IRNLHHVLGG LN Sbjct: 61 GTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSEKLVTQIRNLHHVLGGALN 120 Query: 383 PNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKCVYYPGLPSHPEHHIAKRQMT 442 PNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVK V+YPGL SHPEHHIA +QMT Sbjct: 121 PNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMT 180 Query: 443 GFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLNQSERAKYG 502 GFGGVVSFEVDGDLT TIKF+DALKIPYIAPSFGGCESIVDQPAIMSYWDL+QSER KYG Sbjct: 181 GFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYG 240 Query: 503 IQDNLVRFSFGVEDFEDLKADILQALESI 531 I DNLVRFSFGVEDFEDLKAD+LQAL +I Sbjct: 241 IMDNLVRFSFGVEDFEDLKADVLQALHAI 269 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23825 (355 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8261 (113 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51672 (301 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3110 (348 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50427 (141 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49875 (448 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65601 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10366265 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27828 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30991 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13648 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37289 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5564 (54 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44816 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40410 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25362 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47251 (261 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs57118 73 3e-15 >Cs57118 Length = 242 Score = 72.8 bits (177), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 56/218 (25%), Positives = 96/218 (44%), Gaps = 7/218 (3%) Query: 36 MLRLGLQPSLQTYTLLLSCCTEARSSFDMGFCGELMAVTGHPAHMFLLSMPAAGPDGQNV 95 M +L ++P++ T++ +L+ C+ S D E + + + + + D N+ Sbjct: 1 MHKLKIKPNVVTFSAILNACSRCNSFEDASMLLEELRLFDNQVYGVAHGLLMGYRD--NI 58 Query: 96 RDHVSKFLDLMHSEDRESKRGLVDAVVDFLHKSGLKEEAGSVWEVAAQKNVYPDAVREKS 155 D + D + +A+ D L G K A V ++ V+ + E Sbjct: 59 WVQALSLFDEVKLMDSSTASAFYNALTDMLWHFGQKRGAQLVVLEGKRRQVWENVWSE-- 116 Query: 156 SCYWLINLHFMSDGTAVTALSRTLAWFHREMLVSGTVPSRIDIVTGWGRRSRVTGASLVR 215 SC ++LH MS G A + L H + +P + I+TGWG+ S+V G +R Sbjct: 117 SC---LDLHLMSSGAARAMVHAWLLNIHSIVFEGHELPKLLSILTGWGKHSKVVGDGALR 173 Query: 216 QAVQELLHIFSFPFFTENGNSGCFVGRGEPLGRWLLQS 253 +AV+ LL PF+ N N G F+ G + WL +S Sbjct: 174 RAVEVLLTGMGAPFWVANCNLGRFISTGPMVASWLRES 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61192 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1888 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45736 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42552 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs72108 238 3e-65 >Cs72108 Length = 189 Score = 238 bits (607), Expect = 3e-65, Method: Compositional matrix adjust. Identities = 110/179 (61%), Positives = 141/179 (78%), Gaps = 2/179 (1%) Query: 3 TFAGTTQKCKACEKTVYLVDELTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPH 62 +F GT QKCK CEKTVY V++L+AD VYHK+CF+C HCKGTLKLSNYSS EGVLYCKPH Sbjct: 2 SFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH 61 Query: 63 FDQLFKMTGSLDKSFEGAPKTVRSV--DQGQTNSKVSSMFAGTQEKCVACKKTVYPIEKV 120 F+QLFK +G+ +K+F+ K+ + + ++ SK +SMF+GTQEKC +C KTVYP+EKV Sbjct: 62 FEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCASCSKTVYPLEKV 121 Query: 121 GVDGTSYHKACFRCTHGGCTISPSNYIAHEHRLYCRHHHSQLFKEKGNFSQLDKQEQVK 179 V+ +YHK CF+C+HGGC+ISPSNY A E LYC+HH SQLFKEKG+++ L K +K Sbjct: 122 AVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMK 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58338 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666265 (378 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1866265 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv966258 (356 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs113106184 666 0.0 >Cs113106184 Length = 384 Score = 666 bits (1718), Expect = 0.0, Method: Compositional matrix adjust. Identities = 314/343 (91%), Positives = 331/343 (96%) Query: 14 ETTEKVIVEYIWVGGSGMDLRSKARTLSGPVSDPAKLPKWNYDGSSTGQAPGEDSEVILY 73 E+T+K+I EYIW+GGSGMD+RSKARTL GPVSDP+KLPKWNYDGSSTGQAPGEDSEVILY Sbjct: 42 ESTDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY 101 Query: 74 PQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRCNAAKIFSHPDVAAEVPWYGIEQEYT 133 PQAIFKDPFRRGNNILVMCD YTPAGEPIPTNKR AAKIFSH DV AE PWYGIEQEYT Sbjct: 102 PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYT 161 Query: 134 LLQKEVKWPIGWPVGGFPGPQGPYYCGIGADKAWGRDIVDAHYKACLYAGINISGINGEV 193 LLQK+VKWP+GWP+GG+PGPQGPYYCG+GADKAWGRDIVD+HYKACLYAGINISGINGEV Sbjct: 162 LLQKDVKWPLGWPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV 221 Query: 194 MPGQWEYQVGPSVGISAGDELWVSRYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS 253 MPGQWE+QVGP+VGISAGD+LWV+RYILERITEIAGVVLSFDPKPIQGDWNGAGAH NYS Sbjct: 222 MPGQWEFQVGPAVGISAGDQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHANYS 281 Query: 254 TKSMRNDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA 313 TKSMRNDGGFEVIKKAIEKLGLRH EHIAAYGEGNERRLTG+HETADINTF WGVANRGA Sbjct: 282 TKSMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA 341 Query: 314 SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 356 SIRVGRDTEK GKGYFEDRRPASNMDPYVVTSMIAETTILWKP Sbjct: 342 SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 384 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55845 (484 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37079 207 2e-55 >Cs37079 Length = 176 Score = 207 bits (527), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 108/180 (60%), Positives = 126/180 (70%), Gaps = 11/180 (6%) Query: 298 IMFSPTQGVPPPNPEWNGYQAPLYXXXXXXXXXXXXXAFVINNTATDANVYGHHQQQQQS 357 +M+SPT GVP N EWNGYQ+PLY +VINN NV HQ Q Sbjct: 1 MMYSPTPGVPSQNSEWNGYQSPLYPQERSVQSAP---TYVINNNPLVDNVQIIHQPQM-- 55 Query: 358 LIEDFPERPGQPECSYFLKTGDCKFRAACKYHHPKNRIPKSPPCTLSDKGLPLRPDQNIC 417 L+ +FPERPGQPECSYFL+TGDCK+++ CKYHHPKNRIPKSPPCTLSDKGLPLRP QN+C Sbjct: 56 LVGEFPERPGQPECSYFLRTGDCKYKSNCKYHHPKNRIPKSPPCTLSDKGLPLRPGQNVC 115 Query: 418 THYNRYGICKFGPACKFDHPVNYGNSASAPSAESGQDQPPPFGGSVTVDGV-RPGSGNGN 476 ++Y+RYGICKFGPACK+DHP++ SAE G D PP FG S T G+GNGN Sbjct: 116 SYYSRYGICKFGPACKYDHPIH-----PDASAEYGLDPPPSFGDSTTRQETGMAGTGNGN 170 Score = 92.4 bits (228), Expect = 8e-21, Method: Compositional matrix adjust. Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 3/95 (3%) Query: 175 FPERPGQTECKYYLRTGGCKFGKACRYNHTKAKPSAVPVLELNFLGLPIRMGEKECPYYM 234 FPERPGQ EC Y+LRTG CK+ C+Y+H K + P L+ GLP+R G+ C YY Sbjct: 60 FPERPGQPECSYFLRTGDCKYKSNCKYHHPKNRIPKSPPCTLSDKGLPLRPGQNVCSYYS 119 Query: 235 RTGSCKYGANCRFN---HPDPTAAGGYEPPSGYGN 266 R G CK+G C+++ HPD +A G +PP +G+ Sbjct: 120 RYGICKFGPACKYDHPIHPDASAEYGLDPPPSFGD 154 Score = 80.1 bits (196), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 37/79 (46%), Positives = 49/79 (62%), Gaps = 3/79 (3%) Query: 125 QYPVRPDAVDCSFYLRTGTCKFGSNCKFNHPIRRKNQVAXXXXXXXXXXXFPERPGQTEC 184 ++P RP +CS++LRTG CK+ SNCK++HP KN++ P RPGQ C Sbjct: 59 EFPERPGQPECSYFLRTGDCKYKSNCKYHHP---KNRIPKSPPCTLSDKGLPLRPGQNVC 115 Query: 185 KYYLRTGGCKFGKACRYNH 203 YY R G CKFG AC+Y+H Sbjct: 116 SYYSRYGICKFGPACKYDH 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39691 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37887 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 67 2e-13 >Cs36939 Length = 275 Score = 66.6 bits (161), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 5/62 (8%) Query: 76 LIVKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLKRK-----LIRMGINPDKHHVRQS 130 +I+ L ALLGNRW+ IA LP RTDN++KNYWN+HLK+K L G + D R Sbjct: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKVRKLQLAAAGCSEDNSQYRDE 60 Query: 131 IS 132 ++ Sbjct: 61 LA 62 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2500 (455 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24412 99 1e-22 >Cs24412 Length = 388 Score = 98.6 bits (244), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 82/291 (28%), Positives = 129/291 (44%), Gaps = 25/291 (8%) Query: 157 LGRIINVIGEPIDERGDIKTDHFLPIHREAPSFVDQATEQQILVTGIKVVDLLAPYQRGG 216 LGRI N G+PID I + +L I + + ++ ++++ TGI +D++ RG Sbjct: 2 LGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQ 61 Query: 217 KIGLFGGAGVGKT------------VLIMELINNVAK--AHGGFS-VFAGVGERTREGND 261 KI LF AG+ V +E +N+ + F+ VFA +G Sbjct: 62 KIPLFSAAGLPHNEIAAQICRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVNMETAQF 121 Query: 262 LYREMIESGVIKLGEKQSESKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLL 321 R+ E+G S + L N+P R LT AE+ G+ VL+ Sbjct: 122 FKRDFEENG--------SMERVTLFLNLANDPTIERIITPRIALTTAEYLAYECGKHVLV 173 Query: 322 FIDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERI--TTTKKGSITSVQAIY 379 + ++ + A EVSA +P GY + TDL + ER +KGSIT + + Sbjct: 174 ILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLAQIYERAGRIEGRKGSITQIPILT 233 Query: 380 VPADDLTDPAPATTFAHLDATTVLSRQISELGIYPAVDPLDSTSRMLSPHI 430 +P DD+T P P T + + RQ+ IYP ++ L S SR++ I Sbjct: 234 MPNDDITHPTPDLTGYITEGQIYIDRQLQNRQIYPPINVLPSLSRLMKSAI 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63497 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs194106183 269 2e-74 >Cs194106183 Length = 182 Score = 269 bits (687), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 123/179 (68%), Positives = 145/179 (81%) Query: 1 MASSMLSSATVATINRXTPDQANMVAPSTGLKSLSTFPGTRKANTDITSVASNGGRVRCM 60 MASSM+SS TVAT NR + QA+MVAP TGLKS S FP T+K N DITS+ASNGGRV+CM Sbjct: 1 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCM 60 Query: 61 KVWPTEGVMKFETLSYLPPLNDEQLCKEVDYLLRMNWVPCLEFTKLYPYPHREHNRSPGY 120 KVWP G+ KFETLSYLPPL+DE L KE+ YLLR W+PCLEF + +REH+ SPGY Sbjct: 61 KVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGY 120 Query: 121 YDGRYWTMWKLPMFGCTDSAQVIKEVQEARTAYPNAHIRIIGFDNTRQVQCIAFIAYKP 179 YDGRYWTMWKLPM+GCTD+ QV+KEV E + YP++ +RIIGFDN RQVQCI+F+A KP Sbjct: 121 YDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63497 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs194106183 269 2e-74 >Cs194106183 Length = 182 Score = 269 bits (687), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 123/179 (68%), Positives = 145/179 (81%) Query: 1 MASSMLSSATVATINRXTPDQANMVAPSTGLKSLSTFPGTRKANTDITSVASNGGRVRCM 60 MASSM+SS TVAT NR + QA+MVAP TGLKS S FP T+K N DITS+ASNGGRV+CM Sbjct: 1 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCM 60 Query: 61 KVWPTEGVMKFETLSYLPPLNDEQLCKEVDYLLRMNWVPCLEFTKLYPYPHREHNRSPGY 120 KVWP G+ KFETLSYLPPL+DE L KE+ YLLR W+PCLEF + +REH+ SPGY Sbjct: 61 KVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGY 120 Query: 121 YDGRYWTMWKLPMFGCTDSAQVIKEVQEARTAYPNAHIRIIGFDNTRQVQCIAFIAYKP 179 YDGRYWTMWKLPM+GCTD+ QV+KEV E + YP++ +RIIGFDN RQVQCI+F+A KP Sbjct: 121 YDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49941 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6838 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43779 (588 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs21714 146 7e-37 >Cs21714 Length = 286 Score = 146 bits (368), Expect = 7e-37, Method: Compositional matrix adjust. Identities = 88/258 (34%), Positives = 134/258 (51%), Gaps = 15/258 (5%) Query: 115 KMHPPHCGTTDT-----GTCIGPTAGQMAFLLSGFGLLVIGAAGIRPCNLAFGADQFNPE 169 K+ PH D G+C + QM +L + + GAAGIRPC +FGADQF+ Sbjct: 2 KVFMPHQDNCDRISQLLGSCEPAKSWQMLYLYTVLYITGFGAAGIRPCVSSFGADQFDER 61 Query: 170 TESGKRGISSFFNWYYFTYTFAMMVSLTVIVYVQSDVSWSLGLAIPTLLMLLSCALYFMG 229 ++ K + FFN++Y + T +V+ T++VY+Q + W + M +S L+F+G Sbjct: 62 SKDYKTHLDRFFNFFYLSVTVGAIVAFTLVVYIQMEHGWGSAFGALAIAMGISNMLFFIG 121 Query: 230 TRIYVKVKPEGSPLKNVAHVIVAAVKKRRLELPGQPWLSLFNHIPANSI----NSKLPHT 285 T +Y P GSPL VA V+VAA +KR + L+ +P + K+ HT Sbjct: 122 TPLYRHRLPGGSPLTRVAQVLVAAFRKRHAAFSSSELIGLYE-VPGKHSAIKGSGKIDHT 180 Query: 286 DQFRFLSKGAILTPEVQINSDGSAANPWRLSSMQKVEEVKCVIRVIPIWAAGIIYYVALV 345 D FR L K A+ E IN +PW+L ++ +VEE K ++R++PI A I+ V L Sbjct: 181 DDFRCLDKAALELKEDVIN-----PSPWKLCTVTQVEESKTLVRLVPIPACTIMLNVNLT 235 Query: 346 QQSTYVVFQALQSDRRLG 363 + T V QA + +G Sbjct: 236 EFLTLSVQQAYTMNTHMG 253 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24280 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9168 (319 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3293 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4726 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30474 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45661 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20666261 (190 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41328 (249 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66022 (324 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49361 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs89949 337 8e-95 >Cs89949 Length = 240 Score = 337 bits (864), Expect = 8e-95, Method: Compositional matrix adjust. Identities = 172/247 (69%), Positives = 190/247 (76%), Gaps = 9/247 (3%) Query: 1 MTLVGLFLVGFLSMVSSVHGQG-WINAHATFYXXXXXXXXXXXXXXYGNLYSEGYGTNTA 59 M L + VGFLS+VSSV G G WINAHATFY YGNLYS+GYGTNTA Sbjct: 1 MALWVILCVGFLSLVSSVQGYGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTA 60 Query: 60 ALSTALFNNGLSCGSCYEIKCVNDGKWCLPGSIVITATNFCXXXXXXXXXXGGWCNPPLH 119 ALSTALFNNGLSCG+C++I C ND +WCL GSI++TATNFC GGWC+PP H Sbjct: 61 ALSTALFNNGLSCGACFQIMCANDPQWCLRGSIIVTATNFCPP--------GGWCDPPNH 112 Query: 120 HFDLSQPVFQHIAQYRAGIVPVSYXXXXXXXXXXXXFTINGHSYFNLVLITNVGGAGDVH 179 HFDLSQPVFQHIAQYRAGIVPV Y FTINGHSYFNLVLITNVGGAGDVH Sbjct: 113 HFDLSQPVFQHIAQYRAGIVPVIYRRVRCKRNGGIRFTINGHSYFNLVLITNVGGAGDVH 172 Query: 180 AVAIKGSRTGWQSMSRNWGQNWQSNTYLNGQSLSFKVTTSDGHTIVSYNCVPAHWSFGQT 239 AV+IKGSRT WQ MSRNWGQNWQSN+YLNGQSLSF VTTS+GH++VSYN P +WSFGQT Sbjct: 173 AVSIKGSRTRWQPMSRNWGQNWQSNSYLNGQSLSFVVTTSNGHSVVSYNVAPPNWSFGQT 232 Query: 240 FSGAQFR 246 ++G QFR Sbjct: 233 YTGRQFR 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40999 (448 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44944 (311 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18644 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13466261 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60159 100 8e-24 >Cs60159 Length = 242 Score = 100 bits (249), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 53/153 (34%), Positives = 80/153 (52%), Gaps = 7/153 (4%) Query: 3 YLKAVVLEGLRRHPPGHFVLPHSVTEDVSFEGYDIPKNATVNFIVSELNWNPKIWENPME 62 YL+A++ E LR +P G + P ED + GY +P + ++ +P++WENP Sbjct: 85 YLQAIIKETLRLYPAGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPRVWENPSA 144 Query: 63 FKPERFLDINGDGDHGDEGEAFDITGSREIKMMPFGAGRRICPGYGLAMLHLEYFVANLV 122 F+PERFL G G H D D+ G ++ +++PFG+GRR CPG A+ L +A L+ Sbjct: 145 FQPERFLP--GHGAHAD----VDVRG-QQFELIPFGSGRRSCPGASSALQVLHLTLARLL 197 Query: 123 WNFDWKAVEGDEVDLSEKLEFTVVMKNPLQAHL 155 F+ VD+SE T+ PL L Sbjct: 198 HAFELATPLDQPVDMSESPGLTIPKATPLXXSL 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4687 (358 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23541 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64843 (312 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43225 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs49233 92 6e-21 >Cs49233 Length = 326 Score = 91.7 bits (226), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 75/242 (30%), Positives = 108/242 (44%), Gaps = 18/242 (7%) Query: 6 RMLVLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGE----SW 61 R L LIC+ + T +D AL + +SL A W G DPCG+ W Sbjct: 5 RTLSLICIFSLILTAAQSKTLKRDVKALNEIKASLGWRVVYA-WV--GDDPCGDGDLPPW 61 Query: 62 QGITCKGS----RVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLP--P 115 G+TC VTE+E+ + + G +T+L + LD+ NN L IP Q+ Sbjct: 62 SGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLK 121 Query: 116 NLQRLNLAGNGFNGGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSL 175 L+ LNL N IP I + L +L++S N +G++ + L L L N L Sbjct: 122 RLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRL 181 Query: 176 TGDLPESFSSLSSITTMFLQNNQFTGSINVL----ASLP-LETLNVANNHFTGWIPESLK 230 TG +P L + + + NN G+I L S P L L + NN+ TG +P L Sbjct: 182 TGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLA 241 Query: 231 TL 232 L Sbjct: 242 NL 243 Score = 62.0 bits (149), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 5/130 (3%) Query: 80 RLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLP-----PNLQRLNLAGNGFNGGIPYS 134 RLTG + +L L + +LD+ NN+L I + P L+ L L N GG+P Sbjct: 180 RLTGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQ 239 Query: 135 ISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFSSLSSITTMFL 194 ++ + +L+ L +SHN++ G + + + LT L N +G +P++F + M++ Sbjct: 240 LANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHPFLKEMYI 299 Query: 195 QNNQFTGSIN 204 + N F +N Sbjct: 300 EGNAFRPGVN 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62388 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73025 337 4e-95 >Cs73025 Length = 382 Score = 337 bits (864), Expect = 4e-95, Method: Compositional matrix adjust. Identities = 169/171 (98%), Positives = 170/171 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEAEA 171 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+ Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES 171 Score = 337 bits (864), Expect = 4e-95, Method: Compositional matrix adjust. Identities = 169/171 (98%), Positives = 170/171 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 137 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 196 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEAEA 171 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+ Sbjct: 197 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES 247 Score = 337 bits (864), Expect = 4e-95, Method: Compositional matrix adjust. Identities = 169/171 (98%), Positives = 170/171 (99%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 213 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 272 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEAEA 171 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+ Sbjct: 273 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES 323 Score = 305 bits (781), Expect = 2e-85, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 289 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 348 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 152 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 349 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9909 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60148 (613 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60255 325 1e-90 >Cs60255 Length = 235 Score = 325 bits (832), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 156/259 (60%), Positives = 187/259 (72%), Gaps = 24/259 (9%) Query: 316 MQPDWDMFHSLHPAAEYHGAARAVGGCAIYVSDKPGHHNFELLRKLVLPDGSVLRAQLPG 375 MQPDWDMFHSLHP AEYHGAARAVGGCAIYVSDKPG H+F LLRKLVLPDGS+LRA+LPG Sbjct: 1 MQPDWDMFHSLHPMAEYHGAARAVGGCAIYVSDKPGQHDFNLLRKLVLPDGSILRAKLPG 60 Query: 376 RPTRDCLFADPARDGTSLLKIWNVNKCSGVVGVFNCQGAGWCKIEKKTRVHDTSPDTLTG 435 RPTRDCLF+DPARDG SLLKIWN+N +GVVGVFNCQGAGWC++ KK +HD P T TG Sbjct: 61 RPTRDCLFSDPARDGKSLLKIWNLNDFTGVVGVFNCQGAGWCRVGKKNLIHDEQPGTTTG 120 Query: 436 SVCAADVDQIAHVAGTNWKGDVVVYAYKSGEVVRLPEGASLPVTLKVLEFEVFHFCPLKE 495 + A DVD + VAG W GD + Y++ GEV LP+ A+LP+TLK E+EV+ P+KE Sbjct: 121 FIRAKDVDYLPRVAGDEWTGDAIAYSHLGGEVAYLPKNATLPITLKSREYEVYTVVPVKE 180 Query: 496 IATNISFAPIGLLDMLNSGGAVEQFEVHMACEKPELFDGEIPFELSTSLSENRSPTATIA 555 +++ FAPIGL+ M NSGGA++ E+ +E SE TAT+ Sbjct: 181 LSSGTRFAPIGLVKMFNSGGAIK----------------EVRYE-----SEG---TATVD 216 Query: 556 LTARGCGRFGAYSSQRPLK 574 + RGCG GAYSS RP + Sbjct: 217 MKVRGCGELGAYSSARPQR 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17974 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8552 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6843 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27166260 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3566262 (359 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64198 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96763 62 3e-12 >Cs96763 Length = 192 Score = 62.4 bits (150), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Query: 1 MITEAIVALKERTGSSQYAITKFIEEKHK-KLPSNFRXXXXXXXXXXXASEKLVKVKNSY 59 MITEA++AL++++GSS YAI K++EEKHK +LP+NFR A L+K++ SY Sbjct: 57 MITEALMALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASY 116 Query: 60 KL 61 KL Sbjct: 117 KL 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17666257 (357 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26451 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99128 450 e-128 >Cs99128 Length = 302 Score = 450 bits (1157), Expect = e-128, Method: Compositional matrix adjust. Identities = 216/308 (70%), Positives = 251/308 (81%), Gaps = 9/308 (2%) Query: 1 MRDFPSCFGENGVQVADSSSS---NATKTAQNLVTCVYQCRLRGRSCLITVVWSKNLMGQ 57 MRDFPSCFGENGVQVADSSSS ATK AQNLV CVYQC+L GR LI V W+KNLMGQ Sbjct: 1 MRDFPSCFGENGVQVADSSSSSSSGATKAAQNLVACVYQCKLHGRLVLINVTWTKNLMGQ 60 Query: 58 GLSVGIDDSANQSLCKVDIKPWLFSKRKGSKSLEANSSKIDIYWDFSSAKFGSGPEPLEG 117 GL V +DDS NQ LCKV+IKPWLFSKRKGSK+LE +SS++DIYWD S A+FGSGPEP+EG Sbjct: 61 GLCVAVDDSTNQCLCKVEIKPWLFSKRKGSKNLEVDSSRVDIYWDLSGARFGSGPEPVEG 120 Query: 118 FYVGVVFDRQMVLLLGDLRKEAFKKTNATPVPSNAVFIAKRENIFGKKVFRTKAQFCDNG 177 +Y+ V ++++MVLLLGDL+KEA++K NA P+ SN +FIAKRE+IFGKK + KAQFCD G Sbjct: 121 YYLAVAYNQEMVLLLGDLKKEAYRKINAAPINSNPIFIAKREHIFGKKFYGAKAQFCDKG 180 Query: 178 QIHDVMIECDTIGVTDPCLVIRVDSKIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNW 237 HD+ IECDTI V DPCLVIR+DSK VMQVK+L+WKFRGNHTI VDGL VEVFWDVHNW Sbjct: 181 LTHDITIECDTIDVKDPCLVIRIDSKTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNW 240 Query: 238 LFSTTLGNAVFLFKTCLSAEKLWASQPLSDPNVFRDPNVVTLSCSQRFRDSQSQALSFSL 297 LF +GNAVF+F+TCLSAEK WA Q DP+V+T S SQRF+D+Q Q L FSL Sbjct: 241 LFGNAMGNAVFMFQTCLSAEKFWACQSAF------DPSVLTWSYSQRFKDNQLQGLGFSL 294 Query: 298 ILHALKNE 305 +L A KNE Sbjct: 295 LLSAWKNE 302 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10638 (428 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs53149 525 e-151 >Cs53149 Length = 737 Score = 525 bits (1352), Expect = e-151, Method: Compositional matrix adjust. Identities = 242/391 (61%), Positives = 304/391 (77%), Gaps = 2/391 (0%) Query: 22 MCKKDDAPNPVINACKGFYCDAFSPNKPYKPRIWTEAWSGWFTEFGGTIHRRPVQDLAFG 81 MCK+DDAP+PVIN C GFYC+ F PN+ YKP++WTEAW+GWFTEFG + RP +DL F Sbjct: 229 MCKQDDAPDPVINTCNGFYCEKFVPNQNYKPKMWTEAWTGWFTEFGSAVPTRPAEDLVFS 288 Query: 82 VARFIQNGGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPIDEYGLIRQPKYGHLKELH 141 VARFIQ+GGSF+NYYMYHGGTNFGR++GG F+ TSYDYDAPIDEYGL+ +PK+GHL+ LH Sbjct: 289 VARFIQSGGSFINYYMYHGGTNFGRTSGG-FVATSYDYDAPIDEYGLLNEPKWGHLRGLH 347 Query: 142 KAIKLCEHAVVSADPTVISLGSYQQAHVFSSGRGNCAAFLSNYNPKSSARVIFNNVHYDL 201 KAIKLCE A+VS DPTV SLG Q+AHVF+S G CAAFL+NY+ SA+V F N YDL Sbjct: 348 KAIKLCEPALVSVDPTVKSLGENQEAHVFNSISGKCAAFLANYDTTFSAKVSFGNAQYDL 407 Query: 202 PAWSISILPDCRTVVFNTARVGVQTSHMRMFPTNSKLHSWETYGEDISSLGSSGTMTAGG 261 P WSIS+LPDC+T VFNTARVGVQ+S + P + SW++Y E+ +S T T G Sbjct: 408 PPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVINAF-SWQSYIEETASSTDDNTFTKDG 466 Query: 262 LLEQINITRDSTDYLWYMTSVNIDSSESFLRRGQTPTLTVQSKGHAVHVFINGQYSGSAY 321 L EQ+ +T D++DYLWYMT VNI S+E FL+ GQ P LT+ S GHA+ VFINGQ SG+ Y Sbjct: 467 LWEQVYLTADASDYLWYMTDVNIGSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVY 526 Query: 322 GTRENRKFTYTGAANLHAGTNRIALLSIAVGLPNVGLHFETWKTGILGPVLLHGIDQGKR 381 G+ EN K T++ L AG N+I+LLS +VGLPNVG HFE W G+LGPV L G+++G R Sbjct: 527 GSLENPKLTFSKNVKLRAGVNKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTR 586 Query: 382 DLSWQKWSYQVGLKGEAMNLVSPNGVSAIEW 412 D+S QKW+Y++GLKGEA++L + +G S++EW Sbjct: 587 DISKQKWTYKIGLKGEALSLHTVSGSSSVEW 617 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28330 (238 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101477 308 5e-86 >Cs101477 Length = 242 Score = 308 bits (788), Expect = 5e-86, Method: Compositional matrix adjust. Identities = 159/204 (77%), Positives = 171/204 (83%), Gaps = 8/204 (3%) Query: 43 KRGFSETV-DLKLNLLSKDSVA-DQAEKMKEKSA-LPPSNDPAKPPAKAQVVGWPPVRSF 99 KRGF++TV DLKLNL +K+S D EK K KSA + D +KPPAK+QVVGWPPVRSF Sbjct: 39 KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF 98 Query: 100 RKNILTVQKNX-----XXXXXXXXXXXFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKM 154 RKNI+ VQK+ FVKVSMDGAPYLRKVDLK+YKSYQELSDALGKM Sbjct: 99 RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM 158 Query: 155 FSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKR 214 FSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPW+MFV+SCKR Sbjct: 159 FSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKR 218 Query: 215 LRIMKGSEAIGLAPRAVEKCKNRS 238 LRIMKGSEAIGLAPRAVEKCKNRS Sbjct: 219 LRIMKGSEAIGLAPRAVEKCKNRS 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58440 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47769 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4978 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33375 (346 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58092 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27451 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53631 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38009 (327 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42304 (364 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16453 137 1e-34 >Cs16453 Length = 223 Score = 137 bits (346), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 88/228 (38%), Positives = 130/228 (57%), Gaps = 25/228 (10%) Query: 42 TRPIQSSSLTSISVGESATFDPSLK-------RISMGELLAATRNFASDGIIGDGSFGMV 94 TRP ++ S T S S P L+ +I E+++AT +F ++ IG G G V Sbjct: 1 TRPKENDSQTQQS---SFGNTPGLRSVLTFEGKIVYEEIISATNDFNAEHCIGKGGHGSV 57 Query: 95 YKACLSNGVTVAVKKL-SP----DAFQGFREFRAETETLAKLQHRNIVQILGYCVSGSDR 149 Y+A + +G AVKK SP +FQ EF E + L +++HRNIV+ +C Sbjct: 58 YRAKVPSGEIFAVKKFHSPLPGEMSFQQ-EEFLNEIQALTEIRHRNIVKFYCFCSHPKHS 116 Query: 150 VLIYEFIEKGSLDQWLHDTSEDQQLSTPRLPLSWETRLKIIRGVADGLSYLHN-LDTPII 208 +IYE++E GSLD+ L + + ++L W RL +I+GVAD L YLHN PI+ Sbjct: 117 FIIYEYLESGSLDKILCNDASAKELG-------WTQRLNVIKGVADALFYLHNNCFPPIV 169 Query: 209 HRDIKASNVLLDSEFEPHIADFGLARRIEWSHSHVSTQVAGTMGYMPP 256 HRDI + NVLLD +E H++DFG+A+ + S+ S ++AGT GY+ P Sbjct: 170 HRDISSKNVLLDLGYEAHVSDFGIAKFLNPDSSNWS-ELAGTHGYVAP 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65345 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35660 (272 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs105558 67 1e-13 >Cs105558 Length = 358 Score = 67.4 bits (163), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 46/125 (36%), Positives = 64/125 (51%), Gaps = 8/125 (6%) Query: 106 EHICGRPLGLRFDKKTGDLYIADAYFGLQVVEPNGGLATPLVTEVEGRRLLFTNDMDIDE 165 +HI + L K GD+ I D+ GL V G +V + F ND+ ID Sbjct: 89 KHIDSQSLLGLTTTKEGDVVICDSKKGLFKVTEEG-------VKVLDPDVRFANDV-IDA 140 Query: 166 VEDVIYFTDTSTDFHRRQFMAALLSGDNTGRLMKYDKSSKEVTVLLRGLAFANGVAMSKD 225 + +YFT +ST + F + G+ G+L+KYD S + TVL G FANGVA+SKD Sbjct: 141 SDGTLYFTVSSTKYTPADFYKDMAEGNPYGQLLKYDPKSNQTTVLQEGFYFANGVALSKD 200 Query: 226 RSFVL 230 FV+ Sbjct: 201 EDFVV 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20516 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40618 (239 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22866265 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46547 (389 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41556 (339 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44620 383 e-108 >Cs44620 Length = 200 Score = 383 bits (983), Expect = e-108, Method: Compositional matrix adjust. Identities = 184/198 (92%), Positives = 190/198 (95%), Gaps = 1/198 (0%) Query: 143 MVKDGGEPTLDNVLQPGKNMLAAGYCMYGSSCTLVLSTGTGVNGFTLDPSLGEFILTHPN 202 M+KD EPTLD+VLQPG NMLAAGYCMYGSSCTLVLSTG+GVNGFTLDPSLGEFILTHP+ Sbjct: 1 MMKDSHEPTLDDVLQPGNNMLAAGYCMYGSSCTLVLSTGSGVNGFTLDPSLGEFILTHPD 60 Query: 203 IKIPKKGKIYSVNEGNTKNWDAPTAKYVEKCKFPKDGSSPKSLRYIGSMVADVHRTLLYG 262 IKIPKKGKIYSVNEGN KNWD PTAKYVEKCKFPKDGSSPKSLRYIGSMVADVHRTLLYG Sbjct: 61 IKIPKKGKIYSVNEGNAKNWDGPTAKYVEKCKFPKDGSSPKSLRYIGSMVADVHRTLLYG 120 Query: 263 GIFLYPADKKSPNGKLRVLYEVFPMSFLMEQAGGQAFTGKQRALDLVPKNIHERSPIFLG 322 GIF+YP DKKSPNGKLRVLYEVFPMSFLMEQAGGQ+FTGKQRALDLVPK IHERSPIFLG Sbjct: 121 GIFMYPRDKKSPNGKLRVLYEVFPMSFLMEQAGGQSFTGKQRALDLVPKKIHERSPIFLG 180 Query: 323 SYDDVEEIKAL-YAAEEK 339 SYDDVEEIKAL YAAEEK Sbjct: 181 SYDDVEEIKALFYAAEEK 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31412 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12750 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23855 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs40321 290 9e-81 >Cs40321 Length = 204 Score = 290 bits (741), Expect = 9e-81, Method: Compositional matrix adjust. Identities = 150/190 (78%), Positives = 165/190 (86%), Gaps = 4/190 (2%) Query: 1 MEEDD-DNDEAVF---GELIEDEVETPAHLRNLAAAAQLGDVDALRLALDTLNGSIDEPV 56 MEEDD + D A+F G ++ E ETP HLR+LAAAAQLGDV +LRLALD L+GSIDEPV Sbjct: 9 MEEDDSEEDNALFEEDGVNMDLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPV 68 Query: 57 EDGDTALHLTCLYGFLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFTEIVELLMNSTN 116 ED DTALHLTCLYG+LPCVQLLLERGASLEAKDEDGAIPLHDACAGGF EIV+LL+NS + Sbjct: 69 EDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSAS 128 Query: 117 NTECVKRMLESVDVEGDTPLHHAARGEHVGVIRLLLAHGASPTKGNIYGKIPSELADMDT 176 TECVKRMLE+VD EGDTPLHHAARGEHV VIRLLLA GASPTK N+YGK PSEL + DT Sbjct: 129 GTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSELPEPDT 188 Query: 177 EAKRILEAAA 186 EA+RILE AA Sbjct: 189 EARRILEVAA 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64516 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 169 2e-44 >Cs99541 Length = 211 Score = 169 bits (429), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 90/209 (43%), Positives = 123/209 (58%), Gaps = 7/209 (3%) Query: 12 YDYLVKLLLIGDSGVGKSCLLLRXXXXXXXXXXXXXXXXXXKIRTIELDGKRIKLQIWDT 71 Y YL K ++IGD+GVGKSCLLL+ R I +D K IKLQIWDT Sbjct: 3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDT 62 Query: 72 AGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKAD 131 AGQE FR+IT +YYRGA G LLVYD+T +FN++ +W+ + QHA+ N+ +L+GNK D Sbjct: 63 AGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCD 122 Query: 132 MDESKRAVPTSQGQALADEYGIKFFETSAKTNFNVEQVFFSIARDIKQRIAES--DSKAE 189 + +RAV T +G+ A E+G+ F E SAKT NVE+ F A I ++I + D E Sbjct: 123 LAH-RRAVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSNE 181 Query: 190 PLTIKISK---PDPAIG-SATAQEKSACC 214 IK+ P P+ G ++ + CC Sbjct: 182 SYGIKVGYGGIPGPSGGRDGSSSQAGGCC 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566259 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54601 155 3e-40 >Cs54601 Length = 305 Score = 155 bits (392), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 109/207 (52%), Positives = 130/207 (62%), Gaps = 18/207 (8%) Query: 42 FIHAGTHYIHHHPTGPLQVPSF------XXXXXXXXXXXXXXXXXXXXXXXMYFVPS-RQ 94 F+HAG HYIHHHP G + + ++ +Y+VP+ RQ Sbjct: 87 FVHAGGHYIHHHPAGAMPISAYYPVYPSQQQPQVHHHQHQHQVHQLDQQYPVYYVPAGRQ 146 Query: 95 AQAYSLSMQQS--NFSEAATGIPSGRSQAPSAPAMVTSP-AAYNPTRNAPLQKPEM--AA 149 QAY+LSMQQ + SE+ T I S R Q P P+MV P AAYNP RN + KPEM AA Sbjct: 147 PQAYNLSMQQQSHSVSESPTAITSSRPQTPPNPSMVPPPAAAYNPMRNTHITKPEMAAAA 206 Query: 150 GMYRTGTAAAP-LVQVPSSQHQQQYVGYSQIHHPSQSIAPPSA--ATANYAYEFSDPAHA 206 G+YRT T P +VQVPSS QQQYV YSQIHHPSQS+AP SA ATANY YE++DPAHA Sbjct: 207 GVYRTTTTGTPQMVQVPSS--QQQYVNYSQIHHPSQSVAPTSAAMATANYGYEYTDPAHA 264 Query: 207 QIFYAQAMAPTLP-QYQTMTSADQNFS 232 QI+Y Q +APT+P QYQTMT A S Sbjct: 265 QIYYTQPLAPTMPSQYQTMTEASAQLS 291 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41417 (595 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55034 (302 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs45360 207 2e-55 >Cs45360 Length = 378 Score = 207 bits (526), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 111/282 (39%), Positives = 159/282 (56%), Gaps = 26/282 (9%) Query: 1 MLELLRGKRLVFVGDSLNRNMWESLVCILRNSVKDRTKVYEASGRHHFRTEASYSFIFEE 60 LE RGK+++FVGDSL+ N W+SL C++ + V +TK RT S F+E Sbjct: 121 FLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWVP-KTKYSVV------RTAVLSSITFQE 173 Query: 61 YHCSVEFFVSPFLVQEWEMPDKNGSKKETLRLDKIPTSSDKYKTADIIIFNTGHWWTHDK 120 + + + + +LV P LRLD I + ++ D++IFNT HWWTH Sbjct: 174 FGLQILLYRTTYLVDLVREP-----AGTVLRLDSI-KGGNAWRGMDMLIFNTWHWWTHTG 227 Query: 121 TSKGKDYYQEGSHVYGELNVMEAFRKALTTWARWVDANVNPAKSLVFFRGYSSSHFSGGQ 180 S+ DY +EG +Y ++N + AF K LTTWARWV+ NV+P K+ VFF+G S +H+ G Sbjct: 228 RSQPFDYIREGRKLYKDMNRLVAFYKGLTTWARWVNFNVDPTKTKVFFQGISPTHYEGRD 287 Query: 181 WNSGGQ-CDGETEPIRNETYIPDYPPKMIVLEKILRGMKTQVTYLNITRITDYRKDGHPS 239 WN + C G+T+P Y P +VL+K+ ++ V L+ITR++ YRKD HPS Sbjct: 288 WNEPSKSCSGQTKPYFGYKYPAGTPMPWVVLQKVFSRLRKPVYLLDITRLSQYRKDAHPS 347 Query: 240 IYRKQNLSDEERRSPLRFQDCSHWCLPGVPDAWNELLYAEIL 281 Y + DCSHWCLPG+PD WN+L+YA + Sbjct: 348 EYGGHS------------DDCSHWCLPGLPDTWNQLMYAALF 377 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7415 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22024 (73 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17016 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32536 (63 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48636 (60 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31428 (239 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84306 136 3e-34 >Cs84306 Length = 201 Score = 136 bits (342), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 60/71 (84%), Positives = 64/71 (90%) Query: 168 MIIEAGAYPSPLGYGGFPKSVCTSVNECMCHGIPDSRQLQDGDIINIDVTVYFNGYHGDT 227 MII+ GAYPSPLGYGGFPKSVCTSVNEC+CHGIPDSR L+DGD INIDVTVY NGYHGDT Sbjct: 1 MIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDT 60 Query: 228 SKTFLCGNVTD 238 S TF CG+V D Sbjct: 61 SATFFCGDVDD 71 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19111 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33600 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11466261 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14329 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27821 (418 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs31373 66 7e-13 >Cs31373 Length = 293 Score = 65.9 bits (159), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Query: 48 RLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYR 99 ++ WTP+LH RF++AV QLG DKA P +++LMGI LT +++ SHLQKYR Sbjct: 87 KVDWTPELHRRFVQAVEQLG-VDKAVPSRILELMGIDCLTRHNIASHLQKYR 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47598 (293 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24808 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96617 71 6e-15 >Cs96617 Length = 103 Score = 71.2 bits (173), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 12/100 (12%) Query: 81 EGYSGSDLKNLCVAAAYRPVXXXXXXXXKGGGDILP------PV-----LRSLTLDDFIK 129 +GYSGSDLK+LCV AA+ P+ K L P+ +R L +DDF Sbjct: 3 DGYSGSDLKSLCVTAAHCPIREILEKEKKERALALAENRASAPLYNSVDVRPLNMDDFKY 62 Query: 130 SKAKVGPSVAFDAASMNELRKWNEQYGEGGSR-RKSLFGF 168 + V SV+ ++ MNEL +WNE YGEGGSR RKSL F Sbjct: 63 AHDHVCASVSSESTHMNELLQWNELYGEGGSRKRKSLSYF 102 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53186 (276 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66175 71 1e-14 >Cs66175 Length = 260 Score = 70.9 bits (172), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 39/78 (50%), Positives = 49/78 (62%), Gaps = 3/78 (3%) Query: 119 AGSTASTAVLVGDRLLVANVGDSRVVACRAGSAIPLSTDHKPDRSDERQRIEDAGGFVIW 178 +GSTA A++ +L+VAN GDSR V R G A+ LS DHKPD E+ RI AGGF+ Sbjct: 175 SGSTACVAIIRDKQLVVANAGDSRCVLSRKGQALNLSKDHKPDLEVEKDRILKAGGFI-- 232 Query: 179 AGTWRVGGVLAVSRAFGD 196 RV G L ++RA GD Sbjct: 233 -QVGRVNGSLNLARAIGD 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22163 (460 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41546 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65961 391 e-111 >Cs65961 Length = 210 Score = 391 bits (1004), Expect = e-111, Method: Compositional matrix adjust. Identities = 183/210 (87%), Positives = 204/210 (97%) Query: 2 LPDSSSSQPEFDYLFKLLLIGDSGVGKSTLLLSFTSNTFEDLSPTIGVDFKVKHVNIGGK 61 + SS+SQ EFDYLFKLL+IGDSGVGKS+LLLSFTS+ FE+LSPTIGVDFKVK+V++GGK Sbjct: 1 MDSSSASQQEFDYLFKLLMIGDSGVGKSSLLLSFTSDNFEELSPTIGVDFKVKYVDVGGK 60 Query: 62 KLKLAIWDTAGQERFRTLTSSYYRGAQGVIMVYDVTRRETFTNLSDIWAKEIDLYSTNQD 121 KLKLAIWDTAGQERFRTLTSSYYRGAQG+IMVYDVTRR+TFTNLSD+WAKEIDLYSTNQD Sbjct: 61 KLKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQD 120 Query: 122 CIKMLVGNKVDKESERVVTKKEGIDFAREYGCLFLECSAKTRVNVEQCFEELVLKILETP 181 CIK+LVGNKVDKESERVVTKKEGI+FAREYGCLF+ECSAKTRVNV+QCFEELVLKIL+TP Sbjct: 121 CIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTP 180 Query: 182 SLLAEGSSGVRKNIFKQKPPESDASTSGCC 211 SLLAEGS G++KNIFKQKPPE+DA+ SGCC Sbjct: 181 SLLAEGSKGLKKNIFKQKPPEADAAASGCC 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22330 (69 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31274 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42037 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7436 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31645 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41061 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54952 (573 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11929 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3266259 (431 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18366261 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28359 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13048 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2466261 (322 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7237 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57840 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28266264 (325 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10126 (433 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7888 (525 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31365 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14913 (381 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18794 261 8e-72 >Cs18794 Length = 217 Score = 261 bits (667), Expect = 8e-72, Method: Compositional matrix adjust. Identities = 136/223 (60%), Positives = 170/223 (76%), Gaps = 9/223 (4%) Query: 162 LDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPEQAE-GPPAARPPASGLAVNLPTQ 220 +DMGGG+WD++TV RAL+AAYNNPERAV+YLYSGIPE AE P A PAS A Sbjct: 1 MDMGGGTWDKETVTRALQAAYNNPERAVDYLYSGIPETAEVAVPVAHFPASQAAETGAAG 60 Query: 221 APQGPQTTVASSGPNANPLDLFPQGLPSMGSNASAGTLDFLRNSPQFQALRAMVQANPQI 280 S PN++PL++FPQ S + G+LDFLRN+ QFQALR+MVQ+NPQI Sbjct: 61 ------AAPVSGVPNSSPLNMFPQETLSGAPASGLGSLDFLRNNQQFQALRSMVQSNPQI 114 Query: 281 LQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNVLGQ-LGTVPQAVTITPEER 338 LQPMLQELGKQNP L+RLIQEHQA+FL+LINEPV+G EG++ Q +P A+ +TP E+ Sbjct: 115 LQPMLQELGKQNPQLLRLIQEHQAEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQ 174 Query: 339 ESIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFEE 381 E+I+RLEAMGFDRALV+E F AC++NEELAANYLL++ +FE+ Sbjct: 175 EAIQRLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 217 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57483 (423 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104345 98 1e-22 >Cs104345 Length = 340 Score = 98.2 bits (243), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 78/314 (24%), Positives = 145/314 (46%), Gaps = 13/314 (4%) Query: 112 MKRRAENCYILTSNVSLEYDKSEINAGFFYSSAEQREAMVAAERRQVDERVKKIIELKNK 171 M+R+ N I+ + LEY K E E M+ E ++ +I++ K Sbjct: 12 MRRKIVNPRIILLDSPLEYKKGENQTNAELVKEEDWGVMLKIEEDYIENLCMQIVKFKPD 71 Query: 172 VCSGNDNNFVVINQKGIDPPSXXXXXXXXXXXXXXXXXXNMERLVLACGGEAVNSVDDLT 231 + VI +KG+ + + R+ ACG VN D+L Sbjct: 72 L---------VITEKGLSDLACHYLSKAGVSAIRRLRKTDNNRIAKACGAVIVNRPDELQ 122 Query: 232 PDCLG-WAGLVYEHILGEEKYTFVENVKNPHSCTILIKGPNDHTIAQIKDAVRDGLRSVK 290 +G AGL +G+E + F+ + K+P +CT+L++G + + +++ ++D + + Sbjct: 123 ESDVGTGAGLFEVKKIGDEFFAFIVDCKDPKACTVLLRGASKDLLNEVERNLQDAMSVAR 182 Query: 291 NTMEDESVVLGAGAFEVAARQYLVNEVKKTVQGRAQLGVEAFADALLVVPKTLAENSGLD 350 N +++ +V G GA E+ L + +++G + EA A A +P+TLA+N G++ Sbjct: 183 NIIKNPKLVPGGGATELTVSATL-KQKSSSIEGIEKWPYEAAAIAFEAIPRTLAQNCGVN 241 Query: 351 TQDVIIALTGEHDRGN--VVGLNQHTGEPIDPHMEGIFDNYSVKRQIINSGPVIASQLLL 408 + AL G+H G +G++ +TG D I+D Y+VK Q + A LL Sbjct: 242 VIRTMTALQGKHANGENAWIGIDGNTGAISDMKEGKIWDAYNVKAQTFKTAIEAACMLLR 301 Query: 409 VDEVIRAGRNMRKP 422 +D+++ + + P Sbjct: 302 IDDIVSGIKKKQAP 315 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58529 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 384 e-109 >Cs99541 Length = 211 Score = 384 bits (987), Expect = e-109, Method: Compositional matrix adjust. Identities = 185/211 (87%), Positives = 196/211 (92%), Gaps = 2/211 (0%) Query: 1 MSYDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGRPIKLQIW 60 MSY YLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARM+TID +PIKLQIW Sbjct: 1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIW 60 Query: 61 DTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANPNMTIMLIGNK 120 DTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHAN NMTIMLIGNK Sbjct: 61 DTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNK 120 Query: 121 CDLAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAARILQNIQEGVFDLSN 180 CDLAHRRAVS EEGEQFAKE+GL+F+EASA+TAQNVEEAFIKTAA I + IQ+GVFD+SN Sbjct: 121 CDLAHRRAVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSN 180 Query: 181 ESSGIKVGYGRPQGPSG--DGTVSQRGGCCN 209 ES GIKVGYG GPSG DG+ SQ GGCC+ Sbjct: 181 ESYGIKVGYGGIPGPSGGRDGSSSQAGGCCS 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43587 (324 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48074 425 e-121 >Cs48074 Length = 257 Score = 425 bits (1092), Expect = e-121, Method: Compositional matrix adjust. Identities = 199/258 (77%), Positives = 232/258 (89%), Gaps = 1/258 (0%) Query: 67 MGNGSYDEAVEGLRKLLREKANLEPVAAAKIDQITAQLKSSDGSSSPFDPVERMKTGFIY 126 M N SY+EA+E L+KLL+EK +L+PVAAAK++QITAQL++ + + FD VER+K GFI+ Sbjct: 1 MANQSYEEAIEALKKLLKEKEDLKPVAAAKVEQITAQLQTPSDTKA-FDSVERIKDGFIH 59 Query: 127 FKKEKYDKNPALHAELAKGQSPKFMVFACSDSRVCPSHVLDFQPGDAFVVRNVANMVPAY 186 FK+EKY+KNPAL++ELAKGQSPK+MVFACSDSRVCPSHVLDFQPG+AFVVRNVAN+VP Y Sbjct: 60 FKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPY 119 Query: 187 DKIRYSGVGSAVEYAVLHLKVEHIVVIGHSSCGGIKGLMSFPFDGTSSTDFIEDWVKIGL 246 D+ +Y+GVG+AVEYAVLHLKV +IVVIGHS+CGGIKGLMSFPFDG +STDFIEDWVKIG+ Sbjct: 120 DQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFPFDGNNSTDFIEDWVKIGI 179 Query: 247 PAKSKVVAECGDLPFPEQCAYCEKEAVNVSLGNLLSYPFVREGLVKKTLTLKGGYYDFVK 306 PAKSKV+ E GD PF +QC YCEKEAVNVSL NLL+YPFVREGLV KTL LKGGYYDFV Sbjct: 180 PAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLALKGGYYDFVN 239 Query: 307 GTFELWGLDFGLSPSFSV 324 G+FELWGLDFGLSP SV Sbjct: 240 GSFELWGLDFGLSPPLSV 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9852 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58192 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53269 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59973 82 4e-18 >Cs59973 Length = 197 Score = 82.0 bits (201), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 45/167 (26%), Positives = 81/167 (48%), Gaps = 20/167 (11%) Query: 7 RIMIAVNESSIKGYPHPSISSKRAFEWTLQKIV-------RSNTSAFKLLFLHVHVPDED 59 ++M+A++ES+ S A +W L + + L +HV P + Sbjct: 33 KVMVAIDESA---------ESVNALKWALDNLYGIVGFTPEAGGGGGILTIVHVQQPFQR 83 Query: 60 ----GFDDMDSIYASPEDFKNLERRDKARGLQLLEHFVKSSHEFGVSCGAWIKKGDPKEV 115 + YA+ +++ + + LL ++ + V + + +GDPK++ Sbjct: 84 FVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDPKDM 143 Query: 116 ICHEVKRIQPDLLVVGCRGLGPFQRVFVGTVSEFCVKHAECPVITIK 162 IC +++ DLLVVG RGLG +R F+G+VS++C HA CP+I +K Sbjct: 144 ICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVK 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41657 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25841 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs1613 229 1e-62 >Cs1613 Length = 476 Score = 229 bits (585), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 110/160 (68%), Positives = 132/160 (82%), Gaps = 3/160 (1%) Query: 1 MRWTVLSSDILFLFPAVFCFVVVYYTG--RGRRSDIAWLIAMILLNPCLILIDHGHFQYN 58 MRWTVLSSD L FPA+F F VY++ R++D AW IAM+LLNPCLILIDHGHFQYN Sbjct: 89 MRWTVLSSDTLIFFPAIFYFAFVYHSSCHSSRKNDCAWHIAMLLLNPCLILIDHGHFQYN 148 Query: 59 CISLGLTIGAVAAILSDKELVACVLFSLALNHKQMSAYFAPAFFSHLLGKCLRRRNPILE 118 CISLGLT+ A+AAILS +EL+A LF+LAL+HKQMS Y+APAFFSHLLGKCLRR+NPI Sbjct: 149 CISLGLTVAAIAAILSQRELLASCLFTLALSHKQMSVYYAPAFFSHLLGKCLRRKNPIHG 208 Query: 119 VSKLGLAVVGTFAIVWWPYIHSMDAFLGVNNSI-KFKKGI 157 V+KLGL V+GTF +VWWPY+HS DA LGV + + F++GI Sbjct: 209 VAKLGLTVLGTFTVVWWPYLHSTDALLGVLSRLAPFERGI 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15952 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3581 (277 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41871 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47361 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26604 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41076 (296 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65342 (482 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7831 208 8e-56 >Cs7831 Length = 138 Score = 208 bits (530), Expect = 8e-56, Method: Compositional matrix adjust. Identities = 100/128 (78%), Positives = 111/128 (86%) Query: 355 MENALRAXXXXXXXXXXLIHRDGDNGKQLIYEKLPKDISERHVLLLDPVLATGNSAGQAI 414 MENALRA LIHR+GDNG+QLIYEKLP+DISERHVLLLDP+L TGNSA QAI Sbjct: 1 MENALRAFCKGIKIGKILIHREGDNGQQLIYEKLPQDISERHVLLLDPILGTGNSAVQAI 60 Query: 415 ELLIQKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGMGEFG 474 LL++KGVPES+IIFLNLISAP+G+H VCK FP LKIVTSEID+ LNE+FRVIPGMGEFG Sbjct: 61 SLLLRKGVPESNIIFLNLISAPQGVHVVCKSFPRLKIVTSEIDIGLNEDFRVIPGMGEFG 120 Query: 475 DRYFGTDD 482 DRYFGTDD Sbjct: 121 DRYFGTDD 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47781 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50988 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9726 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26166260 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55385 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18017 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49949 (228 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37806 291 5e-81 >Cs37806 Length = 239 Score = 291 bits (744), Expect = 5e-81, Method: Compositional matrix adjust. Identities = 161/243 (66%), Positives = 174/243 (71%), Gaps = 32/243 (13%) Query: 1 MSCNGCRVLRKGCSESCILRPCLQWIESAESQGHATVFVAKFFGRAGLMSFISAVPENQR 60 MSCNGCRVLRKGCSESCILRPCLQWIES ESQGHATVFVAKFFGRAGLMSFISAVPE+QR Sbjct: 1 MSCNGCRVLRKGCSESCILRPCLQWIESPESQGHATVFVAKFFGRAGLMSFISAVPESQR 60 Query: 61 PALFRSLLYEACGRTVNPVNGAVGLLGTGNWHVCQAAMETVLRGGTLRAMPELLN---GV 117 PALF+SLLYEACGRTVNPVNGAVGLL TGNWHVCQAA+ETVLRGGTLR +PELLN G Sbjct: 61 PALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPVPELLNSCGGS 120 Query: 118 STPECDEASEAEVTCTDMFKLRD-----------PNXXXXXXXXXXXXLEEASKVQCTDL 166 TP D+ SEAEVTCTDM +L+D + E A K+Q +DL Sbjct: 121 PTPTSDDVSEAEVTCTDMSRLQDRSFPSSHCRFSSSRSKVSPAKRKRVEESAMKLQQSDL 180 Query: 167 DLRLTPGLTGKISSRGLGAMSYLPET-RRPGTPSMNSEESVTTTCFET-------PHSPE 218 DLRLTP TGK+ PE RRPGTPSMNS S TTTC E+ PH E Sbjct: 181 DLRLTPRXTGKVP----------PEVKRRPGTPSMNSGGSGTTTCLESGVTDPPYPHGAE 230 Query: 219 GER 221 E+ Sbjct: 231 EEK 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50683 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35043 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55149 (523 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1866260 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33157 168 3e-44 >Cs33157 Length = 179 Score = 168 bits (426), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 93/183 (50%), Positives = 117/183 (63%), Gaps = 13/183 (7%) Query: 2 VGQWTVTKPGRSDEVLEADQQQRITAQIRAHFDSITPKRPAKXXXXXXXXXXXXXXH-AA 60 V QWTVTKP RSDEVL+A +Q RI Q+RA DS+ PKRP K AA Sbjct: 6 VDQWTVTKPSRSDEVLDAVEQVRIANQVRAQIDSMAPKRPTKPNRSEPDFIAPTNDQSAA 65 Query: 61 NGTIPELHKFRTLQSQSQSESHAMISTDGSGMLQEEFVETHYYKELGSIDKQHHTTGTGF 120 NG IPEL K R+LQSQS + S + + Q+EFVET YY +L SIDK HHTTGTGF Sbjct: 66 NGNIPELDKLRSLQSQSHV--GVIYSAEVNNTAQDEFVETQYYNQLVSIDKDHHTTGTGF 123 Query: 121 IKVERRGVEDGYGLQLQR---RENREMMLRGFKSNPATNDWIPSLEEDEVGYVSSKPSRS 177 I+V G +GY +++ + +R + +KSNPATNDWIPS+E D+ ++SSKP+RS Sbjct: 124 IRVANEG--NGYNIRVGKGCDSGDRPV----YKSNPATNDWIPSVEYDQ-AFISSKPNRS 176 Query: 178 ESC 180 E C Sbjct: 177 EGC 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41723 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10798 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24196 (102 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58110 (313 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1466263 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33185 239 8e-66 >Cs33185 Length = 141 Score = 239 bits (611), Expect = 8e-66, Method: Compositional matrix adjust. Identities = 120/153 (78%), Positives = 123/153 (80%), Gaps = 28/153 (18%) Query: 3 GGIARGRLAEERKAWRKNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGYFPLT 62 GGIARGRL EERKAWRKNHPH TDWEGGYFPLT Sbjct: 4 GGIARGRLTEERKAWRKNHPH----------------------------TDWEGGYFPLT 35 Query: 63 LHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD 122 L+FSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLD Sbjct: 36 LYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLD 95 Query: 123 QPNPADPAQTDGYQLFIQEPAEYKRRVRQQAKQ 155 QPNPADPAQTDGYQLFIQ+PAEYKRRVRQQAK Sbjct: 96 QPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKH 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1537 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2643 (319 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs51332 367 e-104 >Cs51332 Length = 318 Score = 367 bits (942), Expect = e-104, Method: Compositional matrix adjust. Identities = 188/317 (59%), Positives = 212/317 (66%), Gaps = 3/317 (0%) Query: 6 DSEVTSLAASSPTRSPRRPVYYVQSPSRDSHDGEKTTTSFHSTPVLXXXXXXXXXXXXXX 65 DSEVTSLA SSPTRSPRRPVYYVQSPSRDSHDGEKTTTSFHSTPVL Sbjct: 2 DSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHDGEKTTTSFHSTPVLSPAGSPPHSHSSIG 61 Query: 66 XXXXXXXXXXXXXXXXXXXRKISPNDASRGGHRKGEKPW-KECAVIXXXXXXXXXXRQKG 124 RKISPNDASRGG RKG+K W KEC VI R+ G Sbjct: 62 RHSRESSSSRFSGSLKPGSRKISPNDASRGGQRKGQKRWNKECDVIEEEGLLEDEERRSG 121 Query: 125 LPRRCYXXXXXXXXXXXXXXXXXXXWGASKPQKPKITMKSITFERFVVQAGSDSTGVATD 184 LPRRCY WGASK QKPKITMKSI FE F +QAGSD +GVATD Sbjct: 122 LPRRCYFLAFVLGFFLLFSLFSLILWGASKSQKPKITMKSINFEHFKIQAGSDFSGVATD 181 Query: 185 MVSMNSTVKLTFRNTATFFGVHVTSTPLDLSYSRLRVASGTIKKFYQSRKSHRSLTIVLM 244 M+++NSTVK+ +RNT TFFGVHVTS PLDLSYS + +ASG I+KFYQSRKS +++T+ +M Sbjct: 182 MITVNSTVKMIYRNTGTFFGVHVTSNPLDLSYSEITIASGAIRKFYQSRKSQKTVTVAVM 241 Query: 245 GDKIPLYXXXX--XXXXXXXXXXEPLPLKLSFMLRSRAYVLGKLVKPKFYKRIECSVNLD 302 G+KIPLY P+PL L+F++RSRAYVLGKLVKPKFYK I CS+ D Sbjct: 242 GNKIPLYGSGAGLSINSTTGSTSHPVPLNLNFVVRSRAYVLGKLVKPKFYKNIACSITFD 301 Query: 303 PKKLNVPLSLKKSCTYQ 319 PKKLNVP+SLK SCTY Sbjct: 302 PKKLNVPVSLKNSCTYD 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10361 (135 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26779 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35348 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8594 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56813 (224 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8891 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36844 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30587 (355 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10612 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27588 (281 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53808 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59973 112 2e-27 >Cs59973 Length = 197 Score = 112 bits (280), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 60/150 (40%), Positives = 89/150 (59%), Gaps = 11/150 (7%) Query: 3 ALRWALDN---IKLRSPPSHAEAGSFVILHVQSPPS--IATGLNPGAIPFGGPTDLEVPA 57 AL+WALDN I +P + G I+HVQ P + L+ + + + +E Sbjct: 47 ALKWALDNLYGIVGFTPEAGGGGGILTIVHVQQPFQRFVLPALSTSSAFYATSSMVE--- 103 Query: 58 FTAAIEAHQRRITEAILDHALKICSDKNVNVKTDVVIGDPKEKICEAAVNLHADLLVMGS 117 ++ Q + A+L AL++C DK V ++ V+ GDPK+ IC++A +H DLLV+GS Sbjct: 104 ---SVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDPKDMICQSAEQMHIDLLVVGS 160 Query: 118 RAFGPIRRMFLGSVSNYCTNHAQCPVMIVK 147 R G I+R FLGSVS+YC +HA CP++IVK Sbjct: 161 RGLGKIKRAFLGSVSDYCAHHAVCPIIIVK 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25430 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34451 (176 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs167106188 127 1e-31 >Cs167106188 Length = 229 Score = 127 bits (318), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 92/229 (40%), Positives = 112/229 (48%), Gaps = 53/229 (23%) Query: 1 MTTSK--------AGTVGGAASQPS--PECCMCGDYGFSYELFQCKVCQFRSQHRYCSNL 50 MTT+K A + + SQ S ECCMCGDYG S ELF+CKVCQFRSQHRYCSNL Sbjct: 1 MTTNKEANSNIIAATSAKDSQSQASCPAECCMCGDYGVSNELFRCKVCQFRSQHRYCSNL 60 Query: 51 YPKADSYRVCNWCLNQKDDTPEKTQXXXXXXXXXXXXXXXDG---------------RXX 95 YPKA+SY+VCNWCL+Q+D+ + D Sbjct: 61 YPKAESYQVCNWCLSQRDEKDKSQNSSNSSSSNKINGREGDDSKNVKNKKKNHDSSNNNN 120 Query: 96 XXXXXXXXXXXXQRG---SLQLPVSGPIKKQKS-------PERSPTTRKRIIASGCMEER 145 QR LQ P + PI+KQ+S P +P TRKRII +G +EE+ Sbjct: 121 NNNNNRVLLMKSQRSINLKLQQPNNKPIEKQRSPERLPPPPTPTPRTRKRIITNGALEEK 180 Query: 146 --LTRTNSEGSG----------------ITKHVFRNKVRRYKLLDEVSS 176 + R SE + + FRNKVRRYKLLDEVSS Sbjct: 181 NLIKRKKSEEMANNNNNNNSNSNNTVTPVRRPFFRNKVRRYKLLDEVSS 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4016 (349 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19963 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59112 64 7e-13 >Cs59112 Length = 265 Score = 64.3 bits (155), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 44/153 (28%), Positives = 70/153 (45%), Gaps = 18/153 (11%) Query: 14 SIPPEYVFPSNLNDLEVE------EVPTVDFSQLTAGTPDERSKAIQVIGKACREWGFFM 67 +IP E+V P E+PT+D + + ++ I +A REWG F Sbjct: 18 TIPAEFVRPEKEQPASATYHGPAPEIPTIDLDDPV------QDRLVRSIAEASREWGIFQ 71 Query: 68 VINHSMPRRLMDEMLNVGERFFDLAEEEKQDHA-GKELFDPIRCGTGFNNGLGNVFLWRD 126 V NH +P L+ ++ VG+ FF+L +EEK+ ++ + D GT + W D Sbjct: 72 VTNHGIPSDLIGKLQAVGKEFFELPQEEKEVYSRPADAKDVQGYGTKLQKEVEGKKSWVD 131 Query: 127 YLKVHVHP-----HFHAPHKPADFRETSEEYCK 154 +L V P + P+ P +R +EEY K Sbjct: 132 HLFHRVWPPSSINYRFWPNNPPSYRAVNEEYAK 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4834 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20699 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53333 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33185 233 9e-64 >Cs33185 Length = 141 Score = 233 bits (594), Expect = 9e-64, Method: Compositional matrix adjust. Identities = 117/153 (76%), Positives = 120/153 (78%), Gaps = 28/153 (18%) Query: 3 AGIARGRLMEERKAWRKNHPHGFVAKPETLPDGQVNLMVWQCTIPGKPGTDWEGGYFPLT 62 GIARGRL EERKAWRKNHPH TDWEGGYFPLT Sbjct: 4 GGIARGRLTEERKAWRKNHPH----------------------------TDWEGGYFPLT 35 Query: 63 LHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD 122 L+FSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLD Sbjct: 36 LYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLD 95 Query: 123 QPNPADPAQTEGYHLFIQDAAEYKRRVRQQAKQ 155 QPNPADPAQT+GY LFIQD AEYKRRVRQQAK Sbjct: 96 QPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKH 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59348 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8654 (130 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34046 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21039 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7372 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96440 200 5e-54 >Cs96440 Length = 212 Score = 200 bits (509), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 96/135 (71%), Positives = 117/135 (86%) Query: 15 EDKYPQHPLLPPDLKKRAINYQAASFVSSSIQPLQNLVEQKYIAEEVGSDEKLSWVKHHM 74 E+KYPQ PLLP DLK++AINYQAA+ VSSSIQPLQNL KYI E+ G+DE+ W K H+ Sbjct: 74 EEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAGADERDIWAKTHI 133 Query: 75 EKGFAALEKLLKDHAAKYASGDEVFLADLFLAPQIHDALTRFNVDMTQFSLLLRLNDAYN 134 KGFAALEKLLKD+A KYA+GDEVFLADL+LAPQ++ A+ RFN+DMTQF LLL+L++AY+ Sbjct: 134 GKGFAALEKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDMTQFPLLLKLHEAYS 193 Query: 135 ELPAFQDAMPEKQPD 149 +LPAFQ+A PEKQPD Sbjct: 194 KLPAFQNAAPEKQPD 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6035 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25403 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25616 283 9e-79 >Cs25616 Length = 265 Score = 283 bits (725), Expect = 9e-79, Method: Compositional matrix adjust. Identities = 147/204 (72%), Positives = 164/204 (80%) Query: 56 AVSFVTKSLLPTRRRLHLDPPNKLYFPYEPGKQVRSAISIKNISRSHLAFKFQTTAPKSC 115 VS+V +SLLP RRRL LDP N LYFPYEPGKQ RSA+ +KN S+SH+AFKFQTTAPKSC Sbjct: 62 TVSYVARSLLPPRRRLRLDPSNNLYFPYEPGKQTRSAVRLKNTSKSHVAFKFQTTAPKSC 121 Query: 116 YMRPPGGILAPGESLIATVFKFVEHPENNEKPAVDQKSKVKFKIMSLKVKGEMDYVPELF 175 YMRPPGG+LAPG+S+IATVFKFVE PENNE+ +DQKSK KFKIMSLKVKG +DYVPELF Sbjct: 122 YMRPPGGVLAPGDSIIATVFKFVEAPENNERQPLDQKSKDKFKIMSLKVKGGIDYVPELF 181 Query: 176 DEQKDQVAEEQILRVVFLDTERPSPPXXXXXXXXXXXXXXXXXXXXPPEDTGPRIVGEGL 235 DEQKDQV E+ILRVVFL+ ERPSP PP DTGPR+VGEGL Sbjct: 182 DEQKDQVTVERILRVVFLNAERPSPALEKLKRQLAEAEAALEARKRPPPDTGPRVVGEGL 241 Query: 236 VIDEWKERRERYLARQQVEGIDSV 259 VIDEWKERRE+YLARQQVE +DSV Sbjct: 242 VIDEWKERREKYLARQQVEAVDSV 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4758 (383 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4900 (228 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32131 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 166 2e-43 >Cs66150 Length = 305 Score = 166 bits (419), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 93/190 (48%), Positives = 120/190 (63%), Gaps = 8/190 (4%) Query: 25 ASILIDGSST---EKTAGPNR-LLRGYDVIDDAKTQLEAACPGVVSCADILALAARDSVV 80 ASIL+D ++T EK A PN RG++VID+ K +E ACP VVSCADIL +AA SV Sbjct: 83 ASILLDSTNTIDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVA 142 Query: 81 LTKGLMWKVPTGRRDGRVSLASDVN-NLPGPRDSVEVQKQKFADKGLNDQ-DLVTLVGGH 138 L+ G W VP GRRD R + + N NLPGP D+++ K F + GLND+ DLV L G H Sbjct: 143 LSGGPSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAH 202 Query: 139 TIGTSACQAFRYRLYNFSTTTANGADPTMDATFVTQLQALCPADGDASRRIALDTGSSDT 198 T G + CQ FR RLY+F+ T DPT+DATF+ QL+ LCP G+ D + D Sbjct: 203 TFGRAQCQFFRGRLYDFNNT--GKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDV 260 Query: 199 FDASFFTNLK 208 FD +F+NL+ Sbjct: 261 FDNKYFSNLR 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51078 (367 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14966265 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63997 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9437 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53065 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31627 (419 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46499 72 7e-15 >Cs46499 Length = 95 Score = 72.4 bits (176), Expect = 7e-15, Method: Composition-based stats. Identities = 30/45 (66%), Positives = 40/45 (88%) Query: 375 SVIVLPGVSVGMKNWLRVTFAIDPPSLEDGLGRIKAFYQRHAKKE 419 ++I G++VGMKNWLR+TFAI+P +LE+GLGRIKAF QRHAK++ Sbjct: 51 TMINFAGMAVGMKNWLRITFAIEPSALEEGLGRIKAFCQRHAKQQ 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34712 (680 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26296 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31808 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22165 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54979 120 1e-29 >Cs54979 Length = 258 Score = 120 bits (300), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 67/194 (34%), Positives = 112/194 (57%), Gaps = 5/194 (2%) Query: 1 MDILNCWNMTLQYVTINATGDSLNTDGIHMGRSTGVNISDAIIKTGDDSLSIGDGSQHIN 60 M+ C + + ++I++ S NTDGIH+ + V I +++I GDD +SIG G ++ Sbjct: 20 MNFDGCEGVMIDKLSISSPKLSPNTDGIHIENTKSVGIYNSMISNGDDCISIGTGCSDVD 79 Query: 61 VEKVTCGPGHGISVGRLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPVSVATDLH 120 + VTCGP HGIS+G LG ++++ V +TV+N + + NG+R+KTW +DL Sbjct: 80 IADVTCGPSHGISIGSLGAHYSQACVSNITVRNAIIRESDNGLRIKTW-QGGTGCVSDLS 138 Query: 121 FEDIIMNNVGNPILINQEYCPYDQCQAKVPSQVKISDVSFQGICGMSGTQ---VAVVCSR 177 FE+I M NV N I I+Q YC +C + S V ++ ++++ I G + + CS Sbjct: 139 FENIQMENVRNCINIDQYYCLSKECLNQT-SAVFVTGITYRNIKGTYDVRTPPIHFACSD 197 Query: 178 GVPCQTVDISDINL 191 VPC + ++++ L Sbjct: 198 TVPCTKITMAEVEL 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16346 (377 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6095 (117 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12666257 (327 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15994 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs40106185 146 2e-37 >Cs40106185 Length = 182 Score = 146 bits (369), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 61/116 (52%), Positives = 85/116 (73%) Query: 83 MVGQVDFNKDMDFWQLDKWNGFFPVKWHIVKDIPNSQLRHITLESNENRSVTYTRDTQEI 142 M+G DF K +D+WQ DKW+G FPVKWH +KD+PNSQ RHI LE+N+N+ VT +RDTQE+ Sbjct: 1 MIGPADFEKSVDYWQQDKWSGQFPVKWHTIKDVPNSQFRHIVLENNDNKPVTNSRDTQEV 60 Query: 143 GLKQGVEMLKIFKNYSARTSMFDDFNFYENREKSLHARRSSKPPPPSQMEIYGNGD 198 L+QG+EML IFKNY S+ DDF+FYE+R+K++ R++ + + + G D Sbjct: 61 KLEQGIEMLNIFKNYVTDMSILDDFDFYEDRQKAMQERKARQQASLMAVGVVGEND 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41823 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46147 (284 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31072 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6446 (139 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40843 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4708 (471 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9986 223 4e-60 >Cs9986 Length = 197 Score = 223 bits (568), Expect = 4e-60, Method: Compositional matrix adjust. Identities = 111/179 (62%), Positives = 134/179 (74%), Gaps = 2/179 (1%) Query: 19 ADAGSIGVNYGRIANNLPSAVKVVQLLKSQGIERVKVFDTDPAVLKALGESGIKVTVDLP 78 AD G +G+NYGR+ANNLPS KVV+LLKSQGI RVK +DTD AVL AL S I V V P Sbjct: 4 ADTGKVGINYGRVANNLPSPEKVVELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFP 63 Query: 79 NELLISAAKRQSFANTWVQKNVADYFPATKIEAIAVGNEVFVDPHNTTLSLVPALKNIHK 138 NE L AA QSF + WVQ N++ Y+PATKIEA+AVGNEVF DP NTT LVPA+KN++ Sbjct: 64 NEELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPFLVPAMKNVYN 123 Query: 139 ALVKYNLHSHIKVSSPVALSALQSSYPSSAGSFRQELIEPVFKPMLEFL--RQTGSYLM 195 +LVKY L S++KVSSP+AL ALQ+SYP S+GSF+ +LIEP P F R+ S+LM Sbjct: 124 SLVKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALNPCWSFYVRRRRISWLM 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15567 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18905 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17804 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20929 (268 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76629 258 7e-71 >Cs76629 Length = 283 Score = 258 bits (658), Expect = 7e-71, Method: Compositional matrix adjust. Identities = 148/281 (52%), Positives = 180/281 (64%), Gaps = 48/281 (17%) Query: 23 PEKSSFSQTCSLLSQYIKEKGTFGDLSLGMTCSLEGNGTPESLRQTATTTTMNLFPMTER 82 PEKSSFSQTCSLLSQY+KE G+FGDLSLG++ ++E NG PE R+ A TT MNLFP+++ Sbjct: 12 PEKSSFSQTCSLLSQYLKEGGSFGDLSLGISSNIEANGVPEIPRRPAATT-MNLFPVSDN 70 Query: 83 SAGVSGIPARNM----NLKSMNLFPQQAGFGSSVSKDDAPKIVNSSVKKSGNVEPQTAQM 138 S + RNM N +SMNLFPQQAGF K+D P +++SS+ K PQTAQM Sbjct: 71 SG--QDVSVRNMVAPRNWESMNLFPQQAGFAP---KNDTPNMIDSSLNKPA---PQTAQM 122 Query: 139 TIFYGGQVIVFNDFPADKAKEVMRLAGMGSS---------------------------PV 171 TIFYGGQVI FNDFPADKA E+M+LA GSS PV Sbjct: 123 TIFYGGQVIAFNDFPADKANEIMQLASNGSSLSHGTAYPPMQLPAQGYNSFAASLPKSPV 182 Query: 172 PSTTVKNP------IDAGGMAPSTPNVVPNFANSLIQERIQRPAQPVACELPIARKASLH 225 ST +P + P N +PNF N+LI E Q P++P C+LPIAR+ SLH Sbjct: 183 ESTPPVSPGPPKILTEPSCSVPPRSNSIPNFGNNLIPECAQPPSRP--CDLPIARRNSLH 240 Query: 226 RFLEKRKDRITARAPYNISNSPAGPHKPAESKSWLGLAAKS 266 RFLEKRKDRI ARAPY ++ S P KPA+SKSWLGLAA++ Sbjct: 241 RFLEKRKDRIVARAPYQVNGSAGAPDKPADSKSWLGLAAQT 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61002 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26683 140 3e-36 >Cs26683 Length = 118 Score = 140 bits (353), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 76/120 (63%), Positives = 79/120 (65%), Gaps = 22/120 (18%) Query: 1 MASLDSDVTMVPVXXXXXXXXXXXXXXXXXXXRFEIKKWNAVALWAWDIVVDNCAICRNH 60 MA+LDSDV M+PV RFEIKKW+AVALWAWDIVVDNCAICRNH Sbjct: 1 MATLDSDVPMIPVGEASSSAGPSSSSKKPK--RFEIKKWSAVALWAWDIVVDNCAICRNH 58 Query: 61 IMDL--------------------WVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH 100 IMDL VCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH Sbjct: 59 IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21566256 (806 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55748 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25564 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49623 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9712 (308 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50785 (306 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34902 (353 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3157 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65961 94 1e-21 >Cs65961 Length = 210 Score = 94.4 bits (233), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 69/206 (33%), Positives = 103/206 (50%), Gaps = 16/206 (7%) Query: 4 PNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIR 63 +QQ DY FKL+++GD G GK++ + + FE+ PTIGV+ K++ Sbjct: 6 ASQQEFDYL-FKLLMIGDSGVGKSSLLLSFTSDNFEE-LSPTIGVDFKVKYVDVGGKKLK 63 Query: 64 FYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVP-TWHR--DLCRVCENIPI 120 WDTAGQE+F L YY Q I+++DVT R T+ N+ W + DL ++ Sbjct: 64 LAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIK 123 Query: 121 VLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLH 178 +L GNKVD ++ +V K+ + F R+ + E SAK+ N ++ F L K+ +L Sbjct: 124 LLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLL 183 Query: 179 FVESPAL-------APPEVQIDMAAQ 197 S L PPE D AA Sbjct: 184 AEGSKGLKKNIFKQKPPEA--DAAAS 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46425 (104 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43604 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19349 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2691 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25017 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43776 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33167 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46391 (343 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs53960 402 e-114 >Cs53960 Length = 361 Score = 402 bits (1033), Expect = e-114, Method: Compositional matrix adjust. Identities = 182/209 (87%), Positives = 197/209 (94%) Query: 135 MDKALQNFGNDIAIAFSGAEDVVLIEYARLTGRPFRVFSLDTGRLNPETYAFFDTVEKHY 194 MD+AL+ FGNDIAIAFSGAEDV LIEYA LTGRPFRVFSLDTGRLNPETY FFD VEKH+ Sbjct: 1 MDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHF 60 Query: 195 GIHIEYVFPDSVEVQALVRNKGLFSFYEDGHQECCRIRKVRPLRKALKGLRAWITGQRKD 254 GI IEY+FPD+VEVQALVR+KGLFSFYEDGHQECCR+RKVRPLR+ALKGLRAWITGQRKD Sbjct: 61 GIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKD 120 Query: 255 QSPGTRAEIPVVQVDPTFEGMDSGVGSLVKWNPVANVDSMDIWNFLRAMNVPVNSLHSQG 314 QSPGTR+EIPVVQVDP FEG++ GVGSLVKWNPVANV DIWNFLR M+VP+NSLHSQG Sbjct: 121 QSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQG 180 Query: 315 YVSIGCEPCTRPVLPGQHEREGRWWWEDS 343 Y+SIGCEPCTRPVLPGQHEREGRWWWED+ Sbjct: 181 YISIGCEPCTRPVLPGQHEREGRWWWEDA 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65548 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26384 (450 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7615 (367 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63082 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39821 308 3e-86 >Cs39821 Length = 258 Score = 308 bits (788), Expect = 3e-86, Method: Compositional matrix adjust. Identities = 146/171 (85%), Positives = 160/171 (93%), Gaps = 2/171 (1%) Query: 1 MASTACFLHHHALST-PTRVSS-QRQLPSLRPSQLVCRAQKQAANEDDGAAVSRRLALTV 58 MAST CFLHHHALST P R SS QR + +++P+Q+VCRAQKQA EDDG+AVSRRLALTV Sbjct: 1 MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTV 60 Query: 59 LIGAAAIGTKVNPADAAYGEAANVFGKPKTNTDFLPYNGEGFKLSIPSKWNPSKEREFPG 118 LIGAAA+G+KV+PADAAYGE+ANVFGKPKTNTDFLPYNG+GFKLSIPSKWNPSKEREFPG Sbjct: 61 LIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPG 120 Query: 119 QVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDFLLGKQAFFG 169 QVLRYEDNFD NSNVSVIITPTDKKSITDYGSPEEFLSKVD+LLGKQA+ G Sbjct: 121 QVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSG 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40503 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41607 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47664 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs19328 333 6e-94 >Cs19328 Length = 197 Score = 333 bits (854), Expect = 6e-94, Method: Compositional matrix adjust. Identities = 155/172 (90%), Positives = 165/172 (95%) Query: 1 MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD 60 MS +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD 60 Query: 61 TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKL 120 TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VPI+LVGTKL Sbjct: 61 TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL 120 Query: 121 DLREDKQFLIDHPGATPITTAQGEDLKKMIGAAVYIECSSXTQQNVKAVFDA 172 DLR+DKQF IDHPGA PITTAQGE+L+K+IG+ YIECSS TQQNVKAVFDA Sbjct: 121 DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDA 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10197 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13602 (406 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7362 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33140 312 1e-87 >Cs33140 Length = 153 Score = 312 bits (799), Expect = 1e-87, Method: Compositional matrix adjust. Identities = 151/153 (98%), Positives = 153/153 (100%) Query: 1 MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFL 60 MANSNLPRRIIKETQRLLSEPAPGISASPSE+NMRYFNVMILGPTQSPYEGGVFKLELFL Sbjct: 1 MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL 60 Query: 61 PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 120 PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD Sbjct: 61 PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 120 Query: 121 DPLSENIAKHWKSNEAEAVETAKEWTRLYASGA 153 DPLSENIAKHWK+NEAEAVETAKEWTRLYASGA Sbjct: 121 DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58882 (224 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38939 (77 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17366258 (339 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv994 (390 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19744 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs105406 182 2e-48 >Cs105406 Length = 148 Score = 182 bits (463), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 93/148 (62%), Positives = 103/148 (69%) Query: 82 MILMDKLGRKALLVWSFFGMAVAMSVQVXXXXXXXXXXXXVFLSVSGMLLFVLTFXXXXX 141 M+LMDKLGRKALL WSFF MAV+M++QV ++LSV GML+FVLTF Sbjct: 1 MVLMDKLGRKALLQWSFFSMAVSMAIQVAASSSYIPGSASLYLSVGGMLMFVLTFALGAG 60 Query: 142 XXXXXXXXEIFPNRIRAKAMAVCMSVHWVINFFVGXXXXXXXXXXXXXXXYSMFCTFCLM 201 EIFP+RIRAKAMAVCMSVHWVINFFVG YS+F TFCLM Sbjct: 61 PVPSLLLPEIFPSRIRAKAMAVCMSVHWVINFFVGLLFLRLLEQLGPQLLYSIFGTFCLM 120 Query: 202 AVVFVKRNVVETKGRSLQEIEIALLPQE 229 AV FVKRNVVETKG+SLQEIEIALLPQE Sbjct: 121 AVAFVKRNVVETKGKSLQEIEIALLPQE 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51896 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49116 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41729 85 6e-19 >Cs41729 Length = 181 Score = 84.7 bits (208), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 44/87 (50%), Positives = 54/87 (62%), Gaps = 2/87 (2%) Query: 97 ASWCVASQTSSQTALQVALDYACGYGGADCSAIQPAGSCYNPNTLRDHASFAFNDYYQ-K 155 A+WCV LQ ALDYACG GADC+ I G CYNPNT++ H S+A N Y+Q K Sbjct: 19 ANWCVCKDGVGDPVLQKALDYACG-AGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRK 77 Query: 156 NPVPTSCNFGGTAVVTSTDPSSGTCQY 182 SC+F G+A V +TDPS+ C Y Sbjct: 78 GQAQGSCDFSGSATVATTDPSTAGCSY 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25066257 (565 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59929 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9404 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101267 87 3e-19 >Cs101267 Length = 255 Score = 86.7 bits (213), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 84/271 (30%), Positives = 131/271 (48%), Gaps = 30/271 (11%) Query: 1 MESPFRGDILKGKVALLTGGGSGIGYEISRQLGKHGASIAIMGRRRQVLDAAVSSLHSLG 60 ME +GKVA++T GIG+ I+ +LG GAS+ + R+++ +D AV L + G Sbjct: 1 MEKMKMAKRFQGKVAIVTASTQGIGFGIAERLGLEGASVVVSSRKQKNVDEAVVKLKARG 60 Query: 61 IPAIGLEGDVRKQEDAVRVLESTIKHFGRLDILVNAAAGNFLVPAEDLSPKGFQTVI--- 117 I IG+ V + ++ TI+ FG++D++V+ AA N P+ D + ++V+ Sbjct: 61 IEVIGVVCHVSNGQQRKNLINQTIEKFGKIDVVVSNAAAN---PSVDSILQTKESVLDKL 117 Query: 118 -DIDSVGTFTMCHEALQYLXXXXXXXXXXXXXXXXNISATLHYTATWYQIHVSAA----- 171 DI+ + + +A +L S L + YQ S A Sbjct: 118 WDINVKSSILLLQDAAPHLQKGS--------------SVVLISSIAGYQPQSSMAMYGVT 163 Query: 172 KAAVDSITRSLALEWGTDYDIRVNGIAPGPIDDTAGLSKLAPEDVVRKAKEHEPLF-KLG 230 K A+ +T++LA E D RVN +APG + T + D VR+ E L +LG Sbjct: 164 KTALLGLTKALAAEMAP--DTRVNCVAPGFV-PTHFAEYITSNDGVRQTIEQNTLLNRLG 220 Query: 231 EKWDIAMAAVYLASNAGKYINGTTLTVDGGL 261 D+A AA +LAS+ YI G TL V GG+ Sbjct: 221 TTRDMAAAAAFLASDDASYITGETLVVAGGM 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30823 (277 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95618 144 9e-37 >Cs95618 Length = 131 Score = 144 bits (363), Expect = 9e-37, Method: Compositional matrix adjust. Identities = 63/110 (57%), Positives = 85/110 (77%) Query: 93 RYGTAGLLSPSMEAKIVDPGSGKALTVNQTGELWLRGPTIMKGYFSNPEATTSTLDSSGW 152 + G+ G + + E K++DP G +L NQ GE+ +RGP IMKGY ++PEAT +T+D GW Sbjct: 22 KSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQIMKGYLNDPEATAATIDVEGW 81 Query: 153 LRTGDLCYIDDDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPEIADA 202 L TGD+ Y+DDD +FIVDR+KE+IK+KG+QVPPAE+EALLL+HP I DA Sbjct: 82 LHTGDIGYVDDDDEVFIVDRVKEIIKFKGFQVPPAEIEALLLSHPSIGDA 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22092 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35159 (171 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3666261 (382 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68010 122 9e-30 >Cs68010 Length = 146 Score = 122 bits (305), Expect = 9e-30, Method: Compositional matrix adjust. Identities = 62/143 (43%), Positives = 84/143 (58%), Gaps = 8/143 (5%) Query: 236 MKAVYGGFAAAL--KDLKVWVMNVVPINSPDTLPIIFERGLFGIYHDWCESFSTYPRSYD 293 M A GF +AL K VWVMNVVP + LP+I +RG G+ HDWCE+F TYPR+YD Sbjct: 1 MNAHSCGFNSALLEKGKSVWVMNVVPTIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTYD 60 Query: 294 LVHADHLF---SDLKKRCQLTAVIAEVDRILRPEGMLIVRDNVETVSEVESMAKSLQWEV 350 LVHA+ L S + RC + E+DRILRPEG +I+RD + ++ L+W+ Sbjct: 61 LVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIESARALTTRLKWDA 120 Query: 351 R---LTYSKDKEGLLCVKKTFWR 370 R + + D+ L+C K F R Sbjct: 121 RVIEIESNSDERLLICQKPFFKR 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3626 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17666265 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78299 313 1e-87 >Cs78299 Length = 259 Score = 313 bits (803), Expect = 1e-87, Method: Compositional matrix adjust. Identities = 153/255 (60%), Positives = 188/255 (73%), Gaps = 14/255 (5%) Query: 9 LAMVRVICYF------FSNVNA-----FTASGWTKAHATFYGGSDASGTMGGACGYGNLY 57 +A+ R++C+F F+ NA F W AHATFYGGSDASGTMGGACGYGNLY Sbjct: 1 MALFRMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY 60 Query: 58 STGYGTRTAALSTALFNDGASCGQCYKIICDYQSDSQWCKKG-ASVTITATNFCPPNYAL 116 S GYG TAALSTALFN+G SCG C+++ C D QWC G ++ ITATNFCPPN+A Sbjct: 61 SQGYGVNTAALSTALFNNGLSCGACFELKCG--GDPQWCNPGNPAILITATNFCPPNFAQ 118 Query: 117 PSNNGGWCNPPLQHFDMAQPAWEKIGIYRGGIVPVLFQRVPCKKHGGVRFSVNGRDYFEL 176 PS+NGGWCNPP HFD+A P + K+ YR GIVPV ++RVPC+K GG+RF++NG YF L Sbjct: 119 PSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNL 178 Query: 177 VLISNVAGAGSIQSVSIKGSRTSWMAMSRNWGANWQSNAYLNGQSLSFKVTTTDGVTQEF 236 VL++NVAGAG I VS+KG+ T W++MSRNWG NWQSN+ L GQ+LSF+VT +D T Sbjct: 179 VLVTNVAGAGDIVRVSVKGANTQWLSMSRNWGQNWQSNSQLVGQALSFRVTGSDRRTSTS 238 Query: 237 DNVVPSDWGFGQTFS 251 NV P++W FGQTFS Sbjct: 239 WNVAPANWQFGQTFS 253 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65609 (32 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30762 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5037 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46466 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22949 (317 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101682 119 4e-29 >Cs101682 Length = 347 Score = 119 bits (298), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 62/153 (40%), Positives = 94/153 (61%), Gaps = 1/153 (0%) Query: 162 VRCRCENTATLGERKNVNLPGVVVDLPTLTEKDKEDILGWGVPNNIDMIALSFVRKGSDL 221 V+C + L R+++N+ G +LP++T+KD EDI +GV N +D A+SFV+ + Sbjct: 14 VKCIVVDGGELKSRRHLNVRGKSANLPSITDKDWEDI-KFGVDNQVDFYAVSFVKDAKVV 72 Query: 222 VNVRKVLGSHAKRIQLMSKVENQEGVINFDEILRETDSFMVARGDLGMEIPVEKIFLAQK 281 + L S I ++ K+E+ + + N I+ +D MVARGDLG E+P+E + L Q+ Sbjct: 73 HELEDYLKSCNADIHVIVKIESADSIPNLHSIISASDGAMVARGDLGAELPIEDVPLLQE 132 Query: 282 MMIYKCNLVGKPVVTATQMLESMIKSPRPTRAE 314 +I +C + KPV+ AT MLESMI P PTRAE Sbjct: 133 DIIRRCRSMQKPVIVATNMLESMIDHPTPTRAE 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22951 (302 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101682 146 3e-37 >Cs101682 Length = 347 Score = 146 bits (368), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 98/285 (34%), Positives = 150/285 (52%), Gaps = 22/285 (7%) Query: 3 ALSFVRKGSDLVNVRKVLGSHAKRIQLMSKVENQEGVINFDEILRETDSFMVARGDLGME 62 A+SFV+ + + L S I ++ K+E+ + + N I+ +D MVARGDLG E Sbjct: 62 AVSFVKDAKVVHELEDYLKSCNADIHVIVKIESADSIPNLHSIISASDGAMVARGDLGAE 121 Query: 63 IPVEKIFLAQKMMIYKCNLVGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVM 122 +P+E + L Q+ +I +C + KPV+ AT MLESMI P PTRAE +D+A AV +G D VM Sbjct: 122 LPIEDVPLLQEDIIRRCRSMQKPVIVATNMLESMIDHPTPTRAEVSDIAIAVREGADAVM 181 Query: 123 LSGESAAGAYPEIAVKIMARICIEAESSLDYAAIFKEMIRSTPLPMSPLESLASSAVGTA 182 LSGE+A G +P AVK+M + + ESSL + + M + + S+ + A Sbjct: 182 LSGETAHGKFPLKAVKVMHTVALRTESSLPVSITPPTQFSAHKSHMGDMFAFHSTTM--A 239 Query: 183 NKAKAKLIVVMTRGGTTAKLVAKYRPAVPILSVVVPLLTTDSFDWTCSDEAPARHSLIYR 242 N I+V TR G+ A +++ YRP+ I F +T + R ++Y+ Sbjct: 240 NTLNTP-IIVFTRTGSMAVILSHYRPSSTI------------FAFTNQERIKQR-LVLYQ 285 Query: 243 GLIPILAEGSAKATDAESTEVILEAALKSATGKGLCKPGDAVVVL 287 G++PI + S D E T A+K K L G+ V ++ Sbjct: 286 GVMPIYMQFS---DDVEET---FSRAIKLLMDKNLVTKGEFVTLV 324 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42193 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59520 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16366257 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33969 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50709 (306 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34517 (488 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59303 62 1e-11 >Cs59303 Length = 175 Score = 62.0 bits (149), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 42/150 (28%), Positives = 71/150 (47%), Gaps = 4/150 (2%) Query: 299 VNSNHFARLAKLLDDDKVSG-KIIHGGQRDKANLKF-APTILLDVPEDSLVMNEEIFGPL 356 ++S F ++ K + G K+ GG+R A + PT+ V +D L+ +EIFGP+ Sbjct: 19 IDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVKDDMLIAKDEIFGPV 78 Query: 357 LPILTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKT 416 IL L++ + LAA +FT+N ++ + G + IN + Sbjct: 79 QSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGSVWIN--CFDVFDAA 136 Query: 417 LPFGGVGESGMGSYHGKFSYEAFSHRKSVL 446 +PFGG +SG G G +S + K+V+ Sbjct: 137 IPFGGYKQSGQGREKGSYSLSNYLQVKAVV 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23708 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44596 208 3e-56 >Cs44596 Length = 224 Score = 208 bits (530), Expect = 3e-56, Method: Compositional matrix adjust. Identities = 100/190 (52%), Positives = 134/190 (70%), Gaps = 1/190 (0%) Query: 1 MVLWVFGYGSLIWKAGFEYDDRRVCFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGE 60 MV WVFGYGSL+W GFEYD++ + FIK YRRVF DHRGTP++P RT TLE ++ Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKILGFIKDYRRVFDLACIDHRGTPQHPARTCTLEKSQET 60 Query: 61 ICWGVAYKV-SKEEDEQIALTYLEVREKQYDKKAYLDVYAEPMATTPVISGVMVYIASPD 119 ICWGVAY V E E++A+ YLE RE +YD K +D Y E + P ++GV+V+ ++PD Sbjct: 61 ICWGVAYCVRGGPEKERLAMEYLERRECEYDSKTLVDFYREGEPSQPALTGVIVFTSTPD 120 Query: 120 KKLNRNYLGPASVEEIAKQIIHAEGPSGPNREYLFQLEQALLQMGCEDKHVMDLANEVRR 179 K N+ YLGPA +EE+A+QI A GP G NR+YLF+LE+A+ +G ED ++++LANEVR+ Sbjct: 121 KVSNKYYLGPAPLEEMARQIATAVGPCGNNRDYLFKLEKAMFDIGHEDDYIIELANEVRK 180 Query: 180 ILSEKELTVS 189 L E S Sbjct: 181 ELGTAEKGFS 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666258 (377 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15739 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48981 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs82041 477 e-137 >Cs82041 Length = 309 Score = 477 bits (1227), Expect = e-137, Method: Compositional matrix adjust. Identities = 231/263 (87%), Positives = 245/263 (93%), Gaps = 2/263 (0%) Query: 2 AEAVTVMDIDEEDNHLLKA-NKGKSVVVGG-PPDRKATPWVEKYRPQSLADVAAHRDIVD 59 AE V++MD DE++N LK + GK+V+V G PPD KA+PWVEKYRPQSLADVAAHRDIVD Sbjct: 4 AETVSLMDFDEDENQNLKPKDNGKNVIVSGTPPDIKASPWVEKYRPQSLADVAAHRDIVD 63 Query: 60 TIDRLTSENRLPHLLLYGPPGTGKTSTILAVARKLYGEQFHNMILELNASDDRGIDVVRQ 119 TIDRLTSENRLPHLLLYGPPGTGKTSTILAVARKLYG Q+HNMILELNASDDRGIDVVRQ Sbjct: 64 TIDRLTSENRLPHLLLYGPPGTGKTSTILAVARKLYGAQYHNMILELNASDDRGIDVVRQ 123 Query: 120 QIQDFASTQSFSFGAKSSVKLVLLDEADAMTKDAQFALRRVIEKYTKNTRFALICNHVNK 179 QIQDFASTQSFSFG K+SVKLVLLDEADAMTKDAQFALRRVIEKYTKNTRFALICN VNK Sbjct: 124 QIQDFASTQSFSFGVKASVKLVLLDEADAMTKDAQFALRRVIEKYTKNTRFALICNQVNK 183 Query: 180 IIPALQSRCTRFRFAPLDAVHVTERLKHVINAEKLDVSESGLAALVRLSSGDMRKALNIL 239 IIPALQSRCTRFRFAPL+ VHVTERLKHVI AE LDV+E GLAALVRL +GDMRKALNIL Sbjct: 184 IIPALQSRCTRFRFAPLEPVHVTERLKHVIEAEGLDVTEGGLAALVRLCNGDMRKALNIL 243 Query: 240 QSTHMASQQITEEAVYLCTGNPI 262 QSTHMASQQITEEAVYLCTGNP+ Sbjct: 244 QSTHMASQQITEEAVYLCTGNPL 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55037 (444 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59910 75 1e-15 >Cs59910 Length = 135 Score = 75.5 bits (184), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 29/75 (38%), Positives = 54/75 (72%), Gaps = 1/75 (1%) Query: 71 KMYSMSEVKKHNSADSTWIVVHGHVYDCTRFLKDHPGGTDSILINAGTDCTEEFDAI-HS 129 K+++++EV HN+ W++++G VYD T+FL+DHPGG + +L G D T++F+ + HS Sbjct: 7 KVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHS 66 Query: 130 DKAKKLLEDYRIGEL 144 A+++++ Y +GE+ Sbjct: 67 PSAREMMDQYYVGEI 81 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9863 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59112 208 5e-56 >Cs59112 Length = 265 Score = 208 bits (530), Expect = 5e-56, Method: Compositional matrix adjust. Identities = 117/266 (43%), Positives = 151/266 (56%), Gaps = 4/266 (1%) Query: 1 MEVERVQALASGADLN-ELPAKFIRPAHERPEN-TKPLEGVSVPVISLAES-HDVLVKEI 57 MEVERVQA+AS + N +PA+F+RP E+P + T +P I L + D LV+ I Sbjct: 1 MEVERVQAIASLSHSNGTIPAEFVRPEKEQPASATYHGPAPEIPTIDLDDPVQDRLVRSI 60 Query: 58 YKACSEWGFFLLKDHGISPGLIEKLQEVGIXXXXXXXXXXXXYANDPSTGKFEGYGTKMT 117 +A EWG F + +HGI LI KLQ VG Y+ +GYGTK+ Sbjct: 61 AEASREWGIFQVTNHGIPSDLIGKLQAVGKEFFELPQEEKEVYSRPADAKDVQGYGTKLQ 120 Query: 118 KNLDEKVEWVDYFFHLMSPPSNVNHQIWPQTPSSYREVTEVYNXXXXXXXXXXXXXXXXX 177 K ++ K WVD+ FH + PPS++N++ WP P SYR V E Y Sbjct: 121 KEVEGKKSWVDHLFHRVWPPSSINYRFWPNNPPSYRAVNEEYAKYMREVVDKLFTYLSLG 180 Query: 178 XXXXXKVLKSHVGGDEIELEMKINMYPPCPQPQLALGVEPHTDMSALTLLVPNDVPGLQV 237 VLK GGD+IE +KIN YPPCP+P LALGV HTD+SALT+LVPN+VPGLQV Sbjct: 181 LGVEGGVLKEAAGGDDIEYMLKINYYPPCPRPDLALGVVAHTDLSALTVLVPNEVPGLQV 240 Query: 238 WKDDYWVAVDYLPNALFVHVGDQIEV 263 +KDD W+ Y+P H G QIE+ Sbjct: 241 FKDDRWIDAKYIPTLSSSHRG-QIEI 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53740 (145 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47995 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3305 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37497 82 9e-18 >Cs37497 Length = 285 Score = 81.6 bits (200), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 77/278 (27%), Positives = 122/278 (43%), Gaps = 28/278 (10%) Query: 15 LEGKVVMVTGASSGLGSEFCLNLAKAGCKIVAAARRVDRLKSLCDEINNLTHSNLPPNAD 74 L+GKV ++TG + G+G +K G K++ A + D +S+C +I + + S Sbjct: 14 LQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIGSSSSS------- 66 Query: 75 PPLRAVAVELDVTSDGSSIGASVQKAWEAFGRIDALLNNAGIRGNVN-SPLDISEEEWNN 133 V DVT + I +V A +G++D + NNAG V + LD + E+ Sbjct: 67 -ASGCSYVHCDVTKE-KDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFER 124 Query: 134 TLKTNLTGSWLVSKYVGMRMRDAKXXXXXXXXXXXAALNRGQLPGGVAYVSSKSGLSAMT 193 L NL G++L +K+ M+ A + AY SSK GL + Sbjct: 125 ILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATH---AYASSKHGLLGLM 181 Query: 194 KVMALELGAYNIRANAIAPGLFKSEITSGLMQKDWLNTVAQRTCPMRT------FGTSDP 247 K A+ELG + IR N ++P + S + KD+L M + D Sbjct: 182 KNTAVELGRFGIRVNCVSP-----YVVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDI 236 Query: 248 ALTSLVRYLIHDSSRYISGNIFIVDAGATL--PGVPIF 283 A +L YL D S+ +SG+ +VD G + G +F Sbjct: 237 AEAAL--YLGSDESKCVSGHNLVVDGGFAIVNAGFSVF 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17959 (231 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16453 130 1e-32 >Cs16453 Length = 223 Score = 130 bits (326), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 70/186 (37%), Positives = 107/186 (57%), Gaps = 4/186 (2%) Query: 42 YKELKIATDSFHPSNKIGEGGFGSVYKGQLRDGTTVAVKVLSVEI--ESMRGEREFVSEL 99 Y+E+ AT+ F+ + IG+GG GSVY+ ++ G AVK + E + EF++E+ Sbjct: 33 YEEIISATNDFNAEHCIGKGGHGSVYRAKVPSGEIFAVKKFHSPLPGEMSFQQEEFLNEI 92 Query: 100 SALTDIKHENLVTLQGCCVEGASRFLVYDYMENNSLAQTLLGAKQNRMEFGWEARRDISL 159 ALT+I+H N+V C F++Y+Y+E+ SL + L + E GW R ++ Sbjct: 93 QALTEIRHRNIVKFYCFCSHPKHSFIIYEYLESGSLDKILCNDASAK-ELGWTQRLNVIK 151 Query: 160 GVGRGLAYLHEEIQPHIIHRDIKAANILLDQNLAPKISDFGLSKLFVDSRSHISTRVAGT 219 GV L YLH P I+HRDI + N+LLD +SDFG++K F++ S + +AGT Sbjct: 152 GVADALFYLHNNCFPPIVHRDISSKNVLLDLGYEAHVSDFGIAK-FLNPDSSNWSELAGT 210 Query: 220 LGYLAP 225 GY+AP Sbjct: 211 HGYVAP 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1663 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22751 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23666259 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2794 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76516 283 2e-78 >Cs76516 Length = 291 Score = 283 bits (723), Expect = 2e-78, Method: Compositional matrix adjust. Identities = 138/286 (48%), Positives = 190/286 (66%), Gaps = 10/286 (3%) Query: 14 ALLISVVVSFLMAA--SAGNFYQDFGITWGDGRAKILDNGEFLTLSLDKTSGSGFQSKNE 71 +L+ S+ V LM S+ F + +W + +G+ L L+LD SG+GF SK++ Sbjct: 5 SLIFSLFVGLLMVVLVSSAKFDDLYQTSWAFDHVQY--DGDTLKLNLDNYSGAGFASKSK 62 Query: 72 YLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFSQGK 131 YLFGK+ +Q+KLV G+SAGTVTA+Y+SS GP H+E DFEFLGN +G+PY++ TNV+ G Sbjct: 63 YLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYVNGV 122 Query: 132 GNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPYPKNQPMRIY 191 GNREQ+ LWFDPT +FHTYS+LWN ++++F VD TPIR N E G+P+PK+Q M +Y Sbjct: 123 GNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKDQAMGVY 182 Query: 192 SSLWNADDWATRGGLIKTDWTQAPFTASYRNFNADACIWFFG-AXXXXXXXXXXXXXXXD 250 SS+WNADDWAT+GG +KTDW+ APF ASY+ F+ DAC A Sbjct: 183 SSIWNADDWATQGGRVKTDWSHAPFIASYKGFDIDACECPASVAGADNAKKCSSSAEKRF 242 Query: 251 WYSQ----ELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT 292 W+ + EL+ ++ WV+ N++IY+YCTDT RFP +P EC Sbjct: 243 WWDEPTLSELNVHQSHQLMWVRANHLIYDYCTDTSRFP-AIPTECV 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45320 (458 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60432 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35776 (532 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61185 (361 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39278 149 3e-38 >Cs39278 Length = 181 Score = 149 bits (377), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 96/187 (51%), Positives = 115/187 (61%), Gaps = 25/187 (13%) Query: 193 DGVVPVQAKDPSP---------PVTNHPADNCFELDFSRSKLSAYNYTAXXXXXXXXXXD 243 D VVPVQ P P P+ N+ +NCF++DF RSKLS++NY + D Sbjct: 2 DSVVPVQTTKPEPIPAQAAAPIPLINN--ENCFDIDFCRSKLSSFNYQS--QSVSSSSLD 57 Query: 244 VGVVPDGNCNSMSDTSYPSMKQVXX-------XXXXXXXXXXXXXXXXMDREARVLRYRE 296 VGVVPDG NSMSD SY + + +DREARVLRYRE Sbjct: 58 VGVVPDG--NSMSDISYTFGRNMSTGSGADPSVTVSAPGANQASQLCGIDREARVLRYRE 115 Query: 297 KRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTEMESEMVDHIYNS--ASAAAFMVDAG 354 KRKNRKFEKTIRY SRKAYAETRPRIKGRFAKR E +SE VD +Y S ++A A++ D+ Sbjct: 116 KRKNRKFEKTIRYHSRKAYAETRPRIKGRFAKRAEADSE-VDRLYKSAASAAGAYLADSQ 174 Query: 355 YGVVPSY 361 YGVVPS+ Sbjct: 175 YGVVPSF 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33350 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25776 91 7e-21 >Cs25776 Length = 104 Score = 90.9 bits (224), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 42/97 (43%), Positives = 61/97 (62%), Gaps = 2/97 (2%) Query: 90 MAPELLSGKTNMVTEKIDVYSFGIVMWELLTGDEPYADMHCASIIGGIVNNTLRPQIPRW 149 MAPE L G+ + EK DVYSFG+++WEL+T +P+ + A ++G + R IP+ Sbjct: 1 MAPEFLRGEPS--NEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQN 58 Query: 150 CEPEWKYLMESCWASDPAERPSFSEISQKLRNMADAP 186 P LMESCWA DPA+RPSF+ I + L+ + +P Sbjct: 59 TSPVLASLMESCWADDPAQRPSFANIVESLKKLLKSP 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20565 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39703 (285 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9011 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3951 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38144 (274 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49533 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 170 3e-45 >Cs169106187 Length = 148 Score = 170 bits (431), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 79/83 (95%), Positives = 83/83 (100%) Query: 3 EVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 62 +VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 63 MYKTDRAKYETTARSWTQKYAMG 85 MYK+D+AKYE+TARSWTQKYAMG Sbjct: 126 MYKSDKAKYESTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40129 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48939 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27115 (141 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53215 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15666258 (608 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47367 67 6e-13 >Cs47367 Length = 140 Score = 66.6 bits (161), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 38/110 (34%), Positives = 59/110 (53%), Gaps = 4/110 (3%) Query: 490 MLYAAADMVLVPSIYEPCGLAQMIGMRYGAIPIVRKTGGLADTVFD--MDDQLHRETANG 547 M+ A AD +L+PS +EPCGL Q+ MRYG +PIV TGGL DTV + Q+ + + Sbjct: 1 MIIAGADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDC 60 Query: 548 FVFEGIDEGSLNWALDRAFSFYREKPEEWNTTIQKVMEIDNSWNNTAGKY 597 + +D +++ + RA + Y + ++ M D SW A K+ Sbjct: 61 EAVDPVDVAAVSTTVRRALATYGT--QALAEMMKNGMAQDLSWKGPAKKW 108 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20292 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6226 (404 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47538 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43368 (465 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16766258 (393 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs62191 164 2e-42 >Cs62191 Length = 244 Score = 164 bits (415), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 84/221 (38%), Positives = 129/221 (58%), Gaps = 2/221 (0%) Query: 174 LFVMGFIAGGFILGAVHNPXXXXXXXXXXXXXXXXXXWNTYW--GRRAITGFIARYPDAE 231 LF++G FIL VH+ WN + A++ F+ +PD++ Sbjct: 23 LFIIGLSVSVFILIVVHDAAFLLFFLLPSTFVICFIAWNMLNRNHKAALSLFVRSFPDSD 82 Query: 232 LRTARDGQFVKVSGVVTCGNVPLESSFQRVPRCVYTSTSLYEYRGWDSKAANPTHRRFTW 291 LR A GQ VK++G+ +CG+V LESS+++ RC+YTST LYEY K W Sbjct: 83 LRLAPHGQLVKITGLASCGSVSLESSYEKATRCIYTSTLLYEYGRLGLKPVYVNKSCCQW 142 Query: 292 GLRSLERHVVDFYISDFQSGLRALVKTGYGARVTPYVDESVVVDINQSNRDMSPEFIRWL 351 L ER DFYI+D +SG+R LVK G G +V P + ES +V + +R +S +WL Sbjct: 143 SLAYCERFSTDFYITDRKSGIRVLVKAGSGCKVLPLICESNIVTTSGCSRILSTHLRKWL 202 Query: 352 GERNLSSDDRVMRLKESYIKEGSTVSVMGVVQRNEIVLMIV 392 +RNL ++ R++RL+E Y++EGS+V+V+G++ ++ +LMIV Sbjct: 203 RDRNLPAEARLLRLEEGYVQEGSSVTVVGMLCKDNDLLMIV 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39293 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13481 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61762 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4466264 (57 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61067 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3063 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36389 (542 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67211 525 e-151 >Cs67211 Length = 534 Score = 525 bits (1351), Expect = e-151, Method: Compositional matrix adjust. Identities = 282/442 (63%), Positives = 318/442 (71%), Gaps = 25/442 (5%) Query: 109 NRGKCLSESKELIPPHLVSDEPSQVDPYWERSSNIASASFKDLHPLDPVSANARANMGAV 168 N GK L++SKEL+PP LVSD+ S + Y +RS AS SFKD + VS N AN AV Sbjct: 110 NHGKGLADSKELVPPCLVSDDSSPNEYYRDRSGTTASTSFKDQESSESVSVNDSANKNAV 169 Query: 169 NVHNSMDKDRSNSGAGVIHSSSSHAPEHRASYS----DGASAE----NHVSGVSAIDNSS 220 N N GV S PE SYS D ASAE H S V + NS Sbjct: 170 N-------GIENPAEGV----SQIGPEPSCSYSQSLEDSASAEVSVETHESEVIPVHNSH 218 Query: 221 SVSVPAVTDSPVTLHSQGDESIQEAIPSGLGIVVSXXXXXXXXXXXXSVLHVDVVSISSN 280 S V +D PV HS G+ESI+ A+P GLG ++S +VLHVDVVSISSN Sbjct: 219 SDPVSLASDIPVAFHSLGEESIRGALPGGLGFLLSNRDQDRVDG---NVLHVDVVSISSN 275 Query: 281 ILSSTTAEVSNREARRNSRRLFWDAFXXXXXXXXXXXPTIVFSTDDTDDLGSHDRWLLDF 340 ILS A+ NREARRNSRR+F DAF PTIVFSTDDT DLGSHDRWLLDF Sbjct: 276 ILSRGNADTDNREARRNSRRMFRDAFSRRSSRRLTDSPTIVFSTDDTGDLGSHDRWLLDF 335 Query: 341 SGDFFEDGVGGDSGYLGSRIHSMNERRWHSRSEIWERLRGGLDESSRRTTTCPTGLHPDG 400 SGD+F+DGVGGDSGYLG R+HS+NERR HSRSEIWERLR GLDE+SRRTT CP+GLHPDG Sbjct: 336 SGDYFDDGVGGDSGYLGRRVHSLNERRRHSRSEIWERLRAGLDENSRRTTFCPSGLHPDG 395 Query: 401 MCSCDSFLMAEESSTRASISRIVMLAEALFEVLDEIHRQPVSLALSMVSLPAPESVVDSF 460 CSC+SF+M+E+S TRA ISRIVMLAEALFEVLDEIHRQPVSL+LSMVSLPAPESVVDSF Sbjct: 396 TCSCESFVMSEDSGTRA-ISRIVMLAEALFEVLDEIHRQPVSLSLSMVSLPAPESVVDSF 454 Query: 461 PLKNHKKADTAQSGEDVAQCYICLAEYEEGDKIRVLPCHHEYHMSCVDKWLKEIHGVCPL 520 P+K+HKK D A+ G + QCYICLAEYEEGD+IR+LPCHHEYHMSCVDKWLKEIHGVCPL Sbjct: 455 PIKSHKKGDKAEGGVEPDQCYICLAEYEEGDRIRLLPCHHEYHMSCVDKWLKEIHGVCPL 514 Query: 521 CRGDVREGLTGGSVSNGETPSL 542 CR DVR+G T SN E PS+ Sbjct: 515 CRRDVRQGAT--ESSNSEIPSV 534 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20864 (130 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56446 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26435 88 9e-20 >Cs26435 Length = 278 Score = 87.8 bits (216), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 61/226 (26%), Positives = 111/226 (49%), Gaps = 17/226 (7%) Query: 12 LADLHHPNVVAFYGV-VLDGPGGSVATVTEYMVNGSLRNSLQKNEKNLDKRKRLLIAMDV 70 L L H N+V +YG V+D + EY+ GS+ ++++ +++ + + Sbjct: 39 LGHLKHENIVQYYGSEVVDD---HLYIYLEYVHPGSINRYVREHCRDITESIVRNFTRHI 95 Query: 71 AFGMEYLHGKNIVHFDLKSDNLLVNLRDPHRPICKVGDLGLSKVKCQPLISGGVRGTLPW 130 G+ YLH N +H D+K NLLV+ + K+ D G++K ++G+ W Sbjct: 96 LNGLAYLHSTNTIHRDIKGANLLVDASG----VVKLADFGMAKHLTGLSYELSLKGSPNW 151 Query: 131 MAPELLNG-----SSSLVSEKVDVFSFGIVMWELLTGEEPYADLHYGAIIGGIVSNTLRP 185 MAPE++ + ++ VD++S G + E+LTG+ P+++ + +++ T P Sbjct: 152 MAPEVIKAVMQKDGNPKLALAVDIWSLGCTVIEMLTGKPPWSEFEGPQAMFKVLNRT--P 209 Query: 186 SVPEFCDPEWRALMERCWSSEPSERPSFTEIANQ--LRSMAAKIPP 229 +PE E + + RC+ P ERPS E+ +R+ KI P Sbjct: 210 PIPEMLSSEGKDFLLRCFLRNPVERPSAVELLEHPFIRNAIIKICP 255 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25846 (432 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7913 (224 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs13761 98 9e-23 >Cs13761 Length = 473 Score = 97.8 bits (242), Expect = 9e-23, Method: Compositional matrix adjust. Identities = 65/211 (30%), Positives = 93/211 (44%), Gaps = 32/211 (15%) Query: 18 NMSIHLPRSAGIIVNTFEALEPRAVETILDGLCVLDGPTPPIFCIGP--LIAVDDRXXXX 75 M LP++A + +N+FE L+P + +GP L+ D+ Sbjct: 209 QMGRQLPKAAAVFINSFEELDPELTNHLKTKF------NKKFLSVGPFKLLLASDQQPSS 262 Query: 76 XXXXXXIPECLTWLESQPKR--SVXXXXXXXXXXXXEEQLKEIAV-----GLERSGQRFL 128 CL WL+ Q K+ SV ++ IA LE S F+ Sbjct: 263 ATDLDDKYGCLAWLDKQKKKPASVAYVGFGTVATPSPNEIAAIAEDQPGPSLEASKVPFI 322 Query: 129 WVVRSPPSKDPSRRFLAPPEPDLNSLLPDGFLDRTKERGLVVKSWAPQVAVLNHASVGRF 188 W +R + LP+GFL+RT+ G+VV WA QV VL H +VG F Sbjct: 323 WSLRHRSQAN----------------LPNGFLERTRSDGIVV-DWATQVNVLAHEAVGVF 365 Query: 189 VTHCGWNSVLEAVCAGVAMVAWXLYAEQRFN 219 VTHCGW S+LE++ AGV M+ + +QR N Sbjct: 366 VTHCGWGSILESIAAGVPMIGRPFFGDQRIN 396 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38202 (478 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101682 569 e-164 >Cs101682 Length = 347 Score = 569 bits (1466), Expect = e-164, Method: Compositional matrix adjust. Identities = 274/339 (80%), Positives = 303/339 (89%) Query: 140 KSKTGDSVKCEVVDGGELKSRRHLNVRGKSATLPSITEKDWDDIKFGVDNKVDFYAVSFV 199 KSKT D VKC VVDGGELKSRRHLNVRGKSA LPSIT+KDW+DIKFGVDN+VDFYAVSFV Sbjct: 7 KSKTKDLVKCIVVDGGELKSRRHLNVRGKSANLPSITDKDWEDIKFGVDNQVDFYAVSFV 66 Query: 200 KDAKVVHELKNYLKSCNADIHVIVKIESADSIPNLHSIITASDGAMVARGDLGAELPIEE 259 KDAKVVHEL++YLKSCNADIHVIVKIESADSIPNLHSII+ASDGAMVARGDLGAELPIE+ Sbjct: 67 KDAKVVHELEDYLKSCNADIHVIVKIESADSIPNLHSIISASDGAMVARGDLGAELPIED 126 Query: 260 VPLLQEEIIRICRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAIAVREGADAVMLSGET 319 VPLLQE+IIR CRSM K VIVATNMLESMI HPTPTRAEVSDIAIAVREGADAVMLSGET Sbjct: 127 VPLLQEDIIRRCRSMQKPVIVATNMLESMIDHPTPTRAEVSDIAIAVREGADAVMLSGET 186 Query: 320 AHGKFPLKAVKVMHTVSLRTEATLVGSPMPPNLGQAFKNHMSEMFAFHATMMSNTLGTSI 379 AHGKFPLKAVKVMHTV+LRTE++L S PP A K+HM +MFAFH+T M+NTL T I Sbjct: 187 AHGKFPLKAVKVMHTVALRTESSLPVSITPPTQFSAHKSHMGDMFAFHSTTMANTLNTPI 246 Query: 380 VVFTRTGFMAILLSHYRPSGTIFAFTNEERVQQRLAVYQGVCPIYMQFSDDAEETFANAL 439 +VFTRTG MA++LSHYRPS TIFAFTN+ER++QRL +YQGV PIYMQFSDD EETF+ A+ Sbjct: 247 IVFTRTGSMAVILSHYRPSSTIFAFTNQERIKQRLVLYQGVMPIYMQFSDDVEETFSRAI 306 Query: 440 TLLQKQGMVKEGEEVALVQSGRQPIWRFQSTHNIQVRKV 478 LL + +V +GE V LVQSG QPIWR +STH+IQVRKV Sbjct: 307 KLLMDKNLVTKGEFVTLVQSGAQPIWRQESTHHIQVRKV 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39281 (339 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31687 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31403 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33937 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34026 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36796 95 6e-22 >Cs36796 Length = 99 Score = 94.7 bits (234), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 46/69 (66%), Positives = 56/69 (81%) Query: 122 LNSMQPVLSXVAVGSGWQALVAYINLGCYYIIGVPLGCLLGYLAKFGVKGLWGGMICGKA 181 +N +QPVLS VAVG+GWQ+LVAYINLGCYYI+G+PLG LLG+ FG +G+W GMI G Sbjct: 1 MNCLQPVLSGVAVGAGWQSLVAYINLGCYYIVGLPLGILLGFTFGFGAEGIWSGMIGGIG 60 Query: 182 FATLILLVI 190 TLIL+VI Sbjct: 61 LQTLILIVI 69 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19130 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10907 (415 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10475 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95552 88 5e-20 >Cs95552 Length = 262 Score = 88.2 bits (217), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 74/200 (37%), Positives = 103/200 (51%), Gaps = 29/200 (14%) Query: 1 MSKKMKRMV--MESSP---HAVYEDAKSRFKHQSLLQDFHELQKETEAMKKKLQSVNLNK 55 M KKMK + +E +P +VY+D + R +HQSL QD+ EL KE EA KKKLQ + K Sbjct: 2 MKKKMKGVAASVEIAPAPACSVYDDPRVRLRHQSLKQDYEELLKEMEAKKKKLQMMKQKK 61 Query: 56 LTLLAEVRFXXXXXXXXXXNMAPKTPPEPELKQPQNSATQLKNITREKNHSGKQAAAM-- 113 LTL +EVRF N + + Q + + +E+N+ G++AAA+ Sbjct: 62 LTLQSEVRFLRRRHQYLTANKPSTSTMGQNSVKAQQKPIPSRKMAKERNY-GRKAAALCR 120 Query: 114 ---------------------RNPAPVFGGNMKERIHKGKVAALPNPDPGYELNQKTRGY 152 RNP PVF N K + + GK + + P +LNQK R Y Sbjct: 121 PPLGFDLNKKGKAYNEKEATLRNPIPVFDLNQKLKAYNGKESTSLHSLPVLDLNQKERVY 180 Query: 153 SGKEAALRNPVPVFDLNKIS 172 S K+AA++N PVFDLN+IS Sbjct: 181 SRKDAAIQNMTPVFDLNQIS 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19945 (463 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13297 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59383 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53854 (532 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55460 (272 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53383 (292 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45652 (261 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57539 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60833 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19092 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63036 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs85196 269 1e-74 >Cs85196 Length = 149 Score = 269 bits (687), Expect = 1e-74, Method: Compositional matrix adjust. Identities = 132/149 (88%), Positives = 143/149 (95%) Query: 1 MAEQLTEEQLDEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ 60 MA+QLT++Q+ EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG 60 Query: 61 NGTIDFPEVLNLMARKMKDTDSEEKLKEAFKGFDKDQNGFISAAELRHVMTNLGEKLTDE 120 NGTIDFPE LNLMARKMKDTDSEE+LKEAF+ FDKDQNGFISAAELRHVMTNLGEKLTDE Sbjct: 61 NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120 Query: 121 EVDEMIREADVDGDGQVDYEEFVRMMLAK 149 EVDEM READVDGDG ++YEEFV++M+AK Sbjct: 121 EVDEMXREADVDGDGXINYEEFVKVMMAK 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6626 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48454 125 3e-31 >Cs48454 Length = 244 Score = 125 bits (315), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 66/150 (44%), Positives = 104/150 (69%), Gaps = 7/150 (4%) Query: 1 MVRGKIQMRRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSS- 59 M RG++Q++RIEN +RQVTFSKRR+GLLKKA+E+SVLCDAEVA+I+FS KG+L+E+S+ Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTD 60 Query: 60 SNMQSAIERYREHA---KQVETNNPELEQYMQNLKQDAESMAKKIELLEVSQRKLLGQGL 116 S M+ +ERY + +Q++ N E N + + ++E+L+ +Q+ +G+ L Sbjct: 61 SCMERILERYERYCYAERQLQANEIEPN---GNWTLEYSKLKARMEVLQRNQKHFMGEDL 117 Query: 117 SSCSLDEILEIDSQLEKSLKSIRARKAQIF 146 + SL E+ ++ Q++ LK IR+RK Q+ Sbjct: 118 ADLSLKELQSVEQQIDSGLKLIRSRKNQLM 147 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20094 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65963 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28469 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13709 (426 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23749 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs86870 138 4e-35 >Cs86870 Length = 272 Score = 138 bits (348), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 76/208 (36%), Positives = 114/208 (54%), Gaps = 4/208 (1%) Query: 2 RPEIYLFGDSITEASFCDGGWGASLAHHFSRTVDVVLRGYSGYNTRWALEVIEKVFPVVS 61 RP+ LFG SI + F +GGWGA L+ ++R D++LRGY G+N+R AL+V+++VFP Sbjct: 6 RPQFVLFGSSIVQLGFSNGGWGAILSDIYARKADILLRGYYGWNSRRALQVLDQVFP--K 63 Query: 62 RGGGAPLAVTVFFGANDACLPDRCSAFQHVPIHEYKQNLHSIVSFLKKRWXXXXXXXXXX 121 P V V+FG ND+ P HVP+ EY +N+ I + LK Sbjct: 64 DAPIQPSLVIVYFGGNDSMGPHPSGLGPHVPLPEYVENMRRIATHLKSLSCATRIIFLST 123 Query: 122 XXXDEEGRLRNPYVENPMGLPERTNEAAGAYAKACVDVAGECGGPVVDIWTKMQHISDWP 181 D E R+ E L RTNE Y+ AC+++ + G VD++T +Q DW Sbjct: 124 PPVD-EARINQGTSEIFSEL-VRTNELCQKYSDACINLCHDLGVKAVDLFTAIQKRDDWK 181 Query: 182 RICLSDGLHLTQSGNKIVFEEVVARLRE 209 C +DG+HL++ G+KIV E++ L++ Sbjct: 182 NACFTDGIHLSEEGSKIVVAEILKVLKQ 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12866259 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs71808 488 e-140 >Cs71808 Length = 264 Score = 488 bits (1255), Expect = e-140, Method: Compositional matrix adjust. Identities = 241/265 (90%), Positives = 250/265 (94%), Gaps = 2/265 (0%) Query: 1 MAASIMALSSPSFAGTTVKLGPNASDILGGGRVSMRKTGFKA-PSGSPWYGPDRVLYLGP 59 MA S MALSS SF G V L P+ +++ GGR+SMRKTG K+ SGSPWYGPDRV YLGP Sbjct: 1 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGP 59 Query: 60 LSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSR 119 LSG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELL+R Sbjct: 60 LSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR 119 Query: 120 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGP 179 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGP Sbjct: 120 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGP 179 Query: 180 LGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE 239 LGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE Sbjct: 180 LGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE 239 Query: 240 NLADHLADPVNNNAWAYATNFVPGK 264 NLADHLADPVNNNAWAYATNFVPGK Sbjct: 240 NLADHLADPVNNNAWAYATNFVPGK 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56279 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39660 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6966261 (278 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs62644 59 5e-11 >Cs62644 Length = 272 Score = 58.9 bits (141), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 28/61 (45%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Query: 74 APPSDSWAWRKYGQKPIKGSPYPRGYYRCSSS--KGCPARKQVERSRVDPTMLVVTYSCE 131 + +D AWRKYGQK I + +PR Y+RC+ +GC A KQV+R DP M TY Sbjct: 132 STSNDGHAWRKYGQKEILNTKHPRSYFRCTHKYVQGCRATKQVQRRDDDPQMYDTTYIGH 191 Query: 132 H 132 H Sbjct: 192 H 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15977 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9834 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1732 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv166265 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2242 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1727 (325 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93563 120 2e-29 >Cs93563 Length = 164 Score = 120 bits (301), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 66/150 (44%), Positives = 88/150 (58%), Gaps = 11/150 (7%) Query: 176 VAQLDWKIIESNHEKPFVASGLQFVPLPVMHGEDYLCLGFLFGEKCKVAYISDISRFPSS 235 V++L + II+ E+PF L+ PLPV HG Y LGF FG C YISD+S P Sbjct: 26 VSELQFNIID---EEPFTVQDLKITPLPVWHGAGYRSLGFRFGNIC---YISDVSEIPEE 79 Query: 236 TEYVISKNGGGQLDLLILDTLYKKGSHNTHFCFPQTLEAVKRICPKRALLVGMTHEFDHH 295 T + ++LI+D L S +THF P+ LE V++I PKR L +GM H DH Sbjct: 80 TYPFLQ-----DCEILIMDALRPDRSSSTHFGLPRALEEVRKIQPKRTLFIGMMHLMDHE 134 Query: 296 KDNETLMEWSRREGIPVQLAHDGLRVPIDL 325 K NE L++ EG+ VQL++DGLRVP+ L Sbjct: 135 KVNEELLKLMETEGLDVQLSYDGLRVPVML 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21228 (503 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45541 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65214 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv583 (42 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1104 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43494 (505 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41034 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7708 191 5e-51 >Cs7708 Length = 215 Score = 191 bits (484), Expect = 5e-51, Method: Compositional matrix adjust. Identities = 94/146 (64%), Positives = 113/146 (77%), Gaps = 1/146 (0%) Query: 35 TEILTPAK-AGISSDEKTPFITFVVGGPGSGKGTQCAKIVETFGFTHISAGELLRREISC 93 T + TP K A + K P + FV+GGPGSGKGTQCA IVE FG+TH+SAG+LLR EI Sbjct: 3 TVVETPVKEADATVTVKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS 62 Query: 94 NSEHGSMILDSIREGKIVPSEVTVKLIEKEMESSKNNKFLIDGFPRTEENRIAFERVIGA 153 SE+G+MI + I+EGKIVPSEVT+KL++K ME S N+KFLIDGFPR EENR AFE V Sbjct: 63 GSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKI 122 Query: 154 EPXFVLFFHCPEEEMVKRLLSRNEGR 179 EP FVLFF C EEEM +R+L+RN+GR Sbjct: 123 EPEFVLFFDCSEEEMERRILNRNQGR 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38447 (255 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43152 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78954 139 9e-36 >Cs78954 Length = 207 Score = 139 bits (350), Expect = 9e-36, Method: Compositional matrix adjust. Identities = 71/121 (58%), Positives = 84/121 (69%), Gaps = 3/121 (2%) Query: 1 MDHFMDNPFLSTSRGMGTGIRRSWDVKETDDALHLRVDMPGLSKEDVKVSVEQNTLTIQG 60 MD +NPF S +RG G+RR WD KETDDAL+L +DMPGL KEDV+VS+EQNTL I+G Sbjct: 90 MDQMTENPFFSGTRG---GLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRG 146 Query: 61 EEKNXXXXXXXXXXXXXXIDLPEKLYKTGEIKAEMNKGVLKIVVPKLKEEERTDVINVKV 120 E IDLPEKLY+T +IKAEM GVLK+ VPK+KEEER DV VKV Sbjct: 147 EGGKEGEDEESVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKV 206 Query: 121 E 121 + Sbjct: 207 D 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16110 (298 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8310 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4384 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25963 330 6e-93 >Cs25963 Length = 248 Score = 330 bits (846), Expect = 6e-93, Method: Compositional matrix adjust. Identities = 163/195 (83%), Positives = 168/195 (86%) Query: 1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRATRPTRPDKARRLGYKAKQXXX 60 MGAY +VSELWRKKQSDVMRFLQRVRCWEYRQHPSIVR TRPTRPDKARRLGYKAKQ Sbjct: 1 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV 60 Query: 61 XXXXXXXXXXXXXXXXXXXVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYW 120 VYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYW Sbjct: 61 VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW 120 Query: 121 INEDSTYKYYEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL 180 INEDSTYKY+EVILVD AHNAIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGKGHL Sbjct: 121 INEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHL 180 Query: 181 HHKARPSRRATWKRN 195 HHKARPSRRAT KRN Sbjct: 181 HHKARPSRRATXKRN 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3268 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11666263 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs191106188 158 2e-41 >Cs191106188 Length = 122 Score = 158 bits (399), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 76/122 (62%), Positives = 89/122 (72%), Gaps = 3/122 (2%) Query: 3 LLEKLWDDVVAGPQPDRGLGKLRKLTTKPLSVKTD---EGESSKYQRSMXXXXXXXXXXX 59 +LEKLWDDVVAGPQPDRGLG+LRK+TT PL+VK E S K+QRS+ Sbjct: 1 MLEKLWDDVVAGPQPDRGLGRLRKITTTPLAVKEGGEAESSSGKFQRSLSMPASPGAPST 60 Query: 60 XXXXXXXXXXRKDNVWRSVFHPGSNLATKGMGSDYFDKPTKKDTPTVYDWLYSGETRTKH 119 RKDNVWRSVFHPGSNLAT+G+G++ FDKPT ++PTVYDWLYSGETR+KH Sbjct: 61 PVTPTTPLSARKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 120 Query: 120 HH 121 HH Sbjct: 121 HH 122 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5128 (356 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27164 (381 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25880 89 7e-20 >Cs25880 Length = 125 Score = 89.0 bits (219), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 61/119 (51%), Positives = 75/119 (63%), Gaps = 15/119 (12%) Query: 12 SSLWNSNCRSFGTPDTLARTLASSNVFSRRH---KRVV--WCSNNPTCTRE--------- 57 SS++ +N RS G P +L RTLAS++ R+ VV + S+N E Sbjct: 7 SSIFTNNGRSLGAPVSLLRTLASTHASCHRNIYKSNVVLSFSSSNRNFVCESWKRHVFTH 66 Query: 58 -LTASSDSANTSSVNGYPEYHRLLPCPSQNGPPRVEHLVVSEGGCVLDYISKALDLPPL 115 TA+ +A T S GYPEYHRLLPCPSQN PPRVEHLVVSEGG VL+YI + L+LPPL Sbjct: 67 TDTAAIAAATTPSSYGYPEYHRLLPCPSQNCPPRVEHLVVSEGGPVLEYICRELNLPPL 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48577 (514 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10975 (393 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69106190 581 e-168 >Cs69106190 Length = 396 Score = 581 bits (1498), Expect = e-168, Method: Compositional matrix adjust. Identities = 291/397 (73%), Positives = 316/397 (79%), Gaps = 5/397 (1%) Query: 1 MISSIKQSTGSFTRCDFLPRRQRCVAKSDVVSVPSSAN--VQGFKCSAKPLYICSVEXXX 58 MISS+K + S DFLP+++ +P N S KPL+I S + Sbjct: 1 MISSVKHTPFS-ASTDFLPKKRFLTPTLKFSPLPIIQNSIFNNKFSSEKPLHISSTQNLT 59 Query: 59 XX--XXXXXXXXVCRAYEAERSQPLDLNIELSDQEARSEAAQKLKIGIYFATWWALNVVF 116 C AYEA+RS+PLD+NIE+ D++AR EAAQ+LKIGIYFATWWALNVVF Sbjct: 60 FSPKEQQKELKTQCNAYEADRSRPLDINIEVLDEQARFEAAQRLKIGIYFATWWALNVVF 119 Query: 117 NIYNKKVLNAFPYPWXXXXXXXXXXXXXXXISWAVRIAEPPKTDLDFWKTLFPVAVAHTI 176 NIYNKKVLNAFPYPW +SWA RIAE PKTDL+FWK+LFPVAVAHTI Sbjct: 120 NIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIAEAPKTDLEFWKSLFPVAVAHTI 179 Query: 177 GHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLLGETFPVPVYFSLLPIIGGCALAAV 236 GHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFL GET P+PVY SLLPIIGGCALAAV Sbjct: 180 GHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLFGETLPMPVYMSLLPIIGGCALAAV 239 Query: 237 TELNFNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVGGMNYYACLSMLSLLILTPFAIAV 296 TELNFNM GFMGAMISNLAFVFRNIFSK+GMKGKSVGGMNYYACLSM+SLLILTPFAIAV Sbjct: 240 TELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILTPFAIAV 299 Query: 297 EGPQMWAAGWQKAISQIGPNFIWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRX 356 EGPQMWAAGWQKAI+QIGPNF+WWVAAQS+FYHLYNQVSYMSLDQISPLTFSIGNTMKR Sbjct: 300 EGPQMWAAGWQKAIAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRI 359 Query: 357 XXXXXXXXXFHTPVQPVNALGAAIAILGTFLYSQAKQ 393 FHTPVQPVNALGAAIAILGTF+YSQAKQ Sbjct: 360 SVIVSSIIIFHTPVQPVNALGAAIAILGTFIYSQAKQ 396 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59138 (341 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56886 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40797 (71 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8263 (460 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19366261 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6466264 (255 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104648 197 1e-52 >Cs104648 Length = 236 Score = 197 bits (500), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 106/232 (45%), Positives = 137/232 (59%), Gaps = 6/232 (2%) Query: 1 MLAIFHKAFAHPPEELNSPASRDGSRKPKLPEETLREFLSAHPANTFSMSFGTAAALAYV 60 ML +F A PPEEL + SR S PK L + ++ S+ G LAY Sbjct: 1 MLGVFSSAIVSPPEELVAAGSRTPS--PKTTSTALVDRFLQTNSSAVSVQVGDNVTLAYT 58 Query: 61 SPDRSYPTHQRLFGGFDDIYCLFMGSLNNLCILNRQYGLSKGSNEAMLVIEAYRTLRDRG 120 + S P QR F D+I+CLF G+L+NL L +QYGL+K +NE +LVIEAY+ LRDR Sbjct: 59 HQNES-PLRQRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRA 117 Query: 121 PYPADQVVKDLEGSFAFVVYDSKAGTVFTALGSDGGVKLFWGVAADGSVVISDDLGVIKA 180 PYP + VV L G FAF+VYD T+F A G V L+WG+ ADG V +DD ++K Sbjct: 118 PYPPNHVVGHLSGYFAFIVYDKSTSTLFVASDQFGKVPLYWGITADGHVAFADDADLLKG 177 Query: 181 GCAKSFAPFPTGCMFHSD-GGLMSFEHPMNKMKAMPRIDSEGVMCGANFKVD 231 C KS A FP GC F + GGL SFE+P NK+ A+P + E + GA FKV+ Sbjct: 178 ACGKSLASFPQGCFFSTAVGGLRSFENPKNKITAVPAAEEE--IWGATFKVE 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3122 (506 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65797 (399 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22966261 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs137106189 86 1e-19 >Cs137106189 Length = 100 Score = 85.5 bits (210), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 51/92 (55%), Positives = 67/92 (72%), Gaps = 5/92 (5%) Query: 2 SKQYPQTHLKTPCLTSDFPQFLRS-TMS-TCGNCDCADKSQ--KKGNAYGIDIVETEKSY 57 SK ++ K P ++S Q L S MS TCGNCDCAD+SQ KKG++Y D VET+ S+ Sbjct: 7 SKAKQVSYNKEPSISSFKFQVLSSINMSDTCGNCDCADRSQCVKKGSSYAADFVETDLSF 66 Query: 58 VATVV-MEVPAAQHEGSCKCGDSCACIDCTCG 88 V+TVV M+V AA+ EG+CKCG +CAC++CTCG Sbjct: 67 VSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 98 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49553 (139 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs45360 148 2e-38 >Cs45360 Length = 378 Score = 148 bits (374), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 4/137 (2%) Query: 1 MDRVEASKIAMTTWAKWVDENIDPSKPRVFFQGVSAVHVIGADWDEPGAKQCIGQTPPVN 60 M+R+ A +TTWA+WV+ N+DP+K +VFFQG+S H G DW+EP +K C GQT P Sbjct: 245 MNRLVAFYKGLTTWARWVNFNVDPTKTKVFFQGISPTHYEGRDWNEP-SKSCSGQTKPYF 303 Query: 61 GSAYPGGTLPAEDVLRSIISRMKNPPFLMAIPLLTQLRKDGHSSVYAGQGKALVDCSHWC 120 G YP GT VL+ + SR++ P +L+ I L+Q RKD H S Y G DCSHWC Sbjct: 304 GYKYPAGTPMPWVVLQKVFSRLRKPVYLLDITRLSQYRKDAHPSEYGGHSD---DCSHWC 360 Query: 121 LAGVPDSWNELLYAALL 137 L G+PD+WN+L+YAAL Sbjct: 361 LPGLPDTWNQLMYAALF 377 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33541 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs45360 316 1e-88 >Cs45360 Length = 378 Score = 316 bits (810), Expect = 1e-88, Method: Compositional matrix adjust. Identities = 148/245 (60%), Positives = 182/245 (74%), Gaps = 4/245 (1%) Query: 6 LSLNQWQSLTCMLHAAVPRSRYTVDRQNDLSTFTMPEFGISIYLSHNDFLVDLVKEKVGK 65 LSLNQWQSL CM+H+ VP+++Y+V R LS+ T EFG+ I L +LVDLV+E G Sbjct: 137 LSLNQWQSLACMIHSWVPKTKYSVVRTAVLSSITFQEFGLQILLYRTTYLVDLVREPAGT 196 Query: 66 VLRLDSIVGGNAWKGFDMLIFNTWHWWIHKGSKQPWDYIEIGGKYYRDMNRLVAFKEGLT 125 VLRLDSI GGNAW+G DMLIFNTWHWW H G QP+DYI G K Y+DMNRLVAF +GLT Sbjct: 197 VLRLDSIKGGNAWRGMDMLIFNTWHWWTHTGRSQPFDYIREGRKLYKDMNRLVAFYKGLT 256 Query: 126 TWSKWVESNINPAVTRVFFQGISPTHYNGDEWKQSGSTTCNGQTQPLSGSMYPGGMPSEA 185 TW++WV N++P T+VFFQGISPTHY G +W + S +C+GQT+P G YP G P Sbjct: 257 TWARWVNFNVDPTKTKVFFQGISPTHYEGRDWNEP-SKSCSGQTKPYFGYKYPAGTPMPW 315 Query: 186 KILKEVLSKMSKPVQLLDITTLSQLRKDGHPSYYGNNGRKEDDCSHWCLAGVPDTWNELL 245 +L++V S++ KPV LLDIT LSQ RKD HPS YG + DDCSHWCL G+PDTWN+L+ Sbjct: 316 VVLQKVFSRLRKPVYLLDITRLSQYRKDAHPSEYGGH---SDDCSHWCLPGLPDTWNQLM 372 Query: 246 YASLI 250 YA+L Sbjct: 373 YAALF 377 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34883 (63 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24125 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11572 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13534 (67 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2167 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39992 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24718 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37428 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34509 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52603 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103814 160 9e-42 >Cs103814 Length = 211 Score = 160 bits (405), Expect = 9e-42, Method: Compositional matrix adjust. Identities = 104/210 (49%), Positives = 121/210 (57%), Gaps = 15/210 (7%) Query: 3 QQPPQMMNIAPSFPPTAITTEQIQKYLDENKQLILAILENQNLGKLAECAQYQAQLQKNL 62 QQPPQM+ + PSFPPT ITTEQIQKYLDENK+LILAIL+NQNLGKL ECA YQAQLQKNL Sbjct: 2 QQPPQMIPVMPSFPPTNITTEQIQKYLDENKKLILAILDNQNLGKLTECAHYQAQLQKNL 61 Query: 63 IYLAAIADXXXXXXXXXXXXXIHHAMQ-QGHYMQHPXXXXXXXXPGMFGAKLPFQLSDXX 121 +YLAAIAD H AMQ G+YMQHP G+F K+P Q ++ Sbjct: 62 MYLAAIADAQPQAPTMPPQMAPHPAMQASGYYMQHPQAAAMAQQQGIFPQKMPLQFNNPH 121 Query: 122 XXXXXXXXXXXXXXPIQGLMGMRP-IINNGMH---------QAMQTGLGALSGLMDVR-G 170 +Q MGMRP NNGMH G + SG D+R G Sbjct: 122 QLQDPQQQLHQHQA-MQAQMGMRPGATNNGMHPMHAESSLGGGSSGGPPSASGPGDIRGG 180 Query: 171 SKPDGSEVGS--GDGQGKSASGHGSGNRDS 198 +K D SE G+ DGQG SA GHG ++ Sbjct: 181 NKQDASEAGTTGADGQGSSAGGHGGDGEEA 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49015 (278 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92457 308 6e-86 >Cs92457 Length = 274 Score = 308 bits (788), Expect = 6e-86, Method: Compositional matrix adjust. Identities = 151/265 (56%), Positives = 197/265 (74%), Gaps = 7/265 (2%) Query: 13 VMIREVWAENLESEFELISDLIDQYPFISMDTEFPGVVFRPSGGEQQFRLRRPSDHYRFL 72 + IREVW++NLE EF+LI ++D YP+++MDTEFPG+ RP G + HY+ L Sbjct: 10 IQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKS----SYEYHYQTL 65 Query: 73 KSNVDALCLIQVGLTLSDANGNLPDLGTGNRFIWEFNFRDFDVARDAHSPDSIELLSRQG 132 KSNVD L LIQ+GLT SD NGNLP GT +W+FNFR+FDV D + DSIELL + G Sbjct: 66 KSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIELLKQSG 125 Query: 133 IDFDRNREEGVDSARFAELMMSSGLVCNESVSWVTFHSAYDFGYLVKILTRRSLPSGLEE 192 I+F +N E G+D+ RF ELMMSSG+V ++S+ WVTFHS YDFGYL+K+LT ++LP E Sbjct: 126 INFTKNNEIGIDAMRFGELMMSSGIVLSDSMHWVTFHSGYDFGYLLKLLTCQNLPDTQVE 185 Query: 193 FLSILRVFFGTKVYDVKHLMKFCASLYGGLDRVARTLEVDRAVGKCHQAGSDSLLTWHAF 252 F +++R++F T VYD+KHLMKFC SL+GGL+++A LEV+R VG CHQAGSDSLLT F Sbjct: 186 FFNLIRIYFPT-VYDIKHLMKFCNSLHGGLNKLAELLEVER-VGICHQAGSDSLLTASTF 243 Query: 253 QKIRDVYFEKDGTEKYAGVLYGLEV 277 +K+++ +F EKYAGVLYGL V Sbjct: 244 RKLKENFFSS-SLEKYAGVLYGLGV 267 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51469 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14666265 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60386 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26266262 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3113 (393 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16961 325 7e-91 >Cs16961 Length = 301 Score = 325 bits (832), Expect = 7e-91, Method: Compositional matrix adjust. Identities = 165/269 (61%), Positives = 202/269 (75%), Gaps = 9/269 (3%) Query: 21 VIVVGAGPSGLATAASLNLLSIPNIVLEREDCFAPLWQKKSYDRLHLHLPKQACELAHMP 80 VI+VGAG SGLATAA L+L SIP ++LERE+C+A +W+K SYDRL LHL KQ C+L H+P Sbjct: 10 VIMVGAGTSGLATAACLSLQSIPYVILERENCYASIWKKYSYDRLRLHLAKQFCQLPHLP 69 Query: 81 MPTSYPTYPSRLQFIQYLRDYVSHFGISPV--YHRLVESASFDEVTEKWKVKVRVINGGS 138 P+SYP + SR QFI++L YVSHF I P Y R VESAS+DE T W VK + Sbjct: 70 FPSSYPMFVSRAQFIEHLDHYVSHFNIGPSIRYQRSVESASYDEATNMWNVKASNLLSPG 129 Query: 139 DEIEEY-SCRFLVVASGETSDAFIPEVEGLSSF------KGEVLHSTQYKCGKEYAEKTV 191 EIEEY S RFLVVASGET++ F P++ GL SF GEV+HSTQYK GK Y K V Sbjct: 130 REIEEYYSGRFLVVASGETTNPFTPDIRGLCSFCSSATGTGEVIHSTQYKNGKPYGGKNV 189 Query: 192 LVVGSGNSGMEIALDLSNYGAKTSIVVRSPVHILSKEIMHLGLFLARYLPFNMVEYLTVM 251 LVVGSGNSGMEIALDL+N+ AKTS+VVRSPVH+LS+E+++LG+ L +Y PF V+ L VM Sbjct: 190 LVVGSGNSGMEIALDLANHAAKTSLVVRSPVHVLSREMVYLGVVLFKYGPFGWVDTLMVM 249 Query: 252 LSKIMYGDLTKYGIIRHEEGPFTVKAKYG 280 LS++ YGDL+KYGI + EGPF +KA YG Sbjct: 250 LSRLGYGDLSKYGIPKPREGPFFMKAAYG 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65380 (241 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51169 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47835 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14001 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4698 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40297 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16198 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41286 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21434 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566261 (365 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566257 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59489 (375 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41944 697 0.0 >Cs41944 Length = 375 Score = 697 bits (1799), Expect = 0.0, Method: Compositional matrix adjust. Identities = 327/375 (87%), Positives = 351/375 (93%) Query: 1 MVDNTRNSTGGQLSDFPAVPTHGGLFFQHNIFGNLFEITAKYRPPIMPIGRGAYGIVCSV 60 M D + + GQ +DFPAVPTHGG F Q+NIFGNLFEITAKYRPPIMPIGRGAYGIVCSV Sbjct: 1 MADVAQVNGVGQTADFPAVPTHGGQFIQYNIFGNLFEITAKYRPPIMPIGRGAYGIVCSV 60 Query: 61 LNSETNEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENVIGIRDVVPPPLRREFSDV 120 LN+ETNE+VAIKKIANAFDNHMDAKRTLREIKLL+H DHENVI ++DVVPPPLRREF+DV Sbjct: 61 LNTETNELVAIKKIANAFDNHMDAKRTLREIKLLQHFDHENVIAVKDVVPPPLRREFTDV 120 Query: 121 YIATELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNAN 180 YIA ELMDTDLHQIIRSNQ LSEEHCQYFLYQ+LRGLKYIHSANVIHRDLKPSNLLLNAN Sbjct: 121 YIAAELMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLLLNAN 180 Query: 181 CDLKICDFGLARPTAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR 240 CDLKICDFGLARPT+ENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR Sbjct: 181 CDLKICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR 240 Query: 241 RPLFAGKDHVHQMRLLTELLGTPTESDLGFVRNDDARRYIMQLPQHPRQPLVNVFPHIHP 300 RPLF GKDHVHQMRLL ELLGTPT++DLGFVRN+DA+RYI QLPQHPRQ L VFPH+HP Sbjct: 241 RPLFPGKDHVHQMRLLIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHP 300 Query: 301 LAIDLIDRMLTFDPTKRITVEEALAHPYLSRLHDTADEPVCPEPFSFEFEQQALVEEQMK 360 LAIDL+DRMLTFDP KRITV+EALAHPYL+RLHD ADEPVCPEPFSF+FEQQ+L EEQ+K Sbjct: 301 LAIDLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIK 360 Query: 361 DMIYQEALFFNPGYA 375 DMIYQEAL NPG+A Sbjct: 361 DMIYQEALALNPGFA 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25720 (176 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46148 79 4e-17 >Cs46148 Length = 148 Score = 78.6 bits (192), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 45/124 (36%), Positives = 62/124 (50%), Gaps = 14/124 (11%) Query: 22 KNPVDGFSAGLVDESNIFEWSVTIIGPPDTLYDGGFFNAIMSFPPNYPNSPPTVKFTSEV 81 K+P SAG V E ++F W TI+GPPD+ Y GG F + FPP+YP PP V F ++V Sbjct: 15 KDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKV 73 Query: 82 WHPNVYPDGRVCISILHPPGEDPNGYELASERWMPIHTVEXXXXXXXXXXXXPNDESPAN 141 +HPN+ +G +C+ IL E+W P T+ PN + P Sbjct: 74 FHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 142 IEAA 145 E A Sbjct: 121 PEIA 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3106 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84538 404 e-115 >Cs84538 Length = 216 Score = 404 bits (1037), Expect = e-115, Method: Compositional matrix adjust. Identities = 192/216 (88%), Positives = 202/216 (93%) Query: 1 MCCLFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII 60 MCCL INDLDAGAGR+GGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPII Sbjct: 1 MCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPII 60 Query: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPNREDRIGVCKGIFRSDNVPDDDIVKIVDTFPGQS 120 VTGNDFSTLYAPLIRDGRMEKFYWAP REDRIGVCKGIFR+DNV DDDIVK+VDTFPGQS Sbjct: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQS 120 Query: 121 IDFFGALRARVYDDEVRKWISGVGVDFIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 180 IDFFGALRARVYDDEVR WISG+GV IGK LVNSKE PTFEQP+MT+EKLLEYGNM+V Sbjct: 121 IDFFGALRARVYDDEVRNWISGIGVGSIGKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIV 180 Query: 181 MEQENVKRVQLADKYLSEAALGDANVDSIERGTFYG 216 EQENVKRVQLADKYLSEAALG+AN D+I+ G FYG Sbjct: 181 QEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17018 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41343 231 2e-63 >Cs41343 Length = 166 Score = 231 bits (590), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 1/164 (0%) Query: 2 AKDRKIGVAVDFSQGSNIALKWAIDNLLDKGDTLFFIHVKPSQGDESRNLLWSATGSPLI 61 + +R IGVA+DFS+GS +ALKWAIDNLL+KGDTL+ IH+K Q DESRNLLWS TGSPLI Sbjct: 3 SNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQDDESRNLLWSDTGSPLI 62 Query: 62 PLEEFRDLDVAQKYEINLDPEFLGMLATASSQXXXXXXXXXYWGDARDKLCDAVAELKLD 121 PLEEFRD +V ++YE++LD + L ML AS Q YWGDARDKLC+AV +KLD Sbjct: 63 PLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLD 122 Query: 122 SLVMGSRGLGTIQRTFLGSVTNYVMVHATCPVTIVKDPS-SHGF 164 SLVMGSRGLGTIQR LGSV+N+V+ +A+CPVTIVKDPS +HG Sbjct: 123 SLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPSAAHGI 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60079 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20041 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57327 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60046 (572 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs100466 551 e-159 >Cs100466 Length = 345 Score = 551 bits (1421), Expect = e-159, Method: Compositional matrix adjust. Identities = 263/338 (77%), Positives = 301/338 (89%), Gaps = 3/338 (0%) Query: 8 NNRRSLAMERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKEADLT 67 N R S A ERTGQWVFSQEIPTD+VV VGEANF LHKFMLVAKSNYIRKLI+ESKEADLT Sbjct: 6 NKRFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLIIESKEADLT 65 Query: 68 NIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDGNLSGRTED 127 I+LS+IPGGPE+FEKAAKFCYGVNFEITVHNVAALRCAAE+LQMTDKYC+ NL+GRTED Sbjct: 66 RINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCENNLAGRTED 125 Query: 128 FLKQVALTSLSGAVVVLKSCEDLLPKAEELKIVQRCVDVASTKACNEANFPSRSPPNWWT 187 FL QVAL+SLSGAVVVLKSCE LLP AE+L IVQRC+DVA+ KAC EANFP R+PPNWWT Sbjct: 126 FLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCIDVATAKACYEANFPCRTPPNWWT 185 Query: 188 EELSILDIGFFEKIIAAMKLRGAKSLTVASALITYTERTLRDLVRDHT-GNGIRSSDTED 246 EELSI+DI FF +IIAAMK RGAK+LT+ASALITYTER+LRDLVRDH+ GNG +SSD + Sbjct: 186 EELSIIDIEFFSRIIAAMKKRGAKALTIASALITYTERSLRDLVRDHSAGNGTKSSDAQS 245 Query: 247 SN--LRSRQRELLEAIVVLLPSERAALPINFLCCLLRSAIFLKVAHTCKNELEKRISAIL 304 +N +R +QRELLE+IV L+PSE+AA PINFLCCLLRSAIFLK + +CKNELEKR+ Sbjct: 246 TNSQVRYQQRELLESIVSLMPSEKAAFPINFLCCLLRSAIFLKASTSCKNELEKRVQLFG 305 Query: 305 EHVTVDDLLVLSFTYDGERLFDLDSVRRIISGFVEKEK 342 HV+VDDLL LSFTYDGERLFDL+SV+R + GF++++K Sbjct: 306 NHVSVDDLLGLSFTYDGERLFDLESVKRSLMGFLKRKK 343 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41997 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33767 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs49233 77 2e-16 >Cs49233 Length = 326 Score = 77.0 bits (188), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 48/142 (33%), Positives = 73/142 (51%), Gaps = 3/142 (2%) Query: 45 LQSWDPTLVNPCTWFHVTCNQDNRVTRVDLGNSNLSGHLVPEXXXXXXXXXXXXXXNHIQ 104 L+ + ++V P F + +TR+DL N+ L+G + P+ N +Q Sbjct: 78 LEVYAVSIVGP---FPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQ 134 Query: 105 GTIPVELGNLRSLISLDLYSNNISGTIPASLGKLKSLVFLRLNDNQLTGQIPRELVGISS 164 IP E+G L+ L L L NN G IP + L L +L L +N+LTG+IP EL + + Sbjct: 135 DVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPN 194 Query: 165 LKIVDVSSNNLCGTIPTTGPFE 186 + +DV +N+L GTI FE Sbjct: 195 FRHLDVGNNHLVGTIRELIRFE 216 Score = 59.7 bits (143), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 5/126 (3%) Query: 67 NRVTRVDLGNSNLSGHLVPEXXXXXXXXXXXXXXNHIQGTIPVELGNLRSLISLDLYSNN 126 R+T + L +N G + E N + G IP ELG L + LD+ +N+ Sbjct: 145 KRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNH 204 Query: 127 ISGTIPASL---GKLKSLVFLRLNDNQLTGQIPRELVGISSLKIVDVSSNNLCGTIPTTG 183 + GTI + G L L LN+N LTG +P +L +++L+I+ +S N + GTIP Sbjct: 205 LVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLA- 263 Query: 184 PFEHIP 189 HIP Sbjct: 264 -LAHIP 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37449 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13872 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1093 (304 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22966256 (306 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10194 377 e-107 >Cs10194 Length = 251 Score = 377 bits (969), Expect = e-107, Method: Compositional matrix adjust. Identities = 184/251 (73%), Positives = 212/251 (84%) Query: 56 MPFLRIAIGQPQDTYHPDALKKALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIA 115 MP IA+G P++ HPDAL+ ALAEF TLIFVFAGEGSGMAF+KLT +G+ TP+GL+A Sbjct: 1 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVA 60 Query: 116 EALGHGLGLFVAVSGAWNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLL 175 ++ H LFVAV+ NISGGH+NPAVTFGAFVGGNI+LLRGILYWIAQLLGS VACLL Sbjct: 61 ASVAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL 120 Query: 176 LKFCTHGMTTSAFAISSGETVWNAFVLEIVMTFGLVYTVYATAIDPRNGNVGIIAPLAIG 235 LKF T+G TTSAFA+SSG WNA V EIVMTFGLVYTVYATA+DP+ G++G IAP+AIG Sbjct: 121 LKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIG 180 Query: 236 LIVAANILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGFVYETIFID 295 IV ANILAGGAFDGASMNPA+SFGPALVSW W NHWVYW GPLIGGG+AG VYE FI+ Sbjct: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFIN 240 Query: 296 RTHEPLPGSEF 306 ++HE LP +E+ Sbjct: 241 QSHEQLPTTEY 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23251 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2986 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24066257 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4738 (411 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11466257 (503 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22766257 (356 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs49233 140 2e-35 >Cs49233 Length = 326 Score = 140 bits (354), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 99/310 (31%), Positives = 152/310 (49%), Gaps = 40/310 (12%) Query: 25 DRQALLDFKAALNEPYLGIFKSWSGNDCCSS-----WFGISCDSAGRVADINLRGESEDP 79 D +AL + KA+L + +W G+D C W G++C + G + R +E Sbjct: 28 DVKALNEIKASLG---WRVVYAWVGDDPCGDGDLPPWSGVTCSTQG-----DYRVVTELE 79 Query: 80 IFERAGRSGYMTGAISPSICKLDSLTTLIIADWKGISGEIPPCISSLSKLRILDLVGNKI 139 ++ + + G ++ L LT L + + K ++G IPP I L +LRIL+L NK+ Sbjct: 80 VYAVS-----IVGPFPIAVTNLLDLTRLDLHNNK-LTGPIPPQIGRLKRLRILNLRWNKL 133 Query: 140 TGVIPADIGKLQRLTVLNVADNSISGGIPASVVNLASLMHLDLRNNQITGGIPQDFGKLT 199 VIPA+IG+L+RLT L+++ N+ G IP + NL L +L L+ N++TG IP + G L Sbjct: 134 QDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILP 193 Query: 200 MLSRAMLGRNQLTGTIPSSISGLYRLADFDLSVNQISGVIPAELGSMPVLSTLNLDSNRL 259 +G N L GTI L F+ GS PVL L L++N L Sbjct: 194 NFRHLDVGNNHLVGTI-------RELIRFE--------------GSFPVLRNLYLNNNYL 232 Query: 260 SGSIPASLLSNTGLNILNLSRNSLEGKLPDVFGSKTYFIGLDLSYNNLKGQIPKSLSSAA 319 +G +PA L + T L IL LS N + G +P L L +N G+IP + Sbjct: 233 TGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSGRIPDAFYKHP 292 Query: 320 YIGHLDLSHN 329 ++ + + N Sbjct: 293 FLKEMYIEGN 302 Score = 110 bits (275), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 76/217 (35%), Positives = 106/217 (48%), Gaps = 5/217 (2%) Query: 140 TGVIPADIGKLQRLTVLNVADNSISGGIPASVVNLASLMHLDLRNNQITGGIPQDFGKLT 199 +GV + G + +T L V SI G P +V NL L LDL NN++TG IP G+L Sbjct: 62 SGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLK 121 Query: 200 MLSRAMLGRNQLTGTIPSSISGLYRLADFDLSVNQISGVIPAELGSMPVLSTLNLDSNRL 259 L L N+L IP+ I L RL LS N G IP E+ ++P L L L NRL Sbjct: 122 RLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQENRL 181 Query: 260 SGSIPASLLSNTGLNILNLSRNSLEGKLPDVF---GSKTYFIGLDLSYNNLKGQIPKSLS 316 +G IP L L++ N L G + ++ GS L L+ N L G +P L+ Sbjct: 182 TGRIPPELGILPNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLA 241 Query: 317 SAAYIGHLDLSHNHLCGSIPTGWPFDHLEASSFSFND 353 + + L LSHN + G+IP H+ ++ + D Sbjct: 242 NLTNLEILYLSHNKMSGTIPLA--LAHIPKLTYLYLD 276 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66240 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14109 (388 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48346 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54183 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs55995 84 1e-18 >Cs55995 Length = 204 Score = 84.0 bits (206), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/142 (33%), Positives = 81/142 (57%), Gaps = 9/142 (6%) Query: 1 MVKFRSEFSHYVFFCLNLFSCIAVVESCMMVVASLVPNFLMGIITGAGLIGIMMMTSGFF 60 +V R EFS ++F LN F C+ V E M+VVAS+ + I+T + +MM+++G+F Sbjct: 34 LVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISIHVVMMLSAGYF 93 Query: 61 RLLSDLPKPFWRYPVSYISYGAWGLQGAYKNDLIGLEFEP----LISGDPKLKGSEIITN 116 R+ + LP P W YP+SY+++ + ++G +N+ +G F ISG L+ + I++ Sbjct: 94 RIRNALPGPVWTYPISYVAFHTYSIKGLLENEYLGTSFPVGQVRTISGYQALQSAYDISS 153 Query: 117 MLGIQLDHSKWWDLTALFIILI 138 +SKW +L L ++ I Sbjct: 154 K-----SNSKWGNLLVLVLMAI 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11995 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29302 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44596 362 e-102 >Cs44596 Length = 224 Score = 362 bits (928), Expect = e-102, Method: Compositional matrix adjust. Identities = 171/224 (76%), Positives = 191/224 (85%), Gaps = 2/224 (0%) Query: 1 MVLWVFGYGSLVWNPGFDYDEKVIGFIKDYKRVFDLACIDHRGTPEHPARTCTLEQSEGA 60 MV WVFGYGSLVWNPGF+YDEK++GFIKDY+RVFDLACIDHRGTP+HPARTCTLE+S+ Sbjct: 1 MVFWVFGYGSLVWNPGFEYDEKILGFIKDYRRVFDLACIDHRGTPQHPARTCTLEKSQET 60 Query: 61 ICWGAAFCVRGGPEKERLAMEYLERRECEYDCKTLVDFYKEGNTSAPALTGIIVFTSTPD 120 ICWG A+CVRGGPEKERLAMEYLERRECEYD KTLVDFY+EG S PALTG+IVFTSTPD Sbjct: 61 ICWGVAYCVRGGPEKERLAMEYLERRECEYDSKTLVDFYREGEPSQPALTGVIVFTSTPD 120 Query: 121 KVSNKYYLGPAPLEDMARQIATAVGPCGNNRDYLFLLEKAMFDIGHEDDMVIELASEVRK 180 KVSNKYYLGPAPLE+MARQIATAVGPCGNNRDYLF LEKAMFDIGHEDD +IELA+EVRK Sbjct: 121 KVSNKYYLGPAPLEEMARQIATAVGPCGNNRDYLFKLEKAMFDIGHEDDYIIELANEVRK 180 Query: 181 VLGMVGKGSVKEKKLVGLPHLLPAHM--SAIQLHLLPEVITLDS 222 LG KG + K +G + + S +QL L PE + +DS Sbjct: 181 ELGTAEKGFSRRGKWLGHHPACRSQISYSTLQLGLRPEAVGMDS 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31003 (427 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37739 203 4e-54 >Cs37739 Length = 121 Score = 203 bits (516), Expect = 4e-54, Method: Compositional matrix adjust. Identities = 97/117 (82%), Positives = 104/117 (88%) Query: 213 MKIAAGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHPKLSDFGLAKVGPTGDKTHVS 272 MKIAAGAAKGLEYLHDK PPVIYRD K SNILL EG+HPKLSDFGLAK+GP GDK+HVS Sbjct: 1 MKIAAGAAKGLEYLHDKANPPVIYRDFKSSNILLEEGFHPKLSDFGLAKLGPVGDKSHVS 60 Query: 273 TRVMGTYGYCAPDYAMTGQLTFKSDIYSFRVVLLELITGRKAIDNSKGAREQNLVAW 329 TRVMGTYGYCAP+YAMTGQLT KSD+YSF VV LELITGRKAID+S+ EQNLV W Sbjct: 61 TRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSSRPHGEQNLVTW 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3302 (652 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88680 157 4e-40 >Cs88680 Length = 213 Score = 157 bits (397), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 78/158 (49%), Positives = 104/158 (65%), Gaps = 5/158 (3%) Query: 10 IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPIN 68 IGIDLGTT SCV + + ++I N +G+RTTPS VAF E L+G AK Q NP N Sbjct: 60 IGIDLGTTNSCVALMEGKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAVTNPTN 119 Query: 69 TVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYRGEEKQFSAEEISSMVL 128 T+F KRLIGR+F D Q ++++ +K++ P + N +Q+S +I + VL Sbjct: 120 TLFGTKRLIGRKFDDPQTQKEMQMVSYKIVRAPNGDAWVEAN----GQQYSPSQIGAFVL 175 Query: 129 IKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQATKDAG 166 KM+E AE+YLG S+ AV+TVPAYFND+QRQATKDAG Sbjct: 176 TKMKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAG 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23866261 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35628 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 134 7e-34 >Cs30681 Length = 257 Score = 134 bits (337), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 68/159 (42%), Positives = 100/159 (62%), Gaps = 12/159 (7%) Query: 1 MGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLA 60 +GT GYAAPEY+ TG LT +SD++SFGV L E+++GRR +D+NRP E L+EW +P+L Sbjct: 87 VGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRNRPKSEQKLLEWVRPHLT 146 Query: 61 NKRKIFRILDNRLEGQYSLEGAHKASNLALRCLSTEAKFRPTMTEVVTALEQLQDCKEP- 119 + +K ILD +LEG+YS++ A K + +A +CL+ +AK RP M+EVV L ++ D E Sbjct: 147 DAKKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKGRPKMSEVVEVLNKIVDAAETG 206 Query: 120 ---------EITNNRSGGMKHR--RRSADDVRNEKPPIA 147 + ++ K R RR D +R EK +A Sbjct: 207 TPQTPLKNLSLKDDFETSKKERLKRRFVDPIRGEKGCLA 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38423 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs100716 66 2e-13 >Cs100716 Length = 208 Score = 65.9 bits (159), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 37/58 (63%), Positives = 43/58 (74%) Query: 1 MGDLDTKPFQKAMKRKYSEEEANEKALELCSLWEQNLTDSSWHPFKVITDKGNCKEII 58 MG+LD KPF + M RKY+EEEA E+A ELCSLWE+ L D WHPFKVIT +G K I Sbjct: 140 MGELDNKPFLEVMNRKYNEEEAEERASELCSLWEEYLKDPDWHPFKVITAEGKHKVCI 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58117 (516 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32059 (270 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15336 338 4e-95 >Cs15336 Length = 263 Score = 338 bits (867), Expect = 4e-95, Method: Compositional matrix adjust. Identities = 162/260 (62%), Positives = 197/260 (75%), Gaps = 3/260 (1%) Query: 9 SGDGRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFG 68 S + RWSLKGMTALVTGGT+GIGHAIVEEL GA +HTCSR ETELNE +++WK+KG Sbjct: 4 SREQRWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLK 63 Query: 69 VSGSVCDVSSRAQREKLMQTISSVFNGKXXXXXXXXXXTIQKPTVEVTAEEFSTIMAINF 128 VSGS CD+ RA+R+KLM+T+ S F+GK TI K E T E+FSTIM NF Sbjct: 64 VSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNF 123 Query: 129 ESVYHLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKNLACEWAE 188 ES YHLSQ+A+PLLKASG G+I+FISSV G++A S Y+ TKGAMNQLTKNLACEW + Sbjct: 124 ESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGK 183 Query: 189 DNIRSNAVAPWYIKTPMVDQMLSNKTFLEG---VINRTPLRRVGDPKEVSSVVAFLCLPA 245 DNIR NAVAPW I+T ++D + + +E +I RTP+ R G+P EVSSVVAFLCLPA Sbjct: 184 DNIRVNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLPA 243 Query: 246 SSYITGQTICVDGGMTVNGF 265 +SY+TGQ C+DGG +VNGF Sbjct: 244 ASYVTGQVFCIDGGYSVNGF 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16221 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16325 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43351 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20367 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54598 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs91748 471 e-135 >Cs91748 Length = 265 Score = 471 bits (1211), Expect = e-135, Method: Compositional matrix adjust. Identities = 228/264 (86%), Positives = 238/264 (90%) Query: 1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE 60 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE Sbjct: 1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE 60 Query: 61 VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK 120 VIAILMQRHVLVD KVRTDKTYP+GFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK Sbjct: 61 VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK 120 Query: 121 FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDXXXX 180 FKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE+NKIT+FIKFD Sbjct: 121 FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNV 180 Query: 181 XXXXXXXXXXXXXXIKNREKRKGSFETIHVQDATGHEFATRLGNVFIIGKGTKPWVTLPK 240 IKNREK KGSFETIH+QDA GHEFATRLGNVF IGKGTKPWV+LPK Sbjct: 181 VMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPK 240 Query: 241 GKGIKLSIIEEAQKRLAAQAASSA 264 GKGIKLSIIEEA+KR A +++A Sbjct: 241 GKGIKLSIIEEARKRQALATSAAA 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49462 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104791 165 2e-43 >Cs104791 Length = 155 Score = 165 bits (417), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 87/146 (59%), Positives = 114/146 (78%), Gaps = 3/146 (2%) Query: 1 MFKKLELLRSITNSHAHSKTSILLDASKYIEELKQKVERLNQEVAVAQNSSDEQIPMPVQ 60 +++KL LLR +TNS + +KTSI++DASKYIEELKQ+VE LNQE+ ++ S+ E +PV Sbjct: 11 LYEKLMLLRDVTNSTSMNKTSIVVDASKYIEELKQQVETLNQEIGTSEASTVEN-SLPV- 68 Query: 61 VRVEAKEKGYLINVLTESSCPGLLVFILEAFEELGLEVLQARVSCSSSFHLEAVGGKENT 120 V VE EKG+LINV E +C GLLV +LEAFE+LGLEVL ARVSCS F LEAVGG ++ Sbjct: 69 VTVETLEKGFLINVYLEKNCSGLLVSVLEAFEDLGLEVLDARVSCSDRFQLEAVGG-DHI 127 Query: 121 QGQVEHVDAQVVKQAVLRAIENWNES 146 +G + +DAQVVK+AVL+AI+N +S Sbjct: 128 EGHADGIDAQVVKEAVLQAIKNVQDS 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15446 (50 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65578 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44282 126 2e-31 >Cs44282 Length = 125 Score = 126 bits (317), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 63/103 (61%), Positives = 70/103 (67%), Gaps = 1/103 (0%) Query: 162 GVAHVINLDLPKAMENYVHRIGRTGRAGSTGQATSFYTDRDVFLVAHIRKAIADVGSGNT 221 GVAHV+NLDLPK +E+YVHRIGRTGR GS GQATSFYTDRD+ LVA I+KAI D SGN Sbjct: 2 GVAHVVNLDLPKTVEDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKAIVDAESGNA 61 Query: 222 VAFATGXXXXXXXXXXXXXXXXXXXXLSNLSLMGPTSLNIERK 264 VAFATG S LS+MGP S+NIE K Sbjct: 62 VAFATGKVARRKEREAAAAQKGATVATSKLSMMGP-SVNIEDK 103 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13445 (102 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48827 (446 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs34689 226 4e-61 >Cs34689 Length = 264 Score = 226 bits (575), Expect = 4e-61, Method: Compositional matrix adjust. Identities = 102/258 (39%), Positives = 159/258 (61%), Gaps = 8/258 (3%) Query: 175 VSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMS 234 VS +VVEPYN+ LS H L+E+ D ++LDNEA+YDIC R+L + P++ +LN L+S +S Sbjct: 1 VSTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 60 Query: 235 GVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMW 294 +T LRF G LN D+ + NL+P+PR+HF + +AP+ S + L+V E+T + Sbjct: 61 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF 120 Query: 295 DAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVC 354 + +MM DPRHG+Y+ M+RG + K+V+ + ++ K + FV+W P K + Sbjct: 121 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAAIKTKRTIQFVDWCPTGFKCGIN 180 Query: 355 DIPPR--------GLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEM 406 PP + A I NSTS+ E+F R+ ++F M+ ++AF+HWY GEGM+E Sbjct: 181 YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEG 240 Query: 407 EFTEAESNMNDLVSEYQQ 424 EF+EA ++ L +YQ+ Sbjct: 241 EFSEAREDLAALEKDYQE 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47723 (231 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44899 (111 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566262 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566259 (399 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34966257 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22361 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32189 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46331 (399 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45712 (346 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14908 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6492 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39374 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13066260 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8443 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38760 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23393 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47556 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2649 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43701 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26566259 (343 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs56347 95 9e-22 >Cs56347 Length = 259 Score = 95.1 bits (235), Expect = 9e-22, Method: Compositional matrix adjust. Identities = 66/201 (32%), Positives = 101/201 (50%), Gaps = 23/201 (11%) Query: 33 LFVFGDSYVDTGNRNF---SARSWNQPYGITLPGK-PAGHYSNGRVFSDYIASWMGIRSP 88 FVFGDS VD GN N+ +AR+ + PYGI P + P G +SNG D+I+ +G Sbjct: 33 FFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQHIGSEPT 92 Query: 89 TPYRWRKMENTSLEYGMNFAFGGTGVFDT----LVSAPNMTIQIDLFQRQLQKKL----- 139 PY ++ + L G NFA G G+ + V+ M Q + FQ + Q ++ Sbjct: 93 LPYLSPELTGSRLLVGANFASAGIGILNDTGIQFVNIIRMFRQFEYFQ-EYQNRVTALIG 151 Query: 140 --YTKVDLNSSIALVSLAGNDY------TAYLARNGTTEGLSAFTKSMIKQLGLNLQRIQ 191 TK +N ++ L+++ GND+ Y AR+ L + K +I + L R+ Sbjct: 152 PQRTKQLVNGALILITVGGNDFVNNYYLVPYSARSRQFS-LPDYVKYVISEYRKLLTRLH 210 Query: 192 GLGVRKIAVMNIQPLGCLPSE 212 LG R++ V PLGC+P+E Sbjct: 211 DLGARRVLVTGTGPLGCVPAE 231 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44921 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28056 (310 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566265 (364 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs55446 121 1e-29 >Cs55446 Length = 212 Score = 121 bits (303), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 55/85 (64%), Positives = 65/85 (76%) Query: 133 PFDYKYAATEDQLHDDPNVALFFFEKNMQPGTKMELHFIRDANLATFLPRQVANSIPFSS 192 PF+Y YAA E+QLHDDPN ALFF EK++ PG KM LHF + +N ATFL RQ A S PFSS Sbjct: 124 PFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSS 183 Query: 193 KKFPEILNEFSIKPESEEAETIKNT 217 K PEI N+FS+KP S EAE ++NT Sbjct: 184 DKLPEIFNQFSVKPGSVEAEIMQNT 208 Score = 80.5 bits (197), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 32/53 (60%), Positives = 45/53 (84%) Query: 1 MEFHLLPILALISLVVAAGHAALPTEVYWNSVLPNTPMPKAIRDILRPDLMEE 53 MEFHLLPILA +SL + A HA + E+YW +VLPN+PMPKA++D+L+PD++E+ Sbjct: 1 MEFHLLPILAFLSLALVASHADISPELYWKTVLPNSPMPKAVKDLLQPDVLED 53 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11866265 (337 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs55446 178 7e-47 >Cs55446 Length = 212 Score = 178 bits (452), Expect = 7e-47, Method: Compositional matrix adjust. Identities = 99/212 (46%), Positives = 125/212 (58%), Gaps = 26/212 (12%) Query: 1 MEFHXX-XXXXXXXXXXTSHAVLPSEVYWNSMLPNTPMPKSIRDVLRPDLVEDKSSSVDV 59 MEFH SHA + E+YW ++LPN+PMPK+++D+L+PD++EDKS+SV+V Sbjct: 1 MEFHLLPILAFLSLALVASHADISPELYWKTVLPNSPMPKAVKDLLQPDVLEDKSTSVNV 60 Query: 60 GKGGVNVDA--------------------XXXXXXXXXXXXXXXXXXXXXXXHKGKPVYV 99 GKGGVNVDA HKGKPVYV Sbjct: 61 GKGGVNVDAGKGKPGGGTHVNVGGKGVGVNTGKPDKRTSVGVGKGGVSVSTGHKGKPVYV 120 Query: 100 GVTPGPNPFAYKYAATEDQLHADPSVALFFMEKDMRPGTKMNLHFIKNTKEATFLP-QSE 158 GV+ PF Y YAA E+QLH DP+ ALFF+EKD+ PG KMNLHF + + ATFL Q+ Sbjct: 121 GVS----PFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAA 176 Query: 159 HPIIFSSEKLPEILKHFSVKPESVEAQIIKNT 190 FSS+KLPEI FSVKP SVEA+I++NT Sbjct: 177 KSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNT 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60795 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104903 133 6e-34 >Cs104903 Length = 264 Score = 133 bits (335), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 64/95 (67%), Positives = 75/95 (78%) Query: 46 RRQSPPXXXXXXEGHYVFGLGENLTPRYKILSKMGEGTFGRVLECWDRDTREYVAIKVVR 105 R SPP +GHY+F LGENLT RYKI SKMGEGTFG+VLECWDR+ +E VAIK+VR Sbjct: 72 RNGSPPWREDDKDGHYMFALGENLTSRYKIHSKMGEGTFGQVLECWDRERKEMVAIKIVR 131 Query: 106 SISKYRDAAMVEIGVLQQLVKNDKCRLRCVQIQHW 140 I KYR+AAM+EI VLQQL K+DK RCVQI++W Sbjct: 132 GIKKYREAAMIEIEVLQQLAKHDKGGNRCVQIRNW 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv408 (80 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2353 (368 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2471 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48056 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43227 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs75192 130 8e-33 >Cs75192 Length = 239 Score = 130 bits (328), Expect = 8e-33, Method: Compositional matrix adjust. Identities = 80/230 (34%), Positives = 125/230 (54%), Gaps = 15/230 (6%) Query: 5 SSWDALRKQARKLEAQLDEQMHLYRKLVSM-----KVD--------GDKEKEIDSGIDQL 51 S W+ LRK+ARK+E LD ++ Y KL + VD G K ++ I L Sbjct: 11 SGWEELRKEARKIEGDLDVKLSSYAKLGARFTQGGYVDTGSPTVGSGRSWKSMEMEIQSL 70 Query: 52 LKQLQQVNSHM-QAWVSSGGSEIFSHTLTRHQEILQDLTQEFYRLRSSFRAKKEHASLLE 110 L++L +N M + S+ + + L RH++IL + TQEF R++ + + +EHA LL Sbjct: 71 LEKLLDINDAMSRCAASAAPTTSVTQKLARHRDILHEFTQEFRRIKGNINSMREHAELLS 130 Query: 111 DFREFDRSRLDLEEGGGSEQALLKEHASISRSTGQMDTVISQAQATLGALVFQRSTFGGI 170 R+ D S +L+E A+I S +D VISQAQ T L QR+ FG + Sbjct: 131 SVRD-DISEYKASGSMSPRMQILRERAAIHGSITHIDDVISQAQTTRTVLGSQRALFGDV 189 Query: 171 NSKLSNVSSRLPTVNNILSAIKRKKSLDTIILSLVASVCTFLILIYWLTK 220 K+ +S + P + +L +I+R++S DT+IL+ V + CT ++IYWL+K Sbjct: 190 QGKVKVLSDKFPIIRGLLGSIRRRRSRDTLILAAVIAGCTLFLIIYWLSK 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25866264 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58648 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61809 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12996 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59526 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14935 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4327 (369 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs56347 369 e-104 >Cs56347 Length = 259 Score = 369 bits (947), Expect = e-104, Method: Compositional matrix adjust. Identities = 174/214 (81%), Positives = 197/214 (92%) Query: 34 FFVFGDSLVDSGNNDYLVTTARADSPPYGIDYPTHRPTGRFSNGLNIPDIISEQIGEQPT 93 FFVFGDSLVD+GNN+YL TTARADSPPYGIDYPT RPTGRFSNGLNIPD IS+ IG +PT Sbjct: 33 FFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSNGLNIPDFISQHIGSEPT 92 Query: 94 LPYLSPELTGERLLVGANFASAGIGILNDTGIQFLNIIRIYKQLEYFQQYQQRVTTLIGA 153 LPYLSPELTG RLLVGANFASAGIGILNDTGIQF+NIIR+++Q EYFQ+YQ RVT LIG Sbjct: 93 LPYLSPELTGSRLLVGANFASAGIGILNDTGIQFVNIIRMFRQFEYFQEYQNRVTALIGP 152 Query: 154 AQTERLVNQALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVRYLISEYRKVLRRLYEL 213 +T++LVN AL+LIT+GGNDFVNNYYLVP+SARSRQFSLPDYV+Y+ISEYRK+L RL++L Sbjct: 153 QRTKQLVNGALILITVGGNDFVNNYYLVPYSARSRQFSLPDYVKYVISEYRKLLTRLHDL 212 Query: 214 GARRVLVTGTGPMGCVPAELAMRSRNGECAVELQ 247 GARRVLVTGTGP+GCVPAE AMR RNG+CA +L Sbjct: 213 GARRVLVTGTGPLGCVPAERAMRGRNGQCAADLH 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42876 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs53942 204 5e-55 >Cs53942 Length = 185 Score = 204 bits (519), Expect = 5e-55, Method: Compositional matrix adjust. Identities = 96/116 (82%), Positives = 108/116 (93%) Query: 57 IDTAEAVVGQVTEVNKDTFWPIVKAAGDKAVVLDMYTQWCGPCKVMAPKFQELSGKYLDV 116 ++ A A VG+VTEVNKDTFWPIVKAAGDK VVLDMYTQWCGPCKV+APKFQEL+ KY DV Sbjct: 70 LEIAGATVGEVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDV 129 Query: 117 VFLKLDCNQDNKTLAKELGIRVVPTFKILKDSKIVKEVTGAKLDDLVVAIETVRSS 172 +FLKLDCNQ+NK+LAKELGIRVVPTFKILKD+K+VKEVTGAKL+DLV AI+ VRSS Sbjct: 130 IFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAIDAVRSS 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35984 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45747 (361 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29628 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2658 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3027 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12566264 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12566264 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2671 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20031 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 225 4e-61 >Cs66150 Length = 305 Score = 225 bits (574), Expect = 4e-61, Method: Compositional matrix adjust. Identities = 110/222 (49%), Positives = 145/222 (65%), Gaps = 1/222 (0%) Query: 1 MAKAVAREVRMAASIMRLHFHDCFVKGCDAXXXXXXXXXXXXEKNSVPNRNSARGFEVID 60 + KA + ++R+ AS++RLHFHDCFV GCDA EK + PN NSARGFEVID Sbjct: 54 LKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLDSTNTIDSEKFAAPNNNSARGFEVID 113 Query: 61 DIKSAVEKECPHTVSCSDILAIAARDSSVLTGGPSWEVPLGRRDSRGASLSGSNNNIPAP 120 ++K+AVE+ CP VSC+DIL IAA S L+GGPSW VPLGRRDSR A+ + +N N+P P Sbjct: 114 NMKAAVERACPRVVSCADILTIAAERSVALSGGPSWAVPLGRRDSRTANRALANQNLPGP 173 Query: 121 NNTFQTILTKFKLHGLN-IVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGRPDYSLDQSY 179 +T + + F+ GLN +DLVALSG+HT G ++C FR RLY+ + G+PD +LD ++ Sbjct: 174 FDTLDELKSSFRNVGLNDKLDLVALSGAHTFGRAQCQFFRGRLYDFNNTGKPDPTLDATF 233 Query: 180 AAQLRARCPRSGGDQNLFFLDFVSPTKFDNSYFKNILASKGL 221 QLR CP+ G L D +P FDN YF N+ K Sbjct: 234 LQQLRKLCPQGGNGGVLANFDVTTPDVFDNKYFSNLRGRKAF 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12740 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48454 122 4e-30 >Cs48454 Length = 244 Score = 122 bits (305), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 70/177 (39%), Positives = 111/177 (62%), Gaps = 21/177 (11%) Query: 1 MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYTSP 60 MGRG++++KRIEN NRQVT+SKRR+G+ KKA E++VLCDA+V+LI+FS GK EY++ Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTD 60 Query: 61 TITTKKVYDQYQKTLGIDL------------WSSHYERMQENLRKLKEINNKLRREIRQR 108 + +++ ++Y++ + W+ Y KLK L+R + Sbjct: 61 S-CMERILERYERYCYAERQLQANEIEPNGNWTLEYS-------KLKARMEVLQRNQKHF 112 Query: 109 MGEDLGDLSIEDLRGLEQKMDASLGLVRERKYHVIKTQTETYRKKVRNLEEQHGNLL 165 MGEDL DLS+++L+ +EQ++D+ L L+R RK ++ +KK + L+EQ+ NLL Sbjct: 113 MGEDLADLSLKELQSVEQQIDSGLKLIRSRKNQLMLQSISELQKKDKLLKEQN-NLL 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48899 (338 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65444 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25706 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42594 136 1e-34 >Cs42594 Length = 166 Score = 136 bits (342), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 74/122 (60%), Positives = 85/122 (69%), Gaps = 9/122 (7%) Query: 1 MKGGKSKAAEVKRADSNARLSXXXXXXXXXXXXXXXXXXXXXDPNKPKRPASAFFVFMEE 60 MKGGKSK+ +NA+LS DPNKPKRPASAFFVFMEE Sbjct: 1 MKGGKSKSDT-----TNAKLSVNKKPAKAGRKSGKAAK----DPNKPKRPASAFFVFMEE 51 Query: 61 FRKQYKEKHPANKSVSVVGKAGGDKWKSLSEAEKAPYVAKAEKRKTEYNKSMQAYNKRMA 120 FR+QYK+ HP NKSV+ VGK GG+KWKS+SEA+KAPYVAKAEKRK EY K M+ YN+R A Sbjct: 52 FREQYKKDHPKNKSVAAVGKTGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111 Query: 121 EG 122 EG Sbjct: 112 EG 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20578 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24180 112 6e-27 >Cs24180 Length = 294 Score = 112 bits (279), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 83/294 (28%), Positives = 138/294 (46%), Gaps = 37/294 (12%) Query: 7 IGEYTVRSKVGQGPQSTVWKAEQKCSGEVVALKQVYLSKLNRNLKTSLDCEINFLSSVSH 66 + +Y K+G+G V+KA + E +ALK++ L + + + ++ EI+ L + H Sbjct: 1 MDQYEKVEKIGEGTYGVVYKARNCVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQH 60 Query: 67 PNIIRLLHVFQAEGCIFLVLEFCSGGDLESYIRHHGRVQEW-----VARRFMQQLGAGLE 121 NI+RL V +E ++LV E+ DL+ +H ++ + + F+ Q+ G+ Sbjct: 61 GNIVRLQDVVHSEKKLYLVFEYL---DLD-LKKHMDSCPDFANDPRLIKTFLYQILRGIA 116 Query: 122 VLHSHHIIHRDLKPGNILLSGPESDVLLKIADFGLSRTVH-PGEHAETVCGTPLYMAPEV 180 HSH ++HRDLKP N+L+ + LK+ADFGL+R P T Y APE+ Sbjct: 117 YCHSHRVLHRDLKPQNLLIDRRTN--ALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEI 174 Query: 181 LRFKK-YDEKVDMWSLGAILFELLNGYPPFRGRTNVQLLQNI------------------ 221 L + Y VD+WS+G I E++N P F G + + L I Sbjct: 175 LLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEDTWPGVTSL 234 Query: 222 ----ESCKMLPFSQL--ISPGLHPDCVDLCTKLLSTNPVHRLSFDEFCRHRFLR 269 + P +L + L P +DL +K+L +P R++ H + R Sbjct: 235 PDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFR 288 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32486 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88949 63 1e-12 >Cs88949 Length = 156 Score = 62.8 bits (151), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 28/41 (68%), Positives = 33/41 (80%) Query: 4 IYFTLYGMMIVALTPNHQIAAIVMSFFLSFWNLFSGFLIPR 44 ++FT YGMM VALTPNH IAAIV + F WN+FSGF+IPR Sbjct: 92 LFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPR 132 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3936 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10935 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs159106185 103 5e-25 >Cs159106185 Length = 315 Score = 103 bits (257), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 52/64 (81%), Positives = 57/64 (89%) Query: 28 ILGFYSILLFTPLFSRLILQFQLQPQEFITGLPIFSCMLTTLSSGVALTQLAGGNSALAL 87 I G +SILLFTP FS+LILQ QLQPQEF+TGL +FSCM TTLSSGVALT LAGGNSALAL Sbjct: 124 IFGLFSILLFTPYFSKLILQVQLQPQEFVTGLALFSCMPTTLSSGVALTHLAGGNSALAL 183 Query: 88 AMTV 91 AMT+ Sbjct: 184 AMTI 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11260 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41392 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96763 122 2e-30 >Cs96763 Length = 192 Score = 122 bits (307), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 58/80 (72%), Positives = 67/80 (83%) Query: 48 SHPPYFQMIKEALLALDEKSGSSPYAIAKHMEEKHKAVLPANFKKILSLQLKNSVAKGNL 107 SHPPYFQMI EAL+AL +KSGSSPYAIAK+MEEKHK LPANF+KIL++QLK+ AKGNL Sbjct: 50 SHPPYFQMITEALMALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNL 109 Query: 108 IKIKASYKLSGVGKGTAKSD 127 IKI+ASYKLS G K + Sbjct: 110 IKIRASYKLSEAAAGKTKKE 129 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26170 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11228 253 7e-70 >Cs11228 Length = 150 Score = 253 bits (647), Expect = 7e-70, Method: Compositional matrix adjust. Identities = 117/150 (78%), Positives = 127/150 (84%) Query: 16 LSKIACNRLQKELVEWQVNPPAGFKHKVTDNLQRWVIEVHGAPGTLYANESYQLQVDFPE 75 +S + +KEL EWQVNPP+GFKHK TDNLQRWVIEV+GAPGTLYANE+YQLQV+FPE Sbjct: 1 MSGSSTTTRKKELAEWQVNPPSGFKHKATDNLQRWVIEVNGAPGTLYANETYQLQVEFPE 60 Query: 76 HYPMEAPQVIFLQPAPLHPHIYSNGHICLDILYDSWSPAMTVXXXXXXXXXXXXXXTVKQ 135 HYPMEAPQVIFL P+PLHPH+YSNGHICLDILYDSWSPAMTV TVKQ Sbjct: 61 HYPMEAPQVIFLHPSPLHPHVYSNGHICLDILYDSWSPAMTVSSICISILSMLSSSTVKQ 120 Query: 136 RPEDNDRYVRNCRNGRSPKETRWWFHDDKV 165 RPEDNDRYV+NCRNGRSPKETRWWFHDDKV Sbjct: 121 RPEDNDRYVKNCRNGRSPKETRWWFHDDKV 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28666260 (429 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45040 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33528 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47329 (130 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs38375 60 8e-12 >Cs38375 Length = 183 Score = 60.1 bits (144), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 27/62 (43%), Positives = 43/62 (69%) Query: 2 WAKPILRSGKISKLLDPDLDSNYDDPQIERMVLAATLCLRRAPRFRPQISLVLKLLLGDM 61 WA+P+L I +L+DP L ++Y + ++ M+ AA+LC+RR P RP++S VL++L GD Sbjct: 90 WARPLLEEYAIDELVDPRLGNHYSEHEVYCMLHAASLCIRRDPHSRPRMSQVLRILEGDT 149 Query: 62 EI 63 I Sbjct: 150 VI 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11764 (416 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52127 231 1e-62 >Cs52127 Length = 177 Score = 231 bits (589), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 116/158 (73%), Positives = 131/158 (82%), Gaps = 4/158 (2%) Query: 250 MQGWHSQRLLGNGEVGDPIIKDKSSISLQKREKQLKNIGLLKRKKPSNLEHAVKAARTKA 309 MQGWH+QRL G+GEV +PIIKDKS S +REKQLKNIGL K + L+ A KAA T+A Sbjct: 1 MQGWHAQRLFGHGEVAEPIIKDKSLPSPARREKQLKNIGLPKNR---TLDSAEKAALTEA 57 Query: 310 AKPQLDTAVVDIGPPADWVKINVRRTKDCFEVYALVPGLLREEVRVQSDPAGRLVITGEP 369 K Q+ T +VD+GPPADWVKINVR KDC+EVYALVPGL REEVRVQSDPAGRLVITGEP Sbjct: 58 DK-QIITEIVDVGPPADWVKINVREAKDCYEVYALVPGLFREEVRVQSDPAGRLVITGEP 116 Query: 370 EHPDNPWGVTPFKKVVSLPSRIDPHQTSAVVTLHGQLF 407 E DNPWG+TPFKKVV LPSRIDP QT AVV+LHG+L+ Sbjct: 117 EQVDNPWGITPFKKVVILPSRIDPLQTFAVVSLHGRLY 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16928 (333 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64799 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33207 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23881 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13066259 (368 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39142 (325 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59303 118 8e-29 >Cs59303 Length = 175 Score = 118 bits (296), Expect = 8e-29, Method: Compositional matrix adjust. Identities = 63/162 (38%), Positives = 95/162 (58%) Query: 157 VGEGFTEGVVQGPLINEAAVQKVESFVKDAVSKGAKVLLGGKRHSLGMTFYEPTVIGDIK 216 VG+ F G+ QGP I+ +K+ +++ V GAK+ GG+R + +PTV +K Sbjct: 5 VGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVK 64 Query: 217 NDMLIARNEVFGPVAPLLRFKTEEEAIRIANDTAAGLAAYVFTENVQRMWRVTEALEYGL 276 +DMLIA++E+FGPV +L++K +E I+ +N + GLAA VFT N+ + AL G Sbjct: 65 DDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGS 124 Query: 277 VGVNEGLVSTEVAPFGGVKESGLGREGSKYGMDEFLEMKYVC 318 V +N V PFGG K+SG GRE Y + +L++K V Sbjct: 125 VWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVV 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53456 (69 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23765 (328 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48468 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30658 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs100704 77 2e-16 >Cs100704 Length = 122 Score = 76.6 bits (187), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 42/98 (42%), Positives = 57/98 (58%), Gaps = 4/98 (4%) Query: 65 NGKNLCNEADKETSVHXXXXXXXXXXXXXFTEASLHRSAFSRDRPYFQLDELAGMDQ--- 121 NG+++ E D E SV +E SL R+A S +RPY+QLD AG++Q Sbjct: 24 NGEHMLIEVDIEASVQNKGHSSGSSVCAGSSEESLQRTAPSSNRPYYQLDHFAGIEQLDD 83 Query: 122 -MDTIFLTSLLEDLPNTENFNRTFCFSPESQHSAMPEN 158 +D I+L SLLEDLP TE+ +F F PESQH+ +N Sbjct: 84 ILDDIYLNSLLEDLPATEDLYNSFGFDPESQHNLTGDN 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12319 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50615 (63 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11666259 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29860 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84309 216 2e-58 >Cs84309 Length = 210 Score = 216 bits (549), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 125/241 (51%), Positives = 147/241 (60%), Gaps = 46/241 (19%) Query: 13 LGPPWLKPMLRASYFVPCGIHGDSNKSECNMFCLDCMGDALCSYCLI-HHKDHCVVQIRR 71 L PPWL+PMLR ++F C HGD+ +SECNM+CLDC A C YC HKDH V+QIRR Sbjct: 8 LVPPWLEPMLRTAFFTVCRTHGDAARSECNMYCLDCNDHAFCFYCRSSKHKDHQVIQIRR 67 Query: 72 SSYHNVVRVNEIQKYIDISCVQTYVINSAKIVFLNERPQPRPGKGVTNTCEICCRSLLDS 131 SSYH+VVRV EIQ +DIS VQTYVINSA++VFLNERPQPR GKGV + CEIC RSLLD Sbjct: 68 SSYHDVVRVGEIQNIMDISGVQTYVINSARVVFLNERPQPRSGKGVAHICEICGRSLLDP 127 Query: 132 FRFCSLGCKLGAMKRGDPDLTFWLKLKHGRETFHGSESDESSTPRKFQRTHLFSRLMIDG 191 FRFCSLGCKL +KR D + +F L++K+ E F +R SR + Sbjct: 128 FRFCSLGCKLAGIKR-DGNASFTLEIKN--EAF-------------MERKEGISRQVSSR 171 Query: 192 PTISL--DGHHDATVAADKSTASSSGDETINNISPAT---PPIFNHSNARRRKGIPHRAP 246 L D HD I P T PP S+ARRRKG+PHRAP Sbjct: 172 KQEELREDSQHD--------------------IYPPTTHKPP----SSARRRKGVPHRAP 207 Query: 247 F 247 F Sbjct: 208 F 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36397 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54021 237 7e-65 >Cs54021 Length = 255 Score = 237 bits (605), Expect = 7e-65, Method: Compositional matrix adjust. Identities = 107/178 (60%), Positives = 131/178 (73%) Query: 20 EEEHPVKAFGWAARDNSGHLSPFNFSRRSTGEEDVRLKVLYCGICHTDLHNSKNEWGSAS 79 E+EHP AFGWAA+D SG LSPF+FSRR+TGE+DV KV +CGICH+DLH KNEWG+ Sbjct: 6 EQEHPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNEWGNTI 65 Query: 80 YPLVPGHXXXXXXXXXXXXXXXXXXXXXXXXXSLVGACHSCDDCSHDLENYCPKLILTYG 139 YP+VPGH +VG+CHSCD C+ DLENYCPK+I+TY Sbjct: 66 YPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCHSCDSCAIDLENYCPKVIMTYA 125 Query: 140 SLYHDGTMTYGGYSDTMVANERYVIRIPDNMPLDKGAPLLCAGITVYSPLKYYGLNEP 197 + YHDGT+TYGGYSD MVA+E +V+RIP+ PLD APLLCAGITVYSPL++YGL++P Sbjct: 126 NKYHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGLDKP 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26066265 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48684 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52976 124 1e-30 >Cs52976 Length = 206 Score = 124 bits (310), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 73/196 (37%), Positives = 107/196 (54%), Gaps = 2/196 (1%) Query: 10 RFYFSRRTLFQMLSDRGYNVPHSELTRSLSDFRASFGQNPDPSRLRICLPLISSPSKKIL 69 R + RRT+ QML DRGY V E+ S F A FG+N L I L + S +I Sbjct: 10 RLFRIRRTVMQMLRDRGYFVGDFEINMSKEQFIAKFGENMKREDLVINKALRNDSSDQIY 69 Query: 70 VVFCGTDEIRKAVIRVIFQQINREGLHRLILVLQSKMNSHARKVVDEYPIK--VELFLIT 127 V F ++ ++ ++ E + R ILV+Q + AR + E K +E+F Sbjct: 70 VFFPDEQKVGVKTMKTYTNRMKSENVFRAILVVQQNLTPFARTCIQEISAKFHLEVFQEA 129 Query: 128 ELLINITKHVSVPKHEILSAQEKRKLVNKYKLEDKQFPIMQKDDAIARYYGLEKGQVVKI 187 ELL+NI +HV VP+H++L+ +EK+ L+ +Y +++ Q P +Q D RYYGL++GQVVKI Sbjct: 130 ELLVNIKEHVLVPEHQVLTNEEKKTLLKRYTVKETQLPRIQVTDPXCRYYGLKRGQVVKI 189 Query: 188 TYKGGMTDSLVTYRCV 203 VTYR V Sbjct: 190 IRPSETAGRYVTYRYV 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4817 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56098 (292 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5168 (309 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7609 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58630 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31142 (241 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28776 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8600 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93559 100 5e-24 >Cs93559 Length = 300 Score = 100 bits (249), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 49/120 (40%), Positives = 69/120 (57%), Gaps = 2/120 (1%) Query: 8 ETPSLLPTWITEEELGVYADKFQESGFTGGLNYYRAMDLSWELLAPWQGSKITIPSKLXX 67 E LP+W +E++L YA KF ++GFTG LNYYRAM+L+WE+ A W ++ +P K Sbjct: 181 ENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWEMTAAWTEVQVKVPVKFIV 240 Query: 68 XXXXXXXXXXXTKEYIEGNTFKTLVPDHE--VVILDGHHFIQEEKPQQVSAEILSFLAKF 125 KEY+ FK VP E VVI D HFI +E+ ++++A I F+ KF Sbjct: 241 GELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFINQERAEEINAHIYDFIKKF 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30366260 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38410 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38280 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22466264 (71 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3456 (704 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16602 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33129 131 4e-33 >Cs33129 Length = 225 Score = 131 bits (330), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 79/200 (39%), Positives = 110/200 (55%), Gaps = 9/200 (4%) Query: 7 LQKKGLKYEYSQEDLRNKSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKS 66 L+ KG+++++ EDL NKSPLLL+ NPV+KK+PVLIHNGKPI ESL+I++Y+DE WK ++ Sbjct: 23 LKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGKPISESLVILEYVDETWK-QN 81 Query: 67 PLLPSDPYQRAQARFWADYVDKKLYELGGKIWSXXXXXXXXXXXXF---IXXXXXXXXXX 123 PLLP DPY+RA+ARFWA + + K+ IW+ I Sbjct: 82 PLLPEDPYERARARFWAKFGEDKVL---VSIWNAFIKQGKEQEEAIGLAIETLKFLEEEL 138 Query: 124 XXXPYFGGEKIGFVDVALVTFSCWFYAY-ETFGNFSIEAE-CPKLIAWTKRCMEKESVSS 181 +FGGEKIG D+AL + + E G IE E P L AW + E + Sbjct: 139 KGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKERVPLLAAWMQEVAEAPVIKE 198 Query: 182 FLEDPHKVHGFIMGMRKRFG 201 K+ I +R+ +G Sbjct: 199 SWPPHEKLVTKIRAIREAYG 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16594 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16600 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33129 156 2e-40 >Cs33129 Length = 225 Score = 156 bits (394), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 89/219 (40%), Positives = 127/219 (57%), Gaps = 3/219 (1%) Query: 1 MGDEIILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLKNKSPLLLEMNPVHKQIPVLIHN 60 M +E+ LL W S FG+R L KG+++++ +EDL NKSPLLL+ NPV+K++PVLIHN Sbjct: 1 MAEEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHN 60 Query: 61 GKPICESLIIVQYIDEVWHDKSPLLPSDPYQRAQARFWADYVDKKLYGLGRKVWSTKGEE 120 GKPI ESL+I++Y+DE W ++PLLP DPY+RA+ARFWA + + K+ + +G+E Sbjct: 61 GKPISESLVILEYVDETWK-QNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKE 119 Query: 121 QETAKKEFIXXXXXXXXXXXXXPYFGGEKIGFVDVALVTFSCWFYAYES-FGNFSIEAE- 178 QE A I +FGGEKIG D+AL + +E G IE E Sbjct: 120 QEEAIGLAIETLKFLEEELKGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKER 179 Query: 179 CPKLIAWTKRCKEKESVSSSLEDPHKVHGFVMGMRKRFG 217 P L AW + E + S K+ + +R+ +G Sbjct: 180 VPLLAAWMQEVAEAPVIKESWPPHEKLVTKIRAIREAYG 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32041 (333 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78136 468 e-134 >Cs78136 Length = 347 Score = 468 bits (1205), Expect = e-134, Method: Compositional matrix adjust. Identities = 245/350 (70%), Positives = 269/350 (76%), Gaps = 20/350 (5%) Query: 1 MGVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGQGFSLEIIGEIDLYKFDPWVLP 60 MGVPETDPLSQL+LPPGFRFYPTDEELLVQYLCRKVAGQ FSL+IIGEIDLYKFDPWVLP Sbjct: 1 MGVPETDPLSQLNLPPGFRFYPTDEELLVQYLCRKVAGQHFSLQIIGEIDLYKFDPWVLP 60 Query: 61 SKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITTEGRKVGIKKALVFY 120 SKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDK+ITTEGRKVGIKKALVFY Sbjct: 61 SKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITTEGRKVGIKKALVFY 120 Query: 121 IGKAPKGTKTNWIMHEYRLLENSRKNGSSKLDDWVLCRIYKKNSNSSKPIAA--VLPSKA 178 +GKAPKGTKTNWIMHEYRL E SRKNGSSKLDDWVLCRIYKK+S S KP++A V SK Sbjct: 121 VGKAPKGTKTNWIMHEYRLFEPSRKNGSSKLDDWVLCRIYKKHSGSQKPVSATSVSSSKE 180 Query: 179 HSNGXXXXXXXHLDDVLESLPEIDDRFFSPNRMNSLR-VSQPDEKV-NFHNLGSGNFDWA 236 HSNG HLDDVLESLPEIDDRFF+ RMNSL+ + Q D KV N +LGSGNFDWA Sbjct: 181 HSNGSCSSSSSHLDDVLESLPEIDDRFFALPRMNSLKTLQQEDNKVNNLQHLGSGNFDWA 240 Query: 237 TLAGVSSLQELVSGVQSHAQPPA---AVNNSNEMYVPSLPPLIQ---------AEEEVQS 284 +LAG+ S+ E VS Q+ + A +N+ YVPS+P + EEEVQS Sbjct: 241 SLAGLHSVPEFVSAAQTQTTTQSHGVACYANNDFYVPSMPQMCHVNSGRVGNSVEEEVQS 300 Query: 285 GLRTQRVDPVMNQGXXXXXXXXXXX-XXXXXLDPFGFRYPTQPSGFGYRQ 333 GLR QRVD N G +DP+G R+PTQ SGFG+R Sbjct: 301 GLRNQRVD---NSGLFQHNSAVLTQPNFCSPVDPYGLRHPTQSSGFGFRH 347 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17327 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23769 (76 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29224 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs62778 366 e-103 >Cs62778 Length = 252 Score = 366 bits (939), Expect = e-103, Method: Compositional matrix adjust. Identities = 165/253 (65%), Positives = 212/253 (83%), Gaps = 1/253 (0%) Query: 1 MTSIIDDIYDAYGTLEELELFTEAVERWDVSAIDQLPEYMRVCYQALLYVYSEIEEEMAK 60 MTSIIDDIYD YG +EELELFT A+ERWD++AIDQLPEYM++CY+AL+ VYSE+E+++ Sbjct: 1 MTSIIDDIYDVYGKIEELELFTSAIERWDINAIDQLPEYMKLCYRALINVYSEVEKDLVS 60 Query: 61 EGRSYRLYYAKEAMKNQVRAYYEEAKWLQVQQIPTMEEYMAVALVTSAYSMLATTSFVGM 120 +G+ RL+YAKEAMKNQV+ Y+ EAKW +PT++EYM VAL++SA+ L+T SFVGM Sbjct: 61 QGKLSRLHYAKEAMKNQVKHYFFEAKWYHQNYVPTVDEYMTVALISSAHPNLSTISFVGM 120 Query: 121 GDAVTKETFDWIFSEPKIVRASAIVCRLMDDMVSHKFEQKRGHVASAVECYMKQHGASEQ 180 GD VTKE+F+W+FS P+ +RAS V RLM+DMVSHKFEQ RGHVAS+VECY+ Q+GA+E+ Sbjct: 121 GDIVTKESFEWLFSNPRSIRASCAVGRLMNDMVSHKFEQSRGHVASSVECYINQYGATEE 180 Query: 181 ETHNEFNKQVRDAWKDINEECLIPTAVPMPILMRVLNLARVIDVIYKNEDGYTHSGTVLK 240 E ++EF KQV +AWKDINEECL PT VP+P+LMR+LNL R DV+YK +DGYT + LK Sbjct: 181 EAYSEFRKQVSNAWKDINEECLRPTLVPVPLLMRILNLTRAADVVYKYKDGYTDTEE-LK 239 Query: 241 DFVTSMLIDPVPI 253 DF+ S+LI+PVPI Sbjct: 240 DFIASLLINPVPI 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6166264 (381 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73025 751 0.0 >Cs73025 Length = 382 Score = 751 bits (1938), Expect = 0.0, Method: Compositional matrix adjust. Identities = 380/380 (100%), Positives = 380/380 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 Query: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT Sbjct: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240 Query: 241 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 300 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR Sbjct: 241 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 300 Query: 301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 360 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL Sbjct: 301 LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 360 Query: 361 ADYNIQKESTLHLVLRLRGG 380 ADYNIQKESTLHLVLRLRGG Sbjct: 361 ADYNIQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61962 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73025 408 e-116 >Cs73025 Length = 382 Score = 408 bits (1049), Expect = e-116, Method: Compositional matrix adjust. Identities = 206/215 (95%), Positives = 208/215 (96%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 Query: 181 KIQDKEGIPPNXQRLIFAGKQLGKGPNLADYTFQR 215 KIQDKEGIPP+ QRLIFAGKQL G LADY Q+ Sbjct: 181 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK 215 Score = 408 bits (1049), Expect = e-116, Method: Compositional matrix adjust. Identities = 206/215 (95%), Positives = 208/215 (96%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 137 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 196 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 197 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 256 Query: 181 KIQDKEGIPPNXQRLIFAGKQLGKGPNLADYTFQR 215 KIQDKEGIPP+ QRLIFAGKQL G LADY Q+ Sbjct: 257 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK 291 Score = 408 bits (1049), Expect = e-116, Method: Compositional matrix adjust. Identities = 206/215 (95%), Positives = 208/215 (96%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 213 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 272 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA Sbjct: 273 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA 332 Query: 181 KIQDKEGIPPNXQRLIFAGKQLGKGPNLADYTFQR 215 KIQDKEGIPP+ QRLIFAGKQL G LADY Q+ Sbjct: 333 KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK 367 Score = 304 bits (778), Expect = 7e-85, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 Query: 61 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 120 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI Sbjct: 289 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI 348 Query: 121 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 152 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 349 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1532 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31298 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21553 (255 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62168 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3966261 (224 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25409 64 1e-12 >Cs25409 Length = 359 Score = 64.3 bits (155), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 33/79 (41%), Positives = 43/79 (54%), Gaps = 7/79 (8%) Query: 31 YRGVRKRPWGRFAAEIRDPWKKTRVWLGTFDSPEEXXXXXXXXXXTLRGPKAKTNFXXXX 90 YRGVR+R WG++ AEIR P +TR+WLGTFD+ EE LRG A+ NF Sbjct: 166 YRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAYKLRGEFARLNFPHLK 225 Query: 91 XXXXXXXXFDRNLNGQFGD 109 ++ G+FGD Sbjct: 226 HHGA-------HVTGEFGD 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34911 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32166256 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33366264 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22466260 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12028 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26023 (341 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13283 (420 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47614 (135 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3994 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49951 (135 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2632 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88787 163 3e-42 >Cs88787 Length = 354 Score = 163 bits (412), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 104/309 (33%), Positives = 161/309 (52%), Gaps = 39/309 (12%) Query: 117 RRLISGAIAGAVSRTAVAPLETIRTHLMVGSSGHS-----TTEVFNNIMKTDGWKGLFRG 171 + L++G +AGAVSRTAVAPLE ++ L V + HS T + I +T+G++GLF+G Sbjct: 42 KSLVAGGVAGAVSRTAVAPLERLKILLQV-QNPHSIKYNGTIQGLKYIWRTEGFRGLFKG 100 Query: 172 NLVNVIRVAPSKAIELFAYDTVNKNL-----SPIPGEQPKIPIPASLVAGACAGVSSTLV 226 N N R+ P+ A++ F+Y+ +K + E ++ L AGACAG+ + Sbjct: 101 NGTNCARIVPNSAVKFFSYEQASKGILYLYQHHTGNEDAELTPLLRLGAGACAGIIAMSA 160 Query: 227 TYPLELLKTRLTIQGDV----YNGLFDAFVKILQEGGPAELYRGLTPSLIGVVPYAATNY 282 TYP+++++ RLT+Q + Y G+F A +L+E GP LYRG PS+IGVVPY N+ Sbjct: 161 TYPMDMVRGRLTVQTEKSPYRYRGIFHALSTVLREEGPRALYRGWFPSVIGVVPYVGLNF 220 Query: 283 FAYDTLRKTYRKILKQEKIGNIETXXXXXXXX--------XXXXXXTFPLEVARKHMQ-V 333 Y++L+ ++K + +G E +PL+V R+ MQ V Sbjct: 221 AVYESLKVW---LIKTKPLGLAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMV 277 Query: 334 GALSGRQV------------YKNVLHALSSILEQEGIPGLYKGLGPSCLKLVPAAGISFM 381 G V Y ++ A + EG LYKGL P+ +K+VP+ ++F+ Sbjct: 278 GWKEASSVVIGDGRNRAPLEYNGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSISLAFV 337 Query: 382 CYEACKRIL 390 YE K IL Sbjct: 338 TYEVVKDIL 346 Score = 81.6 bits (200), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 58/198 (29%), Positives = 89/198 (44%), Gaps = 11/198 (5%) Query: 207 IPIPASLVAGACAGVSSTLVTYPLELLKTRLTIQGD---VYNGLFDAFVKILQEGGPAEL 263 + I SLVAG AG S PLE LK L +Q YNG I + G L Sbjct: 38 LSICKSLVAGGVAGAVSRTAVAPLERLKILLQVQNPHSIKYNGTIQGLKYIWRTEGFRGL 97 Query: 264 YRGLTPSLIGVVPYAATNYFAYDTLRKTYRKILKQEKIGNIETXXX-------XXXXXXX 316 ++G + +VP +A +F+Y+ K L Q GN + Sbjct: 98 FKGNGTNCARIVPNSAVKFFSYEQASKGIL-YLYQHHTGNEDAELTPLLRLGAGACAGII 156 Query: 317 XXXXTFPLEVARKHMQVGALSGRQVYKNVLHALSSILEQEGIPGLYKGLGPSCLKLVPAA 376 T+P+++ R + V Y+ + HALS++L +EG LY+G PS + +VP Sbjct: 157 AMSATYPMDMVRGRLTVQTEKSPYRYRGIFHALSTVLREEGPRALYRGWFPSVIGVVPYV 216 Query: 377 GISFMCYEACKRILVENE 394 G++F YE+ K L++ + Sbjct: 217 GLNFAVYESLKVWLIKTK 234 Score = 77.0 bits (188), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 54/200 (27%), Positives = 96/200 (48%), Gaps = 26/200 (13%) Query: 116 LRRLISGAIAGAVSRTAVAPLETIRTHLMVGS--SGHSTTEVFN---NIMKTDGWKGLFR 170 L RL +GA AG ++ +A P++ +R L V + S + +F+ +++ +G + L+R Sbjct: 144 LLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEKSPYRYRGIFHALSTVLREEGPRALYR 203 Query: 171 GNLVNVIRVAPSKAIELFAYDTVNKNLSPIP----GEQPKIPIPASLVAGACAGVSSTLV 226 G +VI V P + Y+++ L E ++ + L GA AG V Sbjct: 204 GWFPSVIGVVPYVGLNFAVYESLKVWLIKTKPLGLAEDSELSVTTRLACGAAAGTVGQTV 263 Query: 227 TYPLELLKTRL----------TIQGD-------VYNGLFDAFVKILQEGGPAELYRGLTP 269 YPL++++ R+ + GD YNG+ DAF K ++ G LY+GL P Sbjct: 264 AYPLDVIRRRMQMVGWKEASSVVIGDGRNRAPLEYNGMIDAFRKTVRHEGFGALYKGLVP 323 Query: 270 SLIGVVPYAATNYFAYDTLR 289 + + VVP + + Y+ ++ Sbjct: 324 NSVKVVPSISLAFVTYEVVK 343 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41386 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8266259 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25409 74 9e-16 >Cs25409 Length = 359 Score = 74.3 bits (181), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 32/65 (49%), Positives = 41/65 (63%) Query: 1 MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETXXXXXXXXXXXXXLMCGPRAR 60 +A+P + YRGVRQRHWG WV+EIR P +TR+WLGTF+T + G AR Sbjct: 159 VAKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAYKLRGEFAR 218 Query: 61 TNFPY 65 NFP+ Sbjct: 219 LNFPH 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26753 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs97586 187 8e-50 >Cs97586 Length = 200 Score = 187 bits (475), Expect = 8e-50, Method: Compositional matrix adjust. Identities = 93/194 (47%), Positives = 122/194 (62%), Gaps = 1/194 (0%) Query: 3 MKVYGPVRAACPQRVLACLVEKGVEFEVVHVDLDSGEQKRPDFLLRQPFGQVPVVEDGDF 62 +KVYGP + RV+ACL+EK VEF+++ +++ G+ K+PDFL QPFGQVP +D Sbjct: 5 VKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKI 64 Query: 63 RLFESRAIVRYIAAKYAEQG-PDLLGKSLEEKAVVDQWLEVEAHNFNELVYTLVMQLVIL 121 L ESRAI RY+ Y E+G L G + KA +DQWLE E +FN LV QL + Sbjct: 65 SLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALA 124 Query: 122 PRMGERGDLALAHTCEQKLEKVFDVYEQRLSKSRYLAGDSFTLADLSHLPAIRYLVKEAG 181 PRM + D + E+KL KV DVYE+RL +SR+LAGD F+LADLSHLP YLV Sbjct: 125 PRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATD 184 Query: 182 MAHLVTERKSVSAW 195 ++T R +V W Sbjct: 185 RGEILTSRDNVGRW 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1046 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35992 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42224 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11566260 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59461 273 1e-75 >Cs59461 Length = 248 Score = 273 bits (698), Expect = 1e-75, Method: Compositional matrix adjust. Identities = 147/217 (67%), Positives = 158/217 (72%), Gaps = 4/217 (1%) Query: 2 ATASPMASQLKSSFTSPTTSRALPVASPKGXXXXXXXXXXXXXXXXXXXIKAIQSEKPTY 61 + +SPMASQLKSSFTSP SR+L +P+G +KAIQSEKPTY Sbjct: 3 SVSSPMASQLKSSFTSPV-SRSL--LTPRGISGSPFRVVPSKRSPRFI-VKAIQSEKPTY 58 Query: 62 QVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPVLRGIEVGLAHGFLLVGPF 121 QVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSP+LRG+EVGLAHGFLLVGPF Sbjct: 59 QVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPF 118 Query: 122 VKTGPLRDTXXXXXXXXXXXXXXXXXLSICLTMYGIASFKEGEPSIAPSLTLTGRTKEPD 181 VK GPLR+T LSICLT+YGIASF EGEPS AP LTLTGR KEPD Sbjct: 119 VKAGPLRNTEIAGPAGSLAAGGLVVILSICLTIYGIASFNEGEPSTAPGLTLTGRKKEPD 178 Query: 182 QLQSADGWAKXXXXXXXXXISGVTWAYFLLYVLNLPY 218 QLQ+ADGWAK ISGV WAYFLLYVLN Y Sbjct: 179 QLQTADGWAKFTGGFFFGGISGVIWAYFLLYVLNXXY 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51555 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15866261 (471 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30962 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55987 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48626 350 9e-99 >Cs48626 Length = 192 Score = 350 bits (898), Expect = 9e-99, Method: Compositional matrix adjust. Identities = 166/192 (86%), Positives = 176/192 (91%) Query: 103 MKTKNRADRSGVVGAGQKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDDCD 162 MKTKNRADRSGVV AG+KE R SSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDDCD Sbjct: 1 MKTKNRADRSGVVAAGEKESRTSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDDCD 60 Query: 163 AKQSVYVYGCKDSVLKIQGKVNNITIDKCTKMGIVFADVVAACEVVNCNSVEVQCQGSAP 222 AKQSVYV+GCKDSVL+IQGKVNNITIDKCTKMG+VF DVVAA E+VNCN VE QCQGSAP Sbjct: 61 AKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAAFEIVNCNGVEAQCQGSAP 120 Query: 223 TISVDNTAGCQLYLGKDALEASITTAKSSEINVLVPGAEPDGDWGEHALPQQYIHVFKDG 282 TISVDNT GCQLYL +D+L ASITTAKSSEINVLVPGA PD DW EHALPQQ++H +KDG Sbjct: 121 TISVDNTGGCQLYLSQDSLGASITTAKSSEINVLVPGAGPDSDWAEHALPQQFVHTYKDG 180 Query: 283 QFVTTPVSHSGG 294 F TTPVSHSGG Sbjct: 181 HFETTPVSHSGG 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44108 (255 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12883 (435 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35768 (529 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs70246 122 7e-30 >Cs70246 Length = 301 Score = 122 bits (307), Expect = 7e-30, Method: Compositional matrix adjust. Identities = 93/254 (36%), Positives = 134/254 (52%), Gaps = 35/254 (13%) Query: 84 FVAGATGRVGSRTVRELLKLGFRVRAGVRTAQKAEALIQSVKQMKLDVESASEGTQPVEK 143 FVAGATG G R V +LL GF V+AGVR KA+ + ++ Sbjct: 70 FVAGATGSSGKRIVEQLLAKGFAVKAGVRDLDKAKTTL----------------SKDNPS 113 Query: 144 LEIVECDL-EKRDQIGPALGNAS-VVICCIGASEKEVFDITGPYRIDYMATKNLIDAATV 201 L+IV+ D+ E ++ A+G+ S V+C G + +D+ P+++D T NL++A Sbjct: 114 LQIVKADVTEGSAKLSEAIGDDSEAVVCATGF--RPGWDLFAPWKVDNFGTVNLVEACRK 171 Query: 202 AKVNHFILLTSLGTNKVGF-----PAAI-LNLFWGVLIWKRKAEEALFASGLPYTIVRPG 255 VN FIL++S+ N PA I LN+F LI K +AE+ + SG+ YTI+RPG Sbjct: 172 RGVNRFILISSILVNGAAMGQILNPAYIFLNVFGLTLIAKLQAEQYIRKSGINYTIIRPG 231 Query: 256 GM--ERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELIAFMAKNRVSSYCKVVEVIAET 313 G+ E PT NI + EDTL+ G +S QVAE+ + SSY KVVE+I+ Sbjct: 232 GLRNEPPTG------NIVMETEDTLYEGTISRDQVAEVAVEALLHPESSY-KVVEIISRV 284 Query: 314 TAPLTPFGELLAKI 327 AP + +L I Sbjct: 285 DAPKRSYEDLFGSI 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3449 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60106184 147 7e-38 >Cs60106184 Length = 168 Score = 147 bits (370), Expect = 7e-38, Method: Compositional matrix adjust. Identities = 70/85 (82%), Positives = 76/85 (89%) Query: 1 MASAEIEYRCFVGGLAWATDDQSLERAFSQFGEILESKIINDRETGRSRGFGFVTFSSEQ 60 MAS ++E+RCFVGGLAWAT D SL AF +G+ILESKIINDRETGRSRGFGFVTF E+ Sbjct: 1 MASGDVEFRCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEK 60 Query: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 SMRDAIEGMNGQNLDGRNITVNEAQ Sbjct: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5103 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55060 (75 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4026 (401 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs31373 67 2e-13 >Cs31373 Length = 293 Score = 67.4 bits (163), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Query: 252 QTARKQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 311 Q RK + W+PELHRRFV A++QLG +A P +I ELM +D LT + SHLQKYR H Sbjct: 81 QGKRKMKVDWTPELHRRFVQAVEQLGVDKA-VPSRILELMGIDCLTRHNIASHLQKYRSH 139 Query: 312 TRRM 315 + + Sbjct: 140 RKHL 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15886 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11110 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54852 77 1e-16 >Cs54852 Length = 241 Score = 77.4 bits (189), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 8/139 (5%) Query: 24 QYMIIKSLSAILAVILEAFSLYCEGDFKWGCGYPYIAVVLNFSQSWALYCLVQFYTVTKD 83 Q+++I+ + +IL + L+ LY W ++LN S S ALY LV FY V Sbjct: 97 QFVVIRPVCSILMIALQLLGLYSNW-ISWT-----FTIILNISVSLALYSLVIFYHVFAK 150 Query: 84 ELEHIKPLAKFLTFKSIVFLTWWQGVAIALLYDLGLFKSAI--AQGLQSKSSVQDFIICM 141 EL KPL+KFL K IVF +WQG+ + +L LG+ KS + ++Q+ ++C+ Sbjct: 151 ELAPHKPLSKFLCIKGIVFFCFWQGIVLDILVALGVIKSHHFWLDVEHVEEALQNALVCV 210 Query: 142 EMGIASIVHLYVFPAKPYE 160 EM + Y + AKPY Sbjct: 211 EMVFFAAFQRYAYSAKPYR 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3966262 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9932 (171 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93789 266 7e-74 >Cs93789 Length = 294 Score = 266 bits (681), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 130/171 (76%), Positives = 144/171 (84%), Gaps = 1/171 (0%) Query: 1 MRWSGVRIDDWWRNEQFWVIGGVSAHLFAVFQGLLKVLAGIDTDFTVTSKAGD-DEDFSE 59 MRWSGV ID+WWRNEQFWVIGGVS+HLFAVFQGLLKVLAGIDT+FTVTSKA D D DF+E Sbjct: 124 MRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGDFTE 183 Query: 60 LYAFKWXXXXXXXXXXXXXXXXGVVAGVSNAINNGYESWGPLFGKLFFAFWVIVHLYPFL 119 LY FKW GVVAGVS AIN+GY+SWGPLFGKLFFAFWVIVHLYPFL Sbjct: 184 LYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFL 243 Query: 120 KGLLGRQNRTPTIIIVWSILLASIFSLLWVRVDPFLAKSDGPVLEECGLDC 170 KGL+GRQNRTPTI++VWSILLASIFSLLWVRVDPF + GP +E+CG++C Sbjct: 244 KGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRVTGPDVEQCGINC 294 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38163 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25034 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17321 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs87925 281 4e-78 >Cs87925 Length = 197 Score = 281 bits (719), Expect = 4e-78, Method: Compositional matrix adjust. Identities = 133/154 (86%), Positives = 144/154 (93%) Query: 76 EVRAFTEEQEALVVKSWSSMKKNAGELSLKFFLRIFEIAPSAKKLFSFLRDSDVPPEQNP 135 E RAFTEEQEALVVKSW+ MKKNAGEL LKFFLRIFEIAPSA+KLFSFLRDS+VP EQN Sbjct: 42 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQ 101 Query: 136 KLKPHALSVFVMTCESAIQLRKAGRVTVRESNLIDLGATHFKYGVVDEHFEVTKYALLET 195 KLKPHA+SVFVMTCESA+QLRKAG+VTVRES L LGA HFKYGVV+EHFEVTK++LLET Sbjct: 102 KLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLET 161 Query: 196 IKEAVPDMWSPEMKSAWAEAYDQLVAAIKKEMKP 229 IKEAVP+MWSPEMKSAW+EAYDQLVAAIK EMKP Sbjct: 162 IKEAVPEMWSPEMKSAWSEAYDQLVAAIKSEMKP 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16732 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52514 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16735 (391 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39734 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53432 (272 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33417 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2739 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92264 203 1e-54 >Cs92264 Length = 486 Score = 203 bits (517), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 102/246 (41%), Positives = 162/246 (65%), Gaps = 2/246 (0%) Query: 7 NIFSGFDAQQLAEAFNVDVQLIRKLQGQNDRRGNIVRVEGGLQAL-LXXXXXXXXXXXXX 65 N+F GFD + LAEAFNV+ LIR+LQ +RG I+RVE L+ L Sbjct: 232 NLFRGFDERLLAEAFNVNPDLIRRLQRPQIQRGIIIRVEEELRVLSPQRDREQEQEECEE 291 Query: 66 DHLHARGNGYEETICSLRLKQNIGDPWRADVYTPRGGHRSSVTGYDLPVLQKLVKLSAHK 125 + R NG+EETIC+++L+ NI P ADVY PR G ++V ++LP+L+ L +LSA K Sbjct: 292 TPSYERDNGFEETICTMKLRHNIDKPSHADVYNPRAGRVTTVNRFNLPILRDL-QLSAEK 350 Query: 126 GRLYQGALVLPYYNVNANSVIYAIRGSARIQVVQQQDQTVANEEVQQGQVLVIPQNFAAL 185 G LY AL+ P +N+NA+S++Y RG+ R+Q+V + + V + ++++GQ++V+PQ FA + Sbjct: 351 GNLYPNALLAPQWNLNAHSIVYVTRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVV 410 Query: 186 IKARDSGFEYVAIKTDENAMINTLASNLSLMRAMPVQVIASAYQASNNEAKQLRRNRAES 245 +A + G E+++ KT++ AM + LA S++R +P+ VI +++Q S +EA++L+ NR E Sbjct: 411 KRAGNRGLEWISFKTNDVAMTSQLAGRASVLRGLPLDVIQNSFQVSRDEAQRLKYNRQEL 470 Query: 246 TIGAPG 251 T+ PG Sbjct: 471 TVFTPG 476 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53911 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29068 (340 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv766258 (399 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15462 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7592 (363 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16453 81 1e-17 >Cs16453 Length = 223 Score = 81.3 bits (199), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 59/206 (28%), Positives = 103/206 (50%), Gaps = 17/206 (8%) Query: 48 LILFQGGEHLTLEDVLNATG-----QVMEKTSYGTVYKAKLADGGSIALRLLR-----EG 97 ++ F+G + E++++AT + K +G+VY+AK+ G A++ E Sbjct: 24 VLTFEG--KIVYEEIISATNDFNAEHCIGKGGHGSVYRAKVPSGEIFAVKKFHSPLPGEM 81 Query: 98 SCKDSNSCLPVIKQLGRVRHENLIPLRAFYQGKRGEKLLIYDYLPNRSLHDLLHETRAGK 157 S + L I+ L +RH N++ F + +IY+YL + SL +L + K Sbjct: 82 SFQQE-EFLNEIQALTEIRHRNIVKFYCFCSHPK-HSFIIYEYLESGSLDKILCNDASAK 139 Query: 158 PVLNWARRHKIALGIARGLAFLHT-VEAPITHGNVRSKNVLIDEFFVARLTEFGLDKVMV 216 L W +R + G+A L +LH PI H ++ SKNVL+D + A +++FG+ K + Sbjct: 140 E-LGWTQRLNVIKGVADALFYLHNNCFPPIVHRDISSKNVLLDLGYEAHVSDFGIAKFLN 198 Query: 217 PAVADEMVALAKTDGYKAPELQKMKK 242 P ++ LA T GY AP + + + Sbjct: 199 PDSSN-WSELAGTHGYVAPGITTLNQ 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1185 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4128 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26626 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88787 66 2e-13 >Cs88787 Length = 354 Score = 65.9 bits (159), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 37/81 (45%), Positives = 47/81 (58%), Gaps = 4/81 (4%) Query: 53 LLAGGIAGALSKTCTAPLARLTILFQVQGMHSDVATLTKASIWQEASRIIGEEGFRAFWK 112 L+AGG+AGA+S+T APL RL IL QVQ HS + Q I EGFR +K Sbjct: 44 LVAGGVAGAVSRTAVAPLERLKILLQVQNPHS----IKYNGTIQGLKYIWRTEGFRGLFK 99 Query: 113 GNLVTIAHRLPYSSVSFYAYE 133 GN A +P S+V F++YE Sbjct: 100 GNGTNCARIVPNSAVKFFSYE 120 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47090 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14166258 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs3081 240 6e-66 >Cs3081 Length = 161 Score = 240 bits (612), Expect = 6e-66, Method: Compositional matrix adjust. Identities = 117/161 (72%), Positives = 130/161 (80%) Query: 1 MATAEKSVMVVGIDHSEHSLYAFEWTLDHFFAPFPGTAPFKLVIVHAKPSPATAIGLGGP 60 MATAE MVVGID SE S YA +WTLDHFFA PFKLVIVHA+PSP+ IGL GP Sbjct: 1 MATAETQTMVVGIDDSEQSTYALQWTLDHFFANSTVNPPFKLVIVHARPSPSAVIGLAGP 60 Query: 61 GAIDVLPYVEADLKKTADRVVEKAREICSSKSXXXXXXXXXXXXARNVMCEAVEKHHASI 120 GA++VLP+V++D KK A RVVE+A+EICSSKS ARN++CEAVEKHHASI Sbjct: 61 GAVEVLPHVDSDFKKIAARVVEEAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI 120 Query: 121 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTKH 161 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PKTKH Sbjct: 121 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKTKH 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32818 (296 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41088 298 5e-83 >Cs41088 Length = 299 Score = 298 bits (763), Expect = 5e-83, Method: Compositional matrix adjust. Identities = 152/188 (80%), Positives = 155/188 (82%), Gaps = 2/188 (1%) Query: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEESRDAED 60 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEE+RDAED Sbjct: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEEARDAED 60 Query: 61 AIRGRDGYDFDGHRLRVELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYRVLVTGLPS 120 AIRGRDGYDFDGHRLRVELA EYRVLVTGLPS Sbjct: 61 AIRGRDGYDFDGHRLRVELAHGGRGRSSSDRHSSHSSGRGRGVSRRS--EYRVLVTGLPS 118 Query: 121 SASWQDLKDHMRRAGDVCFSQVFHDGGGTVGIVDYTNYDDMKFAIRKLDDSEFRNAFSRA 180 SASWQDLKDHMRRAGDVCFSQVF DG GT GIVDYTNYDDMK AI+KLDDSEFRNAFSRA Sbjct: 119 SASWQDLKDHMRRAGDVCFSQVFRDGSGTTGIVDYTNYDDMKHAIKKLDDSEFRNAFSRA 178 Query: 181 YVRVKEYD 188 YVRV+EYD Sbjct: 179 YVRVREYD 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50497 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44727 (719 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs53206 256 5e-70 >Cs53206 Length = 175 Score = 256 bits (654), Expect = 5e-70, Method: Compositional matrix adjust. Identities = 121/146 (82%), Positives = 131/146 (89%) Query: 548 METLLVHKDLVQTGGLNQLIVELRNEGVTLYGGPRASALLNLPEAHSFHHEYNSMACTVE 607 METLLVHKDL G LN+L+VEL++EGV L+GGPRAS LL +PE FHHEYNSM CTVE Sbjct: 1 METLLVHKDLACNGALNELVVELQHEGVGLFGGPRASKLLQIPETRLFHHEYNSMVCTVE 60 Query: 608 IVDDVHSAIDHIHRHGSAHTDCIIAEDLEVAEVFLRQVDSAAVFHNASTRFCDGARFGLG 667 IVDDV +AIDHIH+HGSAHTDCI+AED +VAE FL QVDSAAVFHNASTRFCDGARFGLG Sbjct: 61 IVDDVRAAIDHIHQHGSAHTDCIVAEDQKVAETFLCQVDSAAVFHNASTRFCDGARFGLG 120 Query: 668 AEVGISTSRIHARGPVGVEGLLTTRW 693 AEVGISTSRIHARGPVGVEGLLTTRW Sbjct: 121 AEVGISTSRIHARGPVGVEGLLTTRW 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52321 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs97586 171 4e-45 >Cs97586 Length = 200 Score = 171 bits (434), Expect = 4e-45, Method: Compositional matrix adjust. Identities = 82/196 (41%), Positives = 119/196 (60%), Gaps = 2/196 (1%) Query: 4 LKVHGSPFSTATMRVVAALYEKGLEFEFVTIDMKAGQHKSEAFLALNPFGQVPAFEDGDL 63 +KV+G P STA RVVA L EK +EF+ ++++M G HK FL + PFGQVPAF+D + Sbjct: 5 VKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKI 64 Query: 64 KLFESRAIAQYIAHEYASNGTQ-LICPDSKKMAIMSVWMEVEAHQYDPHAAKLCFELCIK 122 L ESRAI +Y+ Y G + L + A + W+E E ++P ++ L F+L + Sbjct: 65 SLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALA 124 Query: 123 PMLGLTTDPAAVEDLEAKLGKVLDVYEARLTQSKYLGGDCLGLADLHHLPTLHYLLGSSA 182 P + + D ++ E KL KVLDVYE RL +S++L GD LADL HLP HYL+ ++ Sbjct: 125 PRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATD 184 Query: 183 K-KLFDSRPHVCAWVA 197 + ++ SR +V WV Sbjct: 185 RGEILTSRDNVGRWVG 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52325 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs97586 169 2e-44 >Cs97586 Length = 200 Score = 169 bits (429), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 83/196 (42%), Positives = 117/196 (59%), Gaps = 2/196 (1%) Query: 4 LKVHGSPFSTAVMRVVAALYEKGLEFEFVTIDMKAGQHKSEAFLALNPFGQVPAFEDGDL 63 +KV+G P STAV RVVA L EK +EF+ ++++M G HK FL + PFGQVPAF+D + Sbjct: 5 VKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEKI 64 Query: 64 KLFESRAITQYIAHEYASNGTQ-LICPDSKKMAIMSVWIEVEAHQYDPHAGKLGYELFYK 122 L ESRAI +Y+ Y G + L + A + W+E E ++P + L ++L Sbjct: 65 SLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLALA 124 Query: 123 PMFGQTTDPAAVEDLEAKLGKVLDVYEARLTQSKYLGGDCFGLADLHHLPTLHYLLGSSA 182 P D ++ E KL KVLDVYE RL +S++L GD F LADL HLP HYL+ ++ Sbjct: 125 PRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNATD 184 Query: 183 K-KLFDSRPHVSAWVA 197 + ++ SR +V WV Sbjct: 185 RGEILTSRDNVGRWVG 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52425 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs97586 80 7e-18 >Cs97586 Length = 200 Score = 79.7 bits (195), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 36/89 (40%), Positives = 52/89 (58%) Query: 2 AIMSVWIEVEAHQYDPHAGKLGYELFYKPMFGQTTDPAAVEDLEAKLGKVLDVYEARLTQ 61 A + W+E E ++P + L ++L P D ++ E KL KVLDVYE RL + Sbjct: 97 ASIDQWLEAEGQSFNPPSSALVFQLALAPRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGE 156 Query: 62 SKYLGGDCFGLADLHHLPTLHYLLGSSAK 90 S++L GD F LADL HLP HYL+ ++ + Sbjct: 157 SRFLAGDEFSLADLSHLPNAHYLVNATDR 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3118 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35742 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3466264 (447 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52609 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11106190 253 6e-70 >Cs11106190 Length = 174 Score = 253 bits (647), Expect = 6e-70, Method: Compositional matrix adjust. Identities = 125/163 (76%), Positives = 133/163 (81%), Gaps = 4/163 (2%) Query: 2 ADGPASPPGGSHESGGDQSPRHNVREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQE 61 A+ PASP GGSHESG +QSPR NVREQDRYLPIANISRIMKKALPANGKIAKDAK+TVQE Sbjct: 3 AEAPASPGGGSHESG-EQSPRSNVREQDRYLPIANISRIMKKALPANGKIAKDAKETVQE 61 Query: 62 CVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLQRYRELEGDT 121 CVSEFISFITSEASDKCQ+EKRKTINGDDLLWAMATLGFEDYI+PLK+YL RYRE+EGDT Sbjct: 62 CVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYREMEGDT 121 Query: 122 XXXXXXXXXXXXXXXIGSQPGPNAQFAHQGSFTQAMNYMNSQA 164 QP PN Q AHQGSF Q +NY NSQ Sbjct: 122 KGNAKGGDASAKKD---GQPNPNTQLAHQGSFPQGVNYGNSQG 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58040 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28823 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17253 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48463 94 1e-21 >Cs48463 Length = 84 Score = 94.0 bits (232), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 48/84 (57%), Positives = 56/84 (66%) Query: 122 MYVLVTVEPAGVVAIPHTRERELVIFNIVCDELLLGIPYKAWWVGFXXXXXXXXXXXXPH 181 M+VLVTVEP GVVA+P+ ERE +IFNI CDELLLGIPYKAWWV P+ Sbjct: 1 MHVLVTVEPEGVVAMPNVEEREFIIFNIACDELLLGIPYKAWWVVVFVLLCLGLALITPY 60 Query: 182 FLPPYLLQKNHGPQSANQVLLKDS 205 FLP YLL KN G S + + K+S Sbjct: 61 FLPSYLLPKNGGLPSDLRNVSKES 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2618 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49849 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53255 (468 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29047 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16648 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 160 2e-41 >Cs47542 Length = 355 Score = 160 bits (404), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 91/276 (32%), Positives = 150/276 (54%), Gaps = 12/276 (4%) Query: 2 LINHGVPESLMTGMIEACRGFFDLTEEEKREFQGTHVLSPIRCGTSFNARVDQILFWRDF 61 L+NHGV + + + + +GFF+L+ EEK+++ H G +F +Q L W D Sbjct: 80 LVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKY-WQHPGDVEGFGQAFVVSEEQKLDWADI 138 Query: 62 LKVFVHPQFHS-----PSKPAGFSEVCLEYTQRMRKVAGELLKGISKSLGLEEWYIDKTM 116 + P P P + Y+ ++ +A L+ + K L +++ + + Sbjct: 139 FSMITLPVHLRKPHLFPKLPPLLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFF 198 Query: 117 NMDSGLQILTVNLYPPCPQPEYAMGMPPHSDHSFLTILIQ-NGIGGLQVQHKGQWFDVNP 175 ++G Q + +N YPPCPQPE MG+ PHSD S LTIL+Q N + GLQ+++ G+W + P Sbjct: 199 --ENGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNDGKWIPITP 256 Query: 176 IPNSILVNTGDHLEVLSNGKYKSVLHRAVVNNKTTRISLALSNGPSLDTVVEPIPEL--- 232 +PN+ +VN GD LE+++NG Y+S+ HRA+VN+ R+S+A LD + P L Sbjct: 257 LPNAFIVNIGDTLEIITNGTYRSIEHRAIVNSLQERLSIATFYTKRLDGEIYPASSLISE 316 Query: 233 SHPLKYVGMAYKEYLELQQGNKLDGKTCLDRVRIRT 268 P + + +EY + +L GK+ LD +RI+ Sbjct: 317 KTPALFRRVTVEEYFRNRYARELRGKSQLDDLRIQN 352 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59773 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65016 (376 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65135 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37390 (344 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15940 (287 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14542 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47266 (334 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20467 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs63673 372 e-105 >Cs63673 Length = 206 Score = 372 bits (956), Expect = e-105, Method: Compositional matrix adjust. Identities = 173/200 (86%), Positives = 187/200 (93%) Query: 53 YGNLYSQGYGTNTAALSTALFNSGLSCGACYEMKCNDDPKWCLPGTLTVTATNFCPPNLA 112 YGNLYSQGYGTNTAALSTALFN+G SCG+CYEMKC +DPKWCLPG++ VTATNFCPPNLA Sbjct: 7 YGNLYSQGYGTNTAALSTALFNNGXSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLA 66 Query: 113 LSNTNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCVKKGGIRFTINGHSYFN 172 LSN NGGWCNPPLQHFD+AEPAFLQIAQYRAGIVP+SFRR+PC KKGGIRFT+NGHSYFN Sbjct: 67 LSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFN 126 Query: 173 LVLITNVAGAGDVRAVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQTLSFQVTASDGRTMT 232 LVLITNV GAGDV +VSIKGSKTGWQ MSRNWGQNWQSNSYLNGQ+LSFQ+TASDGRT+T Sbjct: 127 LVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVT 186 Query: 233 SLNVAPAGWQFGQTYEGAQF 252 S NV P WQFGQT+EG QF Sbjct: 187 SNNVVPGNWQFGQTFEGGQF 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19966262 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44844 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37583 168 3e-44 >Cs37583 Length = 233 Score = 168 bits (425), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 80/131 (61%), Positives = 108/131 (82%), Gaps = 1/131 (0%) Query: 19 DEPHVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGLGDNQQTSHKASVSKVN 78 +E HVLAVDD+ +DRK+IE+LL SC+VT ++G RAL++LGL D +Q+ + KV+ Sbjct: 28 EEVHVLAVDDSFVDRKVIERLLTISSCKVTAVDSGRRALQFLGL-DEEQSVNGFDGLKVD 86 Query: 79 LIITDYCMPGMTGYELLKRVKQSSILKEVPVVIMSSENIPTRINKCLEEGAQMFMLKPLK 138 LIITDYCMPGMTGYELLK++K SS L+E+PVVIMSSENI RI++CLE+GA+ F++KP+K Sbjct: 87 LIITDYCMPGMTGYELLKKIKDSSALREIPVVIMSSENILARIDRCLEDGAEDFIVKPVK 146 Query: 139 QSDVKKLRCYL 149 SDVK+++ YL Sbjct: 147 LSDVKRIKDYL 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16608 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6266260 (394 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs34689 526 e-151 >Cs34689 Length = 264 Score = 526 bits (1354), Expect = e-151, Method: Compositional matrix adjust. Identities = 250/256 (97%), Positives = 254/256 (99%) Query: 121 VSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 180 VSTSVVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS Sbjct: 1 VSTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 60 Query: 181 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAF 240 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAF Sbjct: 61 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF 120 Query: 241 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGIN 300 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGIN Sbjct: 121 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAAIKTKRTIQFVDWCPTGFKCGIN 180 Query: 301 YQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG 360 YQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY+KRAFVHWYVGEGMEEG Sbjct: 181 YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEG 240 Query: 361 EFSEAREDLAALEKDY 376 EFSEAREDLAALEKDY Sbjct: 241 EFSEAREDLAALEKDY 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57366 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57874 (41 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26175 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67260 332 4e-93 >Cs67260 Length = 229 Score = 332 bits (850), Expect = 4e-93, Method: Compositional matrix adjust. Identities = 163/219 (74%), Positives = 184/219 (84%), Gaps = 2/219 (0%) Query: 82 RKNPVVAERLSTDHNXXXXXXXXXXXALNPDDSHVVVYTRGVWRIKGIIQVSRSIGDVYL 141 RK V AERLSTDHN AL+PDDSH+VVY RGVWRIKGIIQVSRSIGDVYL Sbjct: 7 RKVIVAAERLSTDHNVGVEEVRKEVEALHPDDSHIVVYARGVWRIKGIIQVSRSIGDVYL 66 Query: 142 KKPEFNRDPIFQQFGNPVPLKRPVMTAEPSILIRKLLPQDSFLIFASDGLWEQLSDEAAV 201 KKP+F RDP+FQQFGNP+PLKRP MTAEPSILIRKL PQD FLIFASDGLWEQL+DEAAV Sbjct: 67 KKPDFYRDPVFQQFGNPIPLKRPAMTAEPSILIRKLRPQDLFLIFASDGLWEQLTDEAAV 126 Query: 202 EIVFKNPRAGIAKRLVRAALHEAAKKREMSYQDIKRIEKGIRRHFHDDITVIVIYLDHH- 260 EIV KNPRAGIAKRLVRAAL EAA+KRE+ Y++IK++++GIRRHFHDDITVIVIYLDHH Sbjct: 127 EIVCKNPRAGIAKRLVRAALQEAARKREVGYKEIKKLKRGIRRHFHDDITVIVIYLDHHQ 186 Query: 261 KGSTNRRPKHSTVNGTTNAPTDIFSLKAHEGDEDLLHTF 299 KGS+N R KH+ + G T+AP DIFSL A E ++D+ H Sbjct: 187 KGSSNSRSKHNAI-GCTSAPVDIFSLNADEAEDDVQHML 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54859 (102 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15066257 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28021 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84538 116 5e-29 >Cs84538 Length = 216 Score = 116 bits (291), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 53/69 (76%), Positives = 65/69 (94%) Query: 3 TVGKRLVNSKEGPPSFEQPKMTLEKLLEYGSMLVQEQENVKRVQLADKYLNEAALGDANE 62 ++GK LVNSKE P+FEQP+MT+EKLLEYG+M+VQEQENVKRVQLADKYL+EAALG+AN Sbjct: 147 SIGKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANA 206 Query: 63 DAIKSGSFF 71 DAI+SG+F+ Sbjct: 207 DAIQSGNFY 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53324 (304 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42089 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15336 292 2e-81 >Cs15336 Length = 263 Score = 292 bits (748), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 139/262 (53%), Positives = 177/262 (67%), Gaps = 3/262 (1%) Query: 7 SSCSDLRWSXXXXXXXXXXXXXXXXYAIVEELAGMGAAVYTCSRTESKLNNLLRDWNAKG 66 S + RWS +AIVEEL GA V+TCSR E++LN +++W +KG Sbjct: 2 SESREQRWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKG 61 Query: 67 FDVRGSVCDVSDRAQREQLIEKVSSGFNGKLNILINNVGTNFSKPTIEYTAADFSALMAT 126 V GS CD+ RA+R++L+E V S F+GKLNIL+NN GT K E+T DFS +M T Sbjct: 62 LKVSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTT 121 Query: 127 NIESGYHLCQLAYPLLKASGAGSIVFISSVAGVVSTGTGSIYAATKAAMNQITKSLACEW 186 N ES YHL QLAYPLLKASG G+I+FISSV GV++ SIYA+TK AMNQ+TK+LACEW Sbjct: 122 NFESAYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEW 181 Query: 187 AKDNIRSNCVAPFCTRTPLIEQMLAKKSMMEE---VVSRTPLGRPGEPQEISSLATFLCM 243 KDNIR N VAP+ RT LI+ + +ME ++ RTP+ RPGEP E+SS+ FLC+ Sbjct: 182 GKDNIRVNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCL 241 Query: 244 PCASYITGQVISVDGGLTANAF 265 P ASY+TGQV +DGG + N F Sbjct: 242 PAASYVTGQVFCIDGGYSVNGF 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2342 (645 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88680 155 8e-40 >Cs88680 Length = 213 Score = 155 bits (393), Expect = 8e-40, Method: Compositional matrix adjust. Identities = 78/158 (49%), Positives = 104/158 (65%), Gaps = 5/158 (3%) Query: 10 IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPIN 68 IGIDLGTT SCV + + ++I N +G+RTTPS VAF E L+G AK Q NP N Sbjct: 60 IGIDLGTTNSCVALMEGKNPKVIENSEGSRTTPSVVAFNQKGELLVGTPAKRQAVTNPTN 119 Query: 69 TVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGPGDKPMITVTYKGEDKQFAAEEISSMVL 128 T+F KRLIGR+F D Q +++ S+K+V P + + +Q++ +I + VL Sbjct: 120 TLFGTKRLIGRKFDDPQTQKEMQMVSYKIVRAPNGDAWV----EANGQQYSPSQIGAFVL 175 Query: 129 IKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAG 166 KM+E AE+YLG +V AV+TVPAYFND+QRQATKDAG Sbjct: 176 TKMKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAG 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47089 (109 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26466257 (396 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35733 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs53949 198 6e-53 >Cs53949 Length = 257 Score = 198 bits (503), Expect = 6e-53, Method: Compositional matrix adjust. Identities = 102/243 (41%), Positives = 149/243 (61%), Gaps = 16/243 (6%) Query: 15 MSKICPIKPVGPLYKNPKVPNAAVRGD---------FMKADDCIEWLDSKPPSSVVYISF 65 MS++CPI+PVGPL VP + + D + D C+EWL+ + SSVVYISF Sbjct: 1 MSQLCPIRPVGPL-----VPPSLLGQDEKLDVGVERWKPEDRCLEWLNKQSNSSVVYISF 55 Query: 66 GSVVYLKQDQVDEIAYGLLNSGVQFLWVMKPPHKDAGLELLVLPEGFLEKAGDKGKMVQW 125 GS+ L +Q++ IA L N + FLW++K + LP FLE+ ++G +V W Sbjct: 56 GSLAQLSANQMEVIATALKNIKLPFLWIVKQSESASSDGEGTLPLWFLEETKNRGLVVSW 115 Query: 126 SPQEQVLAHPSVACFVTHCGWNSSMEALSSGMPVVAFPQWGDQVTDAKYLVDVFKVGVRM 185 PQ +VLAHP++ACFVTHCGW+S +E + +G+PV+A+PQW DQ T+AK + DVFK+G+R+ Sbjct: 116 CPQTKVLAHPALACFVTHCGWSSLLETIVAGVPVIAYPQWSDQPTNAKLVADVFKIGLRL 175 Query: 186 CRGEAENKLITRDEVEKCLIEATTGEKAAELKQNXXXXXXXXXXXXXXGGSSDRNLQEFV 245 +E+ + +E+EKC+ E G K+ K+N GGSSD+N+Q F Sbjct: 176 --RPSEDGFVGNEELEKCVEEIINGPKSEYYKKNAVELKHAARQAVAGGGSSDQNIQLFA 233 Query: 246 DEV 248 DE+ Sbjct: 234 DEI 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv460 (357 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54021 162 6e-42 >Cs54021 Length = 255 Score = 162 bits (409), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 91/247 (36%), Positives = 122/247 (49%) Query: 5 ETEKTIIGWAARDPSGVLSPYTYTLRNTGPEDVLIKVTYCGICHTDLHQIKNDLGMSHYP 64 E K GWAA+D SGVLSP+ ++ R TG +DV KVT+CGICH+DLH IKN+ G + YP Sbjct: 8 EHPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNEWGNTIYP 67 Query: 65 MXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCQSDIEQYCSKKIWSYNDV 124 + C D+E YC K I +Y + Sbjct: 68 IVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCHSCDSCAIDLENYCPKVIMTYANK 127 Query: 125 YTDGKPTQGGFAESMIVDQKFVLKIPDGMAPEQAAPLLCAGVTVYSPLSHFXXXXXXXXX 184 Y DG T GG+++ M+ D+ FV++IP+G + APLLCAG+TVYSPL + Sbjct: 128 YHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGLDKPGMHV 187 Query: 185 XXXXXXXXXXXXVKIAKAMGHHVTVISSSDRKREEAMDHLGADDYLVSSDSTRMQEAADS 244 I K G K+ EA++ LGA+ +LVS D MQ A + Sbjct: 188 GCXRLGRSRPCRPSIRKGYGGSGDCDQYPPSKKSEAIERLGAEFFLVSRDQNEMQAALGT 247 Query: 245 LDYIIDT 251 +D IIDT Sbjct: 248 MDGIIDT 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16133 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78025 114 1e-27 >Cs78025 Length = 183 Score = 114 bits (284), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 59/154 (38%), Positives = 91/154 (59%), Gaps = 1/154 (0%) Query: 48 AKAMGHHVTVISSSDRKREEAMDHLGADDYLISSDSTRMQKAADSLDYIIDTVPVFHPLE 107 KA G +VTV+S+S K+EEA+ LGAD +++SSD +M+ SLD+IIDT HP + Sbjct: 29 GKAFGLNVTVLSTSTSKKEEALSLLGADKFVVSSDLEQMKALGKSLDFIIDTASGDHPFD 88 Query: 108 PYXXXXXXXXXXXXXXXXNTPLQFANPMVMLGRKSITGSFIGSMKETEEVLEFCKEKGVT 167 Y + ++F+ + +G K+++GS G K+T+E+LE+C + Sbjct: 89 AYMSLLKVAGVYVLVGFP-SEVKFSPASLNIGAKTVSGSVTGGTKDTQEMLEYCAAHKIY 147 Query: 168 SMIEMVKMDYVNTAFERLEKNDVRYRFVVDVAGS 201 IE + ++ VN A ERL K DV+YRFV+D+ S Sbjct: 148 PQIETIPIENVNEALERLIKRDVKYRFVIDIQNS 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36401 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 80 3e-17 >Cs169106187 Length = 148 Score = 79.7 bits (195), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 41/117 (35%), Positives = 65/117 (55%), Gaps = 10/117 (8%) Query: 14 KRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPSDTEFEGGIYHGRIQLPAEYPFQ 73 KRIL+E+K++Q +P + P+ E++F WQ I GPSD+ + GG++ I P +YPF+ Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFK 63 Query: 74 PPSFMLLT----PNGRFETQTKICLSISNHHPEHWQPSWSVRTALVALIAFMPTSPN 126 PP T PN + ICL I E W P+ ++ L+++ + + T PN Sbjct: 64 PPKVAFRTKVFHPN--INSNGSICLDILK---EQWSPALTISKVLLSICSLL-TDPN 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55895 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23874 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65458 (352 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 207 2e-55 >Cs47542 Length = 355 Score = 207 bits (526), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 125/326 (38%), Positives = 181/326 (55%), Gaps = 16/326 (4%) Query: 12 LLAKRVQEMVLKGEDP----PQPYICRDGD---GSEDVXXXXXXXXXXXXXXXXXXAPET 64 LL VQE+V ++P P YIC D D S+D + E+ Sbjct: 8 LLVPCVQELV---KNPMLVVPPRYICPDEDSPLNSDDTLISQIPVIDMQSLL----SEES 60 Query: 65 TEKELQKLKSALSSWGCFQATGHGISTSFLDEIRQVTKEFFEQPIEEKKKISKGVEEFEG 124 + EL KL A WG FQ HG+S++FL+++++ K FF +EEKKK + + EG Sbjct: 61 MDSELAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEG 120 Query: 125 YGADPTPEEGQYLDWSDRVFLDVYPEDLRKYKFWPESPNSFRDVLENYTIKMKIVTEMIS 184 +G E Q LDW+D + P LRK +P+ P RD LE Y++++K + + Sbjct: 121 FGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPLLRDTLEVYSMELKSLAMNLI 180 Query: 185 KAMAKSLNLEEKCFLNQFGERGALQARFNYYSRCLRPDIVLGLKPHADGSGYTILLQ-NE 243 M K LN++++ L +F E G R NYY C +P+ V+GL PH+DGS TILLQ NE Sbjct: 181 SKMGKVLNIKDEE-LREFFENGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINE 239 Query: 244 VDGLQILKDDCWLTIPTISNALLVLMGDQMEIMSNGIFKSPVHRVLASSERERISVAVFY 303 V+GLQI D W+ I + NA +V +GD +EI++NG ++S HR + +S +ER+S+A FY Sbjct: 240 VEGLQIKNDGKWIPITPLPNAFIVNIGDTLEIITNGTYRSIEHRAIVNSLQERLSIATFY 299 Query: 304 TPESGKLIGPEEGLIDEERPRLFKKV 329 T I P LI E+ P LF++V Sbjct: 300 TKRLDGEIYPASSLISEKTPALFRRV 325 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40831 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101682 406 e-115 >Cs101682 Length = 347 Score = 406 bits (1043), Expect = e-115, Method: Compositional matrix adjust. Identities = 194/236 (82%), Positives = 209/236 (88%) Query: 1 MVARGDLGAELPIEEVPLLQEDIIRRCHSMQKPVIVATNMLESMINHPTPTRAEVSDIAI 60 MVARGDLGAELPIE+VPLLQEDIIRRC SMQKPVIVATNMLESMI+HPTPTRAEVSDIAI Sbjct: 112 MVARGDLGAELPIEDVPLLQEDIIRRCRSMQKPVIVATNMLESMIDHPTPTRAEVSDIAI 171 Query: 61 AVREGADAVMLSGETAHGKYPLKAVKVMHTVALRXXXXXXXXXXXXXXXXXYKSHMGTMF 120 AVREGADAVMLSGETAHGK+PLKAVKVMHTVALR +KSHMG MF Sbjct: 172 AVREGADAVMLSGETAHGKFPLKAVKVMHTVALRTESSLPVSITPPTQFSAHKSHMGDMF 231 Query: 121 AFHATTMANTLNTPIIVFTRTGSMAITLSHYRPSSTIFAFTNEERVKQRLVLYHGVMPIF 180 AFH+TTMANTLNTPIIVFTRTGSMA+ LSHYRPSSTIFAFTN+ER+KQRLVLY GVMPI+ Sbjct: 232 AFHSTTMANTLNTPIIVFTRTGSMAVILSHYRPSSTIFAFTNQERIKQRLVLYQGVMPIY 291 Query: 181 MQFSDDAEETFSRALSILVNKGLMKEGEHVTLVQSGAQPIWRVESTHHIQVRKVQG 236 MQFSDD EETFSRA+ +L++K L+ +GE VTLVQSGAQPIWR ESTHHIQVRKVQG Sbjct: 292 MQFSDDVEETFSRAIKLLMDKNLVTKGEFVTLVQSGAQPIWRQESTHHIQVRKVQG 347 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14292 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55193 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43469 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14967 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41031 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5457 (325 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36508 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60213 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49587 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18989 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26166 (320 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76227 192 3e-51 >Cs76227 Length = 409 Score = 192 bits (489), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 111/317 (35%), Positives = 172/317 (54%), Gaps = 15/317 (4%) Query: 12 RSFRFKDEDESQEVRAVERRILLETLANQLPTDSIHFSSKLAKXXXXXXXXXXXXXXXXX 71 RS + + + E+R V R++LLETLA +LP+ +I +SS++ Sbjct: 89 RSLKVQGKYGEHEMRCVRRKLLLETLAKELPSGTIRYSSQVVSIEESGHFKLLHLADGTI 148 Query: 72 XXSGKIVIGCDGIRSPVAKWMGFSEPRYVGHCAFRGLGFFPERMPYEPKVNYVYGRGLRA 131 + K++IGCDG+ S VAKW+GF P +VG A RG F +EP +G+GLR+ Sbjct: 149 LKT-KVLIGCDGVNSIVAKWLGFKNPAFVGRSAIRGYSDFKGSHGFEPNFLQFFGKGLRS 207 Query: 132 GYVPVSPTKVYWFICFNSPSPGPKITDPSV-LKKQARELVRNWPSELLNIIDLTPDDTII 190 G++P +YWF + S S ++ D S LK+ + + P+++ +I+ TP D+II Sbjct: 208 GFIPCDDQTIYWFFTWTSSSQDKELEDHSAELKQFVLGKLHDLPAKVKAVIEKTPLDSII 267 Query: 191 RTPLVDRWLWPAISPPASSGGVVLVGDAWHPMTPNLGQGACCALEDAVVLAKKLSDALR- 249 + L R + S G V + GDA HPMTP++GQG C ALED +VLA+ +++AL+ Sbjct: 268 SSRLQYRQPQEVLWGNISRGSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKT 327 Query: 250 ---LGPES-------VEGALRLYGSERWPRIFPLTMRANLVGSLLQWDNPVVCSVRNNVI 299 +G E VE L+ Y ER R F L A LVGS+ Q D ++ +R+ ++ Sbjct: 328 KQGVGEEDEEEFNKRVEMGLKRYAKERRWRCFELISTAYLVGSIQQSDGKILNFLRDKIL 387 Query: 300 VPKLVRLGPLLEHTNFE 316 LV G L++ +F+ Sbjct: 388 ASFLV--GLLIKKADFD 402 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18629 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6759 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 138 5e-35 >Cs99541 Length = 211 Score = 138 bits (347), Expect = 5e-35, Method: Compositional matrix adjust. Identities = 59/160 (36%), Positives = 100/160 (62%) Query: 12 KLVLVGDMGTGKTSLVLRFVKGQFFEHQEPTIGAAFFTQLLSLNEATVKFDIWDTAGQER 71 K +++GD G GK+ L+L+F +F + TIG F ++++++ +K IWDTAGQE Sbjct: 8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQES 67 Query: 72 YHNLAPMYYRGXXXXXXXYDISNVDTFVRAKKWVQELQKQGNKNLVMALVANKCDLESKR 131 + ++ YYRG YDI+ +TF W+++ ++ N N+ + L+ NKCDL +R Sbjct: 68 FRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRR 127 Query: 132 EVNTQEGEKLSEENGMFFIETSAKTSLNINELFYEIAKRL 171 V+T+EGE+ ++E+G+ F+E SAKT+ N+ E F + A + Sbjct: 128 AVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATI 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6345 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51913 (408 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7966262 (179 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48818 (46 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60961 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56337 (311 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26640 (292 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs13890 171 9e-45 >Cs13890 Length = 225 Score = 171 bits (433), Expect = 9e-45, Method: Compositional matrix adjust. Identities = 96/212 (45%), Positives = 130/212 (61%), Gaps = 6/212 (2%) Query: 64 LGGNGFVGSAICKAAVSKGIEVTXXXXXXXXXXXXXWVDQVNWVTGDVFYVN-WDEVLVG 122 LGGNGFVGS IC+ A+ +G+ V W + V W G++ + W E L G Sbjct: 1 LGGNGFVGSHICREALDRGLTVASLSRSGRSSLRDSWANNVIWHQGNLLSSDSWKEALDG 60 Query: 123 ATAVVSTLGGFGSEEQMKRINGEANVLAVGAAKDYGVPKFILISVHDYNLPQFLLDSGYF 182 TAV+S +GGFGS M +ING AN+ A+ AA + GV +F+ IS D+ + +LL GY+ Sbjct: 61 VTAVISCVGGFGSNSYMYKINGTANINAIRAASEKGVKRFVYISAADFGVANYLLQ-GYY 119 Query: 183 TGKRKAESEVLSKYPNSGVVLRPGFIYGKRRVDGFEIPLDLIGEPLEKILRATENLTRPL 242 GKR AE+E+L++YP GV+LRPGFIYG R V G ++PL +IG P+E +L+ +PL Sbjct: 120 EGKRAAETELLTRYPYGGVILRPGFIYGTRTVGGMKLPLGVIGSPMEMVLQH----AKPL 175 Query: 243 SALPASDLILAPPVSVDDVALAAVNAITDDDF 274 S LP + PPV+V VA AV A TD F Sbjct: 176 SQLPLVGPLFTPPVNVTVVAKVAVRAATDPVF 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47699 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37739 65 3e-13 >Cs37739 Length = 121 Score = 65.5 bits (158), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 29/55 (52%), Positives = 42/55 (76%) Query: 1 MARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGRFSVKSDVYSFGVLILEIISGKR 55 +A++ V + RV+GTYGY +PEYAM G+ +VKSDVYSFGV+ LE+I+G++ Sbjct: 47 LAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRK 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6362 (325 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3451 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106190 147 1e-37 >Cs169106190 Length = 361 Score = 147 bits (372), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 95/222 (42%), Positives = 117/222 (52%), Gaps = 12/222 (5%) Query: 65 FSIFKRRFGKSYASQEEHDYRFKVFKANLRRARRHQQLDPSATHGVTQFSDLTPAEFRGT 124 F+ F RR+GK Y S EE RF F NL R S G+ +F+D + EF+ Sbjct: 62 FARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRH 121 Query: 125 YLGLRPLKLPHDAQKAPILPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWSFSTTGALEGA 184 LG + L + LPE DWR+ G V+ VK+QG CGSCW+FSTTG+LE A Sbjct: 122 RLGAAQ-NCSATTKGNHKLTADVLPETKDWRESGIVSPVKDQGHCGSCWTFSTTGSLEAA 180 Query: 185 NFLATGNLVSLSEQQLVECDHECDPEEMGSCDSGCNGGLMNTAFEYTLKAGGLMKEEDYP 244 A G +SLSEQQLV+C + + GCNGGL + AFEY GGL EE YP Sbjct: 181 YHQAFGKGISLSEQQLVDCAQAFN-------NQGCNGGLPSQAFEYIKYNGGLDTEEAYP 233 Query: 245 YTGTDRGSCKFDKTKIAASVSHFQCISL---DEDQIAXYLVK 283 YTG D G CKF + V I+L DE Q A LV+ Sbjct: 234 YTGKD-GVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVR 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55742 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51028 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55459 (83 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7783 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44383 279 2e-77 >Cs44383 Length = 175 Score = 279 bits (713), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 136/174 (78%), Positives = 149/174 (85%), Gaps = 1/174 (0%) Query: 1 MAEGDEDLPRDAKIVKSLLKSMGVDDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHASKP 60 MAEGDEDLPRDAKIVKSLLKSMGV+DYEPRVIHQFLELWYRYVVDVLTDAQVYSEHA K Sbjct: 1 MAEGDEDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKN 60 Query: 61 AIDCDDVKLAIQFKVNFSFFQPPAREVLLELARNRNKIPLPKSIAGPGIPLPPEQDTLIS 120 IDCDDVKLA+Q KVN SF QPPAREVLLELA+NRNKIPLPKSIAG GIPLPPEQDTLIS Sbjct: 61 TIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLIS 120 Query: 121 PNYQLAIPKKRTAQAVXXXXXXXXGADPSHASQEGRTDLPQHTPQRVSFPIGAK 174 PNYQL+I KK++AQA +P +AS+E RTD+ Q TPQ+VSFP+ + Sbjct: 121 PNYQLSIEKKQSAQAAEEMEEDEQSTEP-NASEEQRTDMLQQTPQKVSFPLARR 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28441 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51002 (53 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14207 (366 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36090 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13281 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55978 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13517 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9104 66 7e-14 >Cs9104 Length = 101 Score = 66.2 bits (160), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 36/75 (48%), Positives = 41/75 (54%) Query: 18 LASAAQLGWGVFSYRRGGVGDSSLMPVKXXXXXXXXXXXXXXXXXXXXXXXGIHKVEDLK 77 LAS QLGWG+ S+R+G GDS LMPVK GI KVEDL Sbjct: 18 LASTGQLGWGIASFRKGYAGDSRLMPVKAFGVASLFVGSAASASLAFLQASGIRKVEDLL 77 Query: 78 EMGANIRTGLGVRPR 92 E+GANIRT LG+ R Sbjct: 78 EVGANIRTRLGIPSR 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53479 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42126 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55360 (387 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs22106186 102 9e-24 >Cs22106186 Length = 229 Score = 102 bits (253), Expect = 9e-24, Method: Compositional matrix adjust. Identities = 70/148 (47%), Positives = 93/148 (62%), Gaps = 19/148 (12%) Query: 214 AASHKVSVNSVAPTNVAGKSVRP-----LHRNEEIHAA----CVASSTSAGSPFEVCQ-- 262 A KV +VAPT+V+GK V P + E+ A AS TS P V Sbjct: 21 ATPDKVLATAVAPTSVSGKPVGPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPE 80 Query: 263 ---QDERQLKRERRKQANRESAKKSRLRKQAENEELRMRYETLNEENKALKFEISKLTEH 319 Q+ER+LKRERRKQ+NRESA++SRLRKQAE EEL + ++L +EN +LK EI++L+E+ Sbjct: 81 TWIQNERELKRERRKQSNRESARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSEN 140 Query: 320 LDKVRLENTALREKLK-----NKQQLEL 342 +K+R EN AL EKLK NKQ++ L Sbjct: 141 SEKLRQENAALLEKLKSAQLGNKQEIVL 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11347 (296 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27426 (254 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41990 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12139 (355 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78025 279 3e-77 >Cs78025 Length = 183 Score = 279 bits (713), Expect = 3e-77, Method: Compositional matrix adjust. Identities = 137/183 (74%), Positives = 151/183 (82%) Query: 173 MMRHKMNQPXXXXXXXXXXXXXXXAVKFGKAFGLRVTVFSTSISKKEEALNLLGADKFVV 232 MMRHKMNQP AVKFGKAFGL VTV STS SKKEEAL+LLGADKFVV Sbjct: 1 MMRHKMNQPGKSVGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSKKEEALSLLGADKFVV 60 Query: 233 SSDEQQMMALSRSLDFIIDTASGDHPFDPYLSLLKTAGVLVLVGFPSEVKFSPGSIVMGM 292 SSD +QM AL +SLDFIIDTASGDHPFD Y+SLLK AGV VLVGFPSEVKFSP S+ +G Sbjct: 61 SSDLEQMKALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSEVKFSPASLNIGA 120 Query: 293 RTVSGSATGGTKDTQEMLDFCAAHGIHPEIEVIPIQYANEALERLIKKDVKYRFVIDIEN 352 +TVSGS TGGTKDTQEML++CAAH I+P+IE IPI+ NEALERLIK+DVKYRFVIDI+N Sbjct: 121 KTVSGSVTGGTKDTQEMLEYCAAHKIYPQIETIPIENVNEALERLIKRDVKYRFVIDIQN 180 Query: 353 SLK 355 SLK Sbjct: 181 SLK 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54200 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41343 173 9e-46 >Cs41343 Length = 166 Score = 173 bits (439), Expect = 9e-46, Method: Compositional matrix adjust. Identities = 83/157 (52%), Positives = 115/157 (73%), Gaps = 3/157 (1%) Query: 4 NRRVGVAVDFSACSKKALKWALDNVVRDGDHLIILSV-LPEGHYEEGEMQLWETTGSPLI 62 NR +GVA+DFS SK ALKWA+DN++ GD L I+ + LP+ +E LW TGSPLI Sbjct: 5 NRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQD--DESRNLLWSDTGSPLI 62 Query: 63 PLSEFSDPIISKKYGVKPDAETLDIVNCVARQKDIVVVMKVYWGDAREKICEAIDNIPLS 122 PL EF D + K+Y V D + LD+++ ++QK + VV K+YWGDAR+K+CEA++ + L Sbjct: 63 PLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLD 122 Query: 123 CLVIGNRGLGKIKRAILGSVSNYVVNNGSCPVTVVKN 159 LV+G+RGLG I+R +LGSVSN+V+ N SCPVT+VK+ Sbjct: 123 SLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKD 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15082 (369 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4183 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666 (612 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68010 128 2e-31 >Cs68010 Length = 146 Score = 128 bits (321), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 68/138 (49%), Positives = 87/138 (63%), Gaps = 6/138 (4%) Query: 468 MKANLGSFAAAL--KGKDVWVMNVVPEDGPNTLKLIYDRGLIGTIHNWCEAFSTYPRTYD 525 M A+ F +AL KGK VWVMNVVP G N L +I DRG +G +H+WCEAF TYPRTYD Sbjct: 1 MNAHSCGFNSALLEKGKSVWVMNVVPTIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTYD 60 Query: 526 LLHAWTVFS--DIEKKGCSAEDLLIEMDRILRPTGFVIIRDKPSVIEFVKKYLTALHWEA 583 L+HA + S + CS D+ E+DRILRP G+VIIRD +IE + T L W+A Sbjct: 61 LVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIESARALTTRLKWDA 120 Query: 584 --VSNERDGDELVFLIQK 599 + E + DE + + QK Sbjct: 121 RVIEIESNSDERLLICQK 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2678 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30866258 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34340 (171 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48218 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 213 1e-57 >Cs66150 Length = 305 Score = 213 bits (542), Expect = 1e-57, Method: Compositional matrix adjust. Identities = 104/190 (54%), Positives = 135/190 (71%), Gaps = 4/190 (2%) Query: 28 RSQLTTDFYNESCPNLLTIVRKAVKNAIKTETRMAASLVRLHFHDCFVNGCDGSVLLDGS 87 ++QL+ FY+ +CPN+L + +K A ++ R+ ASL+RLHFHDCFV+GCD S+LLD + Sbjct: 31 QAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLDST 90 Query: 88 ---DGEKSALPNLNSVRGFDVVDTIKSSVESACPGVVSCADILAIAARDSVLLSGGNTWK 144 D EK A PN NS RGF+V+D +K++VE ACP VVSCADIL IAA SV LSGG +W Sbjct: 91 NTIDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSGGPSWA 150 Query: 145 VFLGRRDGLVANQTGANNGLPFPTDSLDTITQKFANVGLN-QTDVVSLSGAHTIGLARCT 203 V LGRRD AN+ AN LP P D+LD + F NVGLN + D+V+LSGAHT G A+C Sbjct: 151 VPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFGRAQCQ 210 Query: 204 TFSSRLFNFS 213 F RL++F+ Sbjct: 211 FFRGRLYDFN 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31136 (506 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23527 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43002 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99914 115 5e-28 >Cs99914 Length = 157 Score = 115 bits (287), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 58/113 (51%), Positives = 79/113 (69%), Gaps = 1/113 (0%) Query: 2 GCF-QSTARKQFPGHEDPVILASQTAFSVSEVEALFELFKSISSSVIDDGLINKEEFQLA 60 GCF K D V LA+ + F+++EVEAL+ELFK +SSS+IDDGLI+KEE +LA Sbjct: 41 GCFDHHCPPKLRYTFNDLVRLANNSPFTINEVEALYELFKELSSSLIDDGLIHKEELRLA 100 Query: 61 LFKNRKKENLFANRIFDLFDVKRKGVIDFGDFVRSLNVFHPNAPQEDKIDFSF 113 L K ENLF +R+FDLFD K+ GVI+ +FVR+L++FHP+ P E ++ F Sbjct: 101 LLKTTSGENLFPDRVFDLFDEKKNGVIEIEEFVRALSIFHPSTPLEGQMTLHF 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20760 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54217 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65232 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30500 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53533 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44029 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54977 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4195 (462 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38834 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19271 (485 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81139 122 7e-30 >Cs81139 Length = 104 Score = 122 bits (306), Expect = 7e-30, Method: Compositional matrix adjust. Identities = 56/82 (68%), Positives = 66/82 (80%) Query: 391 KLLDASNLENKRAKIVSCGARHSVVLTEGGEIFSWGWNKYGQLGLGDCIDRNIPSPVSIG 450 +LLDA +LEN +K VSCGARH+ V+ + G++F WGWNKYGQLGLGD IDRNIPS V+I Sbjct: 23 RLLDAPSLENVHSKSVSCGARHTAVIADDGKVFCWGWNKYGQLGLGDVIDRNIPSQVTIE 82 Query: 451 GCQLKNVACGWWHTLLLATTST 472 GC +NVACGWWHTLLLA T Sbjct: 83 GCVPRNVACGWWHTLLLAVPPT 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv866 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88814 181 8e-48 >Cs88814 Length = 211 Score = 181 bits (458), Expect = 8e-48, Method: Compositional matrix adjust. Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 10/187 (5%) Query: 39 NTTIPLSPTDNPVSNVSS------KEPDESKVGGSAGAADPVASSPTNTATVSDIQKKIR 92 N P+ NP + V+S K ++SK + A PV+ + V+D QKKIR Sbjct: 28 NNVGPMDLEQNPGAAVNSSAVEVKKNGNDSKTAVTITAVSPVSG---DADLVTDTQKKIR 84 Query: 93 RAERFGMPVQLSEEEKRNSRAERFGTGPTVHGSDGSKKSEELKRKARAERFGLPLDSAPT 152 RAERFGMPVQ+SEEEKRN+RAERFGTG GS+ SK SEELKRKARAERFGLP+ S+ + Sbjct: 85 RAERFGMPVQMSEEEKRNTRAERFGTGSKTQGSEVSKTSEELKRKARAERFGLPVPSSVS 144 Query: 153 DEESKKKARLARFASVSKTDTLEEDKKKARAIRFSNPPSDSLSQVNGKGE-DIEPKTAIA 211 +EE+K+KARLARFA KTD++EEDK+KARA+RFS S S+SQVNGKG ++E K AI Sbjct: 145 EEEAKRKARLARFAPYPKTDSVEEDKRKARALRFSKTSSSSVSQVNGKGNIEVEAKAAIT 204 Query: 212 GKASGGA 218 G+A G A Sbjct: 205 GEADGVA 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv941 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41557 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60295 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs23191 212 4e-57 >Cs23191 Length = 225 Score = 212 bits (539), Expect = 4e-57, Method: Compositional matrix adjust. Identities = 112/195 (57%), Positives = 136/195 (69%), Gaps = 3/195 (1%) Query: 1 MSTSGHTIEVTSLSPKVTEKDVYDFFAFSGAIERVEMVRSADECACTAYVTFKDAYAVET 60 M G+ EV LSP TEKD+++FF+ G VE++RS EC TAYVTF +AYA+ET Sbjct: 1 MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSG-ECGGTAYVTFSNAYALET 59 Query: 61 AVLLSGATIVDQRVCITRWGHYEDEFDLWNRPTWKLEDETSSTHAPETNRSYPDAGEAVT 120 AVLLSGA IVDQ VCI RWG + DE + W +W DE S + + GEAVT Sbjct: 60 AVLLSGAAIVDQPVCIIRWGAFTDEPNPWIS-SWGF-DENSGSMTTHVGQFVSTPGEAVT 117 Query: 121 MAQEVVKTMLAKGYILGKDALSKAKTFDESHQLSATAVATVAELSQRIGLTDKFCAGVEA 180 +AQ+ VKTM+AKGY+L KDAL KAK DES+ LSA+A A VAELS RIGLTDK A +EA Sbjct: 118 VAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEA 177 Query: 181 AKSVDQRYHVSEITK 195 KSVD++YHVS+ITK Sbjct: 178 IKSVDEKYHVSDITK 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5032 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47772 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48554 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55522 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64062 238 3e-65 >Cs64062 Length = 231 Score = 238 bits (607), Expect = 3e-65, Method: Compositional matrix adjust. Identities = 114/144 (79%), Positives = 127/144 (88%) Query: 30 RPVFGRREAAMLSIGLLAGAIWNASENEVAVASEFTDMPALRGKDYGKTKMRFPDYTETA 89 R V RR + SIGLLA A++NAS++ V +A+EF DMPALRGKDYGKTKMR+PDY ET Sbjct: 68 RQVVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYIETE 127 Query: 90 SGLQYKDLRVGSGPSPKVGETVVVDWDGYTIGYYGRIFEARNKTKGGSFQGDDKDFFKFR 149 SGLQYKDLR GSGP PK+GETVVVDWDGYTIGYYGRIFEARNKTKGGSF+GDDKD+FKFR Sbjct: 128 SGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFR 187 Query: 150 VGSQQVIPAFEEAVSGMSLGSVRS 173 +GSQ VIPAFEEAVSGM+LG VRS Sbjct: 188 LGSQDVIPAFEEAVSGMALGGVRS 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54745 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56146 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 146 1e-37 >Cs169106187 Length = 148 Score = 146 bits (368), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 67/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%) Query: 5 ARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFSEEYP 64 A KR++++ K LQ+DPP S P ++ W A I GP D+P+ GG F +T+ F +YP Sbjct: 2 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYP 61 Query: 65 NKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANS 124 KPP V F +++FHPNI ++GSICLDIL+ QWSP ++ +L SI SLL DPNP+ P Sbjct: 62 FKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVP 121 Query: 125 EAARMFSENKREYNRRVREIVEQSWT 150 E A M+ +K +Y R SWT Sbjct: 122 EIAHMYKSDKAKYESTAR-----SWT 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13930 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22768 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50063 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14039 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67057 188 5e-50 >Cs67057 Length = 281 Score = 188 bits (477), Expect = 5e-50, Method: Compositional matrix adjust. Identities = 105/128 (82%), Positives = 115/128 (89%) Query: 113 MIKCSRKVEGLKDAVDIVGTGGDGANTVNISTGASILAAACGANVAKQGNKSSSSACGSA 172 MIK + KVEGL DAVDIVGTGGDGANTVNISTGASILAAACGA VAKQG++SSSSACGSA Sbjct: 1 MIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGSRSSSSACGSA 60 Query: 173 DVLEALGIAIELNPQGVTRCVNETXIGFMMAPIYHPAMKNVGPVKKKLKVKTVFNILGPM 232 DVLEALG+ I+L+P+GV RCV+E IGFMM+ YHPAMK V PV+KKLKVKTVFNILGPM Sbjct: 61 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPM 120 Query: 233 LNPARVPF 240 LNPA VPF Sbjct: 121 LNPACVPF 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55440 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30686 (268 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6463 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50297 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13463 (308 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19474 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25553 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3492 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42846 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46739 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7682 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30030 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36678 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38964 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60290 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50787 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57061 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31139 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41033 (703 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20370 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60106184 107 1e-25 >Cs60106184 Length = 168 Score = 107 bits (266), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 45/79 (56%), Positives = 68/79 (86%) Query: 6 EYRCFIGGLSWSTSDRSLKEAFEKFGHLVEAKVVVDKFSGRSRGFGFVSFDDKQAMEDAI 65 E+RCF+GGL+W+T+D SL EAF +G ++E+K++ D+ +GRSRGFGFV+F D+++M DAI Sbjct: 7 EFRCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAI 66 Query: 66 KEMHGMDLDGRSITVDKAQ 84 + M+G +LDGR+ITV++AQ Sbjct: 67 EGMNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6854 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38339 (284 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs173106183 153 2e-39 >Cs173106183 Length = 286 Score = 153 bits (386), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 80/147 (54%), Positives = 95/147 (64%), Gaps = 16/147 (10%) Query: 5 KAVFGEKEWYFFSPRDRKYPNGLRPNRAAASGYWKATGTDKTIXXXXXXXXXXXXXXXXX 64 KA FGEKEWYFFSPRDRKYPNG RPNRA SGYWKATGTDK I Sbjct: 57 KAEFGEKEWYFFSPRDRKYPNGTRPNRATVSGYWKATGTDKAI-------YGGSKYLGVK 109 Query: 65 XALVFYQGRPPKGIKTNWIMHEYRLAQPPNPAINKPPLKLRDASMRLDNWVLCRIYKKSN 124 ALVFY+GRPPKGIKT+WIMHEYRL P + P K + SM+LD+WVLCRIYKK Sbjct: 110 KALVFYKGRPPKGIKTDWIMHEYRLNDP-----TRQPYK-HNGSMKLDDWVLCRIYKKRQ 163 Query: 125 AVPPATAAAIDDDREQEDSFMEESLKS 151 + + +D E++ S +++ K+ Sbjct: 164 T---GSRSVLDAKVEEDQSCVDQLGKT 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4686 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30228 (378 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10309 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1885 (65 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48941 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11916 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv601 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60434 (83 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3886 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26266265 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59040 (266 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2297 (309 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23174 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52434 277 7e-77 >Cs52434 Length = 203 Score = 277 bits (708), Expect = 7e-77, Method: Compositional matrix adjust. Identities = 133/207 (64%), Positives = 157/207 (75%), Gaps = 4/207 (1%) Query: 1 MATASNEATSICSHCDRSIPSTNIDLHYVHCSRNLERCKHCGDMVPKKHAEEHYLNTHAS 60 MA S+E T ICSHCDR+IPS+NIDLH+ HCSRNLERCK CGDMVP+K+AEEH+LNTHA Sbjct: 1 MAMTSDETTKICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAP 60 Query: 61 VSCSLCSETMEREILAVHRGENCPQRIVTCEFCEFPLPAIDLSEHQEVCGNRTELCHLCR 120 V+CS CSETMEREILA+H+GE CPQRIVTC+FCEFPLPA+DL+EHQEVCGNRTELCHLC Sbjct: 61 VACSQCSETMEREILAIHKGEKCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCN 120 Query: 121 RYVRLRERNDHEANCNGVSYDSVGVPDNTVXXXXXXXXXXXXXXXXXXXXXXXFSQRRVL 180 RY+RLRER +HE+ C GV ++VG N F ++R L Sbjct: 121 RYIRLRERYNHESRCTGVPENTVGSSRNV----RAAESDQGAHRRPAPPPPNEFYRKRFL 176 Query: 181 FTIGITGIAVILRSLFFQRKTENTEMH 207 TI ITGIAV+L SLFF RKTE +++H Sbjct: 177 LTIAITGIAVLLGSLFFPRKTETSQVH 203 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21324 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33977 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2967 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs171106184 253 1e-69 >Cs171106184 Length = 175 Score = 253 bits (646), Expect = 1e-69, Method: Compositional matrix adjust. Identities = 118/168 (70%), Positives = 133/168 (79%) Query: 75 FQLYQSGIFTGRCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWGEEGYIRMERDLATS 134 FQLY+SGIFTGRCGT+LDHGVTAVGYGTENG DYWIVKNSWG+SWGE GYIRMER++A + Sbjct: 3 FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEGGYIRMERNVAGT 62 Query: 135 ATGKCGIAMEASYXXXXXXXXXXXXXXXXXXXXXXTVCDNYYACPESSTCCCIFEYAKYC 194 TGKCGIAMEASY VCDNYY+CPES+TCCC+FEY C Sbjct: 63 LTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSC 122 Query: 195 FQWGCCPLEAATCCEDHDSCCPQEYPVCNVRAGTCMMSKDNPLGVKAL 242 F WGCCPLEAATCC+DH SCCP +YP+CNVRAGTC+MSKDNPLG + + Sbjct: 123 FAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGSEGI 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29255 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103953 238 2e-65 >Cs103953 Length = 171 Score = 238 bits (608), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 121/172 (70%), Positives = 131/172 (76%), Gaps = 4/172 (2%) Query: 1 MGTFGYVAPEYASTGMLNERSDVYSFGILLMEIISGRNPVDYSRPPGEVNLVEWLKAMVT 60 MGTFGYVAPEYASTGMLNERSDVYSFGIL+ME+ISGRNPVDYSRPPGEVNLVEWLK MVT Sbjct: 1 MGTFGYVAPEYASTGMLNERSDVYSFGILIMEVISGRNPVDYSRPPGEVNLVEWLKTMVT 60 Query: 61 NRNAEGVLDPKIPEKPSSXXXXXXXXXXXXCVDPNAQKRPKMGHVIHMLEAXXXXXXXXX 120 NRNAEGVLDP++ EKP S CVDPNA KRPKMGHVIHMLEA Sbjct: 61 NRNAEGVLDPRLQEKPCSRALKRALLVALRCVDPNAHKRPKMGHVIHMLEA--EEFPFRD 118 Query: 121 XXXAGREHGRLQRDGMKDRFLEKRMIESGDSSGYESGAQNNRSSWKK--PEE 170 AGREHGR +G+K R +EK + ESGDSSGYESG Q N+ W+K PEE Sbjct: 119 ERRAGREHGRSPHNGIKGRLMEKGVSESGDSSGYESGVQTNKPLWRKLEPEE 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41793 (323 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs97733 269 3e-74 >Cs97733 Length = 197 Score = 269 bits (687), Expect = 3e-74, Method: Compositional matrix adjust. Identities = 131/174 (75%), Positives = 148/174 (85%), Gaps = 1/174 (0%) Query: 146 VCTVTDVSVNAKGFIAAFVAVWSTALQQYYVHFLQRKYSLGSFNLLGHTAPVQAASLLLL 205 V TVTDVSVNA+GFIAA +AVWST++QQYYVH LQRKYSL SFNLLGHTAP QAA+LL++ Sbjct: 7 VGTVTDVSVNARGFIAALIAVWSTSIQQYYVHHLQRKYSLTSFNLLGHTAPAQAATLLVI 66 Query: 206 GPFLDYWLTNKRVDNYQYSLISVMFIILSCTIAVGTNLSQFICIGRFTAVSFQVIGHMKT 265 GPFLD WLT+KR+ Y Y++ SV+F+ILSCTIAVGTNLSQFICIGRFTAVSFQV+GHMKT Sbjct: 67 GPFLDNWLTDKRIYAYDYNIASVIFLILSCTIAVGTNLSQFICIGRFTAVSFQVLGHMKT 126 Query: 266 XXXXXXXXXXXXKEGLNLHVVLGMIIAVVGMIWYGNASSKPGGKERRSPALPST 319 KEGLN HVVLGMIIAV GMIWY NAS+KPGGKERRS +LP+T Sbjct: 127 ILVLIMGFLFFGKEGLNFHVVLGMIIAVFGMIWYSNASTKPGGKERRS-SLPTT 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34301 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52996 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24909 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv786 (278 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs85452 86 3e-19 >Cs85452 Length = 269 Score = 86.3 bits (212), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 59/141 (41%), Positives = 60/141 (42%) Query: 138 AIRKKVEESLNSEEIKLEIQRRLEEGRKRLLDEVAIQXXXXXXXXXXXXXXXXXXXXXXX 197 AIRKKVEESLNSEEIK+EIQRRLEEGRKRLLDEV Q Sbjct: 129 AIRKKVEESLNSEEIKMEIQRRLEEGRKRLLDEVESQLEKEKEAALTEARRKEEQARKEK 188 Query: 198 XXXXXXXXXXXXXVEESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 257 VEES N Sbjct: 189 EELEKMLEENRRKVEESQRREAEEQQRREEERYRELERIQREKEEAMRRKKQQEEEERVN 248 Query: 258 QMKLLGKNKSRPKLSFALGSK 278 QMKLLGKNKSRPKLSFA GSK Sbjct: 249 QMKLLGKNKSRPKLSFAFGSK 269 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18392 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8144 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33397 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11866256 (301 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31700 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19490 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58465 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42823 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31784 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47125 (406 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46792 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29781 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55918 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38343 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9578 (145 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17894 (228 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60577 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60664 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15500 (509 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52071 375 e-106 >Cs52071 Length = 230 Score = 375 bits (963), Expect = e-106, Method: Compositional matrix adjust. Identities = 182/230 (79%), Positives = 202/230 (87%) Query: 201 MVLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTADQPAQDFYIVVSTRFTSQVLTTTGILR 260 M LVEVEGTHT+QTTYSSLDVHVGQSYSVLVT DQP QDFYI VSTRFT++VLT+TG L Sbjct: 1 MKLVEVEGTHTIQTTYSSLDVHVGQSYSVLVTMDQPPQDFYIAVSTRFTNKVLTSTGTLH 60 Query: 261 YSNSAXXXXXXXXXXXTIQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTSRTIRL 320 YSNSA T QIDWSLNQARSIRTNLTASGPRPNPQGSYHYG+IN SRTI+L Sbjct: 61 YSNSAHPVSGPVPGGPTTQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKL 120 Query: 321 ASSAGQVNGKQRYAVNSVSYVPGDTPLKVADFFKIGGVFRVGSISDNPTGGGVYLDTSVM 380 SSAGQVNGKQRYAVNSVS++P DTPLK+AD+FKIGGVFRVGSI D PTGG +YLDTSVM Sbjct: 121 ESSAGQVNGKQRYAVNSVSFIPADTPLKLADYFKIGGVFRVGSIQDQPTGGNIYLDTSVM 180 Query: 381 GADFRAFVEIVFENPEDIIQSWHIDGYSFFVVGMDGGLWTANSRNQYNLR 430 GADFR F+EIVF+N E+I+QSWHIDGY+F+VVGM+GG+WT SRN+YNLR Sbjct: 181 GADFRGFIEIVFQNHENIVQSWHIDGYNFWVVGMNGGVWTPASRNEYNLR 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6236 (488 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24412 776 0.0 >Cs24412 Length = 388 Score = 776 bits (2004), Expect = 0.0, Method: Compositional matrix adjust. Identities = 377/388 (97%), Positives = 380/388 (97%) Query: 101 MLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARG 160 MLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARG Sbjct: 1 MLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARG 60 Query: 161 QKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKAGNLLEDEVEDNFAIVFAAMGVNMETAQ 220 QKIPLFSAAGLPHNEIAAQICRQAGLVKRLEK NLLED EDNFAIVFAAMGVNMETAQ Sbjct: 61 QKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVNMETAQ 120 Query: 221 FFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSS 280 FFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSS Sbjct: 121 FFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSS 180 Query: 281 YADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRIEGRKGSITQIPILTMPNDDIT 340 YADALREVSAAREEVPGRRGYPGYMYTDLA IYERAGRIEGRKGSITQIPILTMPNDDIT Sbjct: 181 YADALREVSAAREEVPGRRGYPGYMYTDLAQIYERAGRIEGRKGSITQIPILTMPNDDIT 240 Query: 341 HPTPDLTGYITEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHADVSNQL 400 HPTPDLTGYITEGQIYIDRQL NRQIYPPINVLPSLSRLMKSAIGEGMTRRDH+DVSNQL Sbjct: 241 HPTPDLTGYITEGQIYIDRQLQNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQL 300 Query: 401 YANYAIGKDVQAMKAVVGEEALSSEDLLYPEFLDKFERKFVAQGAYDTRNIFQSLDLAWT 460 YANYAIGKDVQAMKAVVGEEALSSEDLLY EFLDKFERKFVAQGAYD+RNIFQSLDLAWT Sbjct: 301 YANYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFERKFVAQGAYDSRNIFQSLDLAWT 360 Query: 461 LLRIFPRELLHRIPAKTLDQYYSRDAAN 488 LLRIFPRELLHRIP KTL+QYYSRDAAN Sbjct: 361 LLRIFPRELLHRIPGKTLEQYYSRDAAN 388 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13694 (385 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42420 199 4e-53 >Cs42420 Length = 250 Score = 199 bits (506), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 119/266 (44%), Positives = 155/266 (58%), Gaps = 26/266 (9%) Query: 88 PKCSASDPDQLKSAREDIKELLKSKFCHPLLVRLGWHDAGTYNKNIEEWPLRGGANGSLR 147 P S ++ + ++ + K C PL++R+ WH AGTY+ + GG G++R Sbjct: 6 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKT----GGPFGTMR 61 Query: 148 FEIELKHGANAGLVNAVKLLQPIKDKYSGVTYADLFQLASATAVEEAGGPKIPMKYGRVD 207 E H AN GL AV+LL+P K+++ ++YADL+QLA VE GGP IP GR D Sbjct: 62 LAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDD 121 Query: 208 ASGPEQCPEEGRLPDAGPPSPADHLRDVF-YRMGLNDKEIVALSGAHTLGRSRPERSGWG 266 + P P+EGRLPDA + DHLR VF +MGL+DK+IVALSG HTLGR ERSG+ Sbjct: 122 KAEP---PQEGRLPDAKQGN--DHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFE 176 Query: 267 KPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKEKIDEELLVLPTDAILFEDPSFKVY 326 P WT L FDNSYF ++ + LL LP+D L +DP F+ Sbjct: 177 GP----------------WTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPL 220 Query: 327 AEKYAVDQEAFFKDYAEAHAKLSNLG 352 EKYA D++AFF DYAEAH KLS LG Sbjct: 221 VEKYAADEDAFFADYAEAHLKLSELG 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27803 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26371 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65980 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13409 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59112 114 8e-28 >Cs59112 Length = 265 Score = 114 bits (285), Expect = 8e-28, Method: Compositional matrix adjust. Identities = 68/199 (34%), Positives = 106/199 (53%), Gaps = 8/199 (4%) Query: 14 TLPQSYIRPEPERPRLSQV-SECKHVPIIDLGKDVNRAQLIQHIADACRLYGFFQVINHG 72 T+P ++RPE E+P + +P IDL D + +L++ IA+A R +G FQV NHG Sbjct: 18 TIPAEFVRPEKEQPASATYHGPAPEIPTIDL-DDPVQDRLVRSIAEASREWGIFQVTNHG 76 Query: 73 VAAEMMEKMLEVADEFYRLPVEEKMKLYS--DDPTKTMRLSTSFNVNKEKVHNWRDYLRL 130 + ++++ K+ V EF+ LP EEK ++YS D T E +W D+L Sbjct: 77 IPSDLIGKLQAVGKEFFELPQEEK-EVYSRPADAKDVQGYGTKLQKEVEGKKSWVDHLFH 135 Query: 131 HCYPLDQYTPE-WPSNPPSFKEIVSSYCKEVRELGFRLQEMISESLGLEKDHIKNVFGEQ 189 +P WP+NPPS++ + Y K +RE+ +L +S LG+E +K G Sbjct: 136 RVWPPSSINYRFWPNNPPSYRAVNEEYAKYMREVVDKLFTYLSLGLGVEGGVLKEAAGGD 195 Query: 190 GQH--MAVNYYPPCPQPEL 206 + +NYYPPCP+P+L Sbjct: 196 DIEYMLKINYYPPCPRPDL 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48365 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51286 (314 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4658 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs19328 314 4e-88 >Cs19328 Length = 197 Score = 314 bits (805), Expect = 4e-88, Method: Compositional matrix adjust. Identities = 148/178 (83%), Positives = 162/178 (91%) Query: 1 MSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWD 60 MSAS+FIKCVTVGDGAVGKTCMLI YTSN FPTDY+PTVFDNFSANV VDGS VNLGLWD Sbjct: 1 MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD 60 Query: 61 TAGQEDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTKL 120 TAGQEDY+RLRPLSYRGAD+F+LAFSLIS+ASYENV KKW+PELR +AP VPI+LVGTKL Sbjct: 61 TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL 120 Query: 121 DLREDKGYLADHMGSNVITSAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVL 178 DLR+DK + DH G+ IT+AQGEELRK IG+ AYIECSSKTQQNVKAVFD AIKVVL Sbjct: 121 DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDAAIKVVL 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50350 (390 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54245 (270 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92457 435 e-124 >Cs92457 Length = 274 Score = 435 bits (1118), Expect = e-124, Method: Compositional matrix adjust. Identities = 206/270 (76%), Positives = 239/270 (88%) Query: 1 MSDVLVNDTFHIRDVWDDNLEDEIRLIRGLLDDYPYIAMDTEFPGVVLRSVGNFKNNNEY 60 MS + D+ IR+VW DNLE E LIR ++DDYPY+AMDTEFPG+ LR VG+FK++ EY Sbjct: 1 MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY 60 Query: 61 NFQTLKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIEL 120 ++QTLK+NVD+LKLIQLGLTFSDE+GN PTCGT++YCVWQFNFREF++NED+FA+DSIEL Sbjct: 61 HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIEL 120 Query: 121 LKQSGIDFKKNNEKGVDARRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTSQNLP 180 LKQSGI+F KNNE G+DA RF EL+MSSGIVL+DS+HWVTFHSGYDFGYLLKLLT QNLP Sbjct: 121 LKQSGINFTKNNEIGIDAMRFGELMMSSGIVLSDSMHWVTFHSGYDFGYLLKLLTCQNLP 180 Query: 181 ETQAGFFELIRIYFPILYDIKHLMKFCNSLHGGLNKLAELLGVERIGSCHQAGSDSLLTC 240 +TQ FF LIRIYFP +YDIKHLMKFCNSLHGGLNKLAELL VER+G CHQAGSDSLLT Sbjct: 181 DTQVEFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA 240 Query: 241 CTFMKLKKDFFNGSPEKYAGVLYGLGVESG 270 TF KLK++FF+ S EKYAGVLYGLGVE+G Sbjct: 241 STFRKLKENFFSSSLEKYAGVLYGLGVENG 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19053 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv480 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27208 (343 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6991 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55033 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18352 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16453 65 4e-13 >Cs16453 Length = 223 Score = 64.7 bits (156), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 38/101 (37%), Positives = 58/101 (57%), Gaps = 7/101 (6%) Query: 33 GSFTLKQIKAATKNFDFANKIG-GGFGPVYKGLLSDGTIVAVKQLSS-----ISRQGNRE 86 G ++I +AT +F+ + IG GG G VY+ + G I AVK+ S +S Q E Sbjct: 29 GKIVYEEIISATNDFNAEHCIGKGGHGSVYRAKVPSGEIFAVKKFHSPLPGEMSFQ-QEE 87 Query: 87 FLNEIAMISCLQHPNLVKLHGFCVEGDQLLLVYEYMENNSL 127 FLNEI ++ ++H N+VK + FC ++YEY+E+ SL Sbjct: 88 FLNEIQALTEIRHRNIVKFYCFCSHPKHSFIIYEYLESGSL 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22152 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24737 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48772 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22322 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14022 (487 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40064 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6587 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29202 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7970 187 4e-50 >Cs7970 Length = 119 Score = 187 bits (476), Expect = 4e-50, Method: Compositional matrix adjust. Identities = 87/114 (76%), Positives = 101/114 (88%) Query: 24 MKGDYYRYLAEFKTGNERKEAADQSLKAYQTASTTAESDLSPTHPIRLGLALNFSVFYYE 83 MKGDYYRYLAEFK G+ERK AA+ ++ +Y+ A A +DL+PTHPIRLGLALNFSVFYYE Sbjct: 1 MKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYE 60 Query: 84 IMNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPE 137 I+NS E+AC +AKQAF+EAI+ELDTL EESYKDSTLIMQLLRDNLTLWTSD+ E Sbjct: 61 ILNSSEKACTMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQE 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26595 (393 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47367 82 1e-17 >Cs47367 Length = 140 Score = 82.0 bits (201), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 44/113 (38%), Positives = 59/113 (52%), Gaps = 2/113 (1%) Query: 270 ITASCDILLMPSRFEPCGLNQLYAMRYGAVPVVHGTGGLRDTVENFNPYAXXXXXXXXXW 329 I A D +L+PSRFEPCGL QL+AMRYG VP+V TGGL DTVE Sbjct: 2 IIAGADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCE 61 Query: 330 TFSPLSKDTMLAALRVAIRTYREHKPSWERLMKRGMEKDYTWDKAALEYEQVF 382 P+ + +R A+ TY + +MK GM +D +W A ++E+ Sbjct: 62 AVDPVDVAAVSTTVRRALATYGTQ--ALAEMMKNGMAQDLSWKGPAKKWEETL 112 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11509 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37079 107 1e-25 >Cs37079 Length = 176 Score = 107 bits (266), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 45/77 (58%), Positives = 56/77 (72%) Query: 36 FPERPGQQECQYYLRTGDCKFGSSCRYHHPREWVVPKTNCVLSPLGLPLRPGVQPCTFYL 95 FPERPGQ EC Y+LRTGDCK+ S+C+YHHP+ + C LS GLPLRPG C++Y Sbjct: 60 FPERPGQPECSYFLRTGDCKYKSNCKYHHPKNRIPKSPPCTLSDKGLPLRPGQNVCSYYS 119 Query: 96 QNGYCKFGSTCKFDHPL 112 + G CKFG CK+DHP+ Sbjct: 120 RYGICKFGPACKYDHPI 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15466256 (322 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93799 115 8e-28 >Cs93799 Length = 160 Score = 115 bits (287), Expect = 8e-28, Method: Compositional matrix adjust. Identities = 59/154 (38%), Positives = 97/154 (62%), Gaps = 1/154 (0%) Query: 163 VSKTLAEDAAWKFAKEKGIDMVTINPAMVIGPLLQPTLNTSAAAILNLINGGQ-TFPNAS 221 +SKTLAE AAW+FA++ G D+V I+PA +GP QP +N S A + L+ G + T + Sbjct: 1 MSKTLAEKAAWEFAEKNGTDVVAIHPATSLGPFPQPYVNASGAVLQRLLQGSKDTQEHYW 60 Query: 222 FGWVNVKDVAEAHIQAFEVPSASGRYCLVERVVHYSELVKILKELFPDFQLPEKCADDKP 281 G V+VKDVA+A + FE +ASGRY + ++E + + +LFP++ + + +P Sbjct: 61 LGAVHVKDVAKAQVLLFETSAASGRYLCTNGIYQFAEFAEKVSKLFPEYPIHRFKGETQP 120 Query: 282 FVPTFQVSKEKAKSLGIEFIPLEVSLKETVESLK 315 + + + ++ SLG++F P+E +++E VESLK Sbjct: 121 GLVACENAAKRLISLGLDFTPVEETIREAVESLK 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6269 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9181 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40140 (391 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs105558 128 1e-31 >Cs105558 Length = 358 Score = 128 bits (321), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 93/268 (34%), Positives = 128/268 (47%), Gaps = 13/268 (4%) Query: 127 EHICGRPLGLRFNKRTGDLYIADSYLGLMKVGPEGGLATSLVTEADGVPLRFTNDLDIDD 186 +HI + L + GD+ I DS GL KV EG V + D +RF ND+ Sbjct: 89 KHIDSQSLLGLTTTKEGDVVICDSKKGLFKVTEEG----VKVLDPD---VRFANDVIDAS 141 Query: 187 AGNIYFTDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVLLRGLQFPNGVSLSKDG 246 G +YFT SS+KY +F + + G+LLKYDP + +TTVL G F NGV+LSKD Sbjct: 142 DGTLYFTVSSTKYTPADFYKDMAEGNPYGQLLKYDPKSNQTTVLQEGFYFANGVALSKDE 201 Query: 247 SFLVLCEGSPGRLVKYWLKGDKAGTSEVFA-ILPGYPDNVRTNEKGEFWVA-IHCRRTMY 304 F+V+CE R +YWLKGD+ GT + FA LPG PDN+ G FW+A I +T Sbjct: 202 DFVVVCESWKFRCRRYWLKGDRNGTLDTFAENLPGGPDNINLAPDGSFWIALIKMNQTGV 261 Query: 305 SYLCGLYPKLRMFLLKLPIPTRYQYLLHIGGRLHAVVVKYS-PEGKLVKILEDSEGKXXX 363 + K + P LL +G A VVK +GK+++ D Sbjct: 262 KAIQNCREKWELL---EAYPGLISLLLPMGSDAGARVVKVDGIDGKIIRDFNDPNATYLS 318 Query: 364 XXXXXXXXXGKLWMGSVLMPFVAVYQLE 391 L++ S+ F+ V L Sbjct: 319 FVTSAVEYNDNLFLASLQSNFIGVLPLH 346 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57391 (672 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66241 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7275 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10357 (117 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53517 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs22449 356 e-101 >Cs22449 Length = 278 Score = 356 bits (914), Expect = e-101, Method: Compositional matrix adjust. Identities = 164/175 (93%), Positives = 172/175 (98%) Query: 27 MLDHPFLPALYASFQTKTHICLITDYCPGGELFLLLDRQPTKVLKEDAVRFYAAEVVVAL 86 MLDHPF+PALYASFQTKTH+CLITDYCPGGELFLLLDRQPTKVLKEDAVRFYAAEVVVAL Sbjct: 1 MLDHPFVPALYASFQTKTHVCLITDYCPGGELFLLLDRQPTKVLKEDAVRFYAAEVVVAL 60 Query: 87 EYLHCQGVIYRDLKPENVLLQSSGHVALTDFDLSCLTSCKPQLLMPNTNEKKRQHKGQQN 146 EYLHCQG+IYRDLKPENVLLQ +GHV+LTDFDLSCLTSCKPQLL+P TNEKKR+HKGQQN Sbjct: 61 EYLHCQGIIYRDLKPENVLLQGNGHVSLTDFDLSCLTSCKPQLLLPTTNEKKRRHKGQQN 120 Query: 147 PIFMAEPMRASNSFVGTEEYIAPEIITGAGHTSAVDWWALGILLYEMLYGYTPFR 201 P+FMAEPMRASNSFVGTEEYIAPEII GAGHTSAVDWWALGILLYEMLYGYTPFR Sbjct: 121 PVFMAEPMRASNSFVGTEEYIAPEIIAGAGHTSAVDWWALGILLYEMLYGYTPFR 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32064 (270 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78980 363 e-102 >Cs78980 Length = 276 Score = 363 bits (931), Expect = e-102, Method: Compositional matrix adjust. Identities = 175/257 (68%), Positives = 206/257 (80%), Gaps = 3/257 (1%) Query: 9 SGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFG 68 S + RWSL GMTALVTGGT+GIGHA VEELA GA +HTCSR + EL+ L +WK KGF Sbjct: 8 SRNKRWSLNGMTALVTGGTRGIGHATVEELARFGAIVHTCSRNQIELDARLHEWKNKGFK 67 Query: 69 VSGSVCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINF 128 V+GSVCD+SSR QREKL+ETV+S+F GKLNIL+NNAAI KPTV++TAE+ ST+ + NF Sbjct: 68 VTGSVCDLSSREQREKLIETVTSIFQGKLNILINNAAIAFVKPTVDITAEDMSTVSSTNF 127 Query: 129 ESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAE 188 ESV+HLSQLAHPL KASG GSIVFISSV GV + +S Y A KGAMNQLTKNLACEWA+ Sbjct: 128 ESVFHLSQLAHPLFKASGNGSIVFISSVGGVRGIPSVSLYGAYKGAMNQLTKNLACEWAK 187 Query: 189 DNIRSNAVAPWYIKTPMV---DQMLSNKTFLEGVINRAPLRRVGDPKEVSSLVAFLCLPA 245 DNIR+N VAPW IKT M+ ++ FL+G+ + P+ R G+P EVSSLVAFLCLPA Sbjct: 188 DNIRTNTVAPWVIKTSMIKPFEEGPEGSEFLDGIARQTPIGRAGEPDEVSSLVAFLCLPA 247 Query: 246 SSYITGQTICVDGGVTV 262 +SYITGQ ICVDGGVTV Sbjct: 248 ASYITGQIICVDGGVTV 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32058 (270 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78980 310 1e-86 >Cs78980 Length = 276 Score = 310 bits (793), Expect = 1e-86, Method: Compositional matrix adjust. Identities = 152/266 (57%), Positives = 186/266 (69%), Gaps = 7/266 (2%) Query: 9 SGDSRWSLKGMTALITGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFG 68 S + RWSL GMTAL+TGGT+GIGHA VEELA GA +HTCSR + EL+ L +WK KGF Sbjct: 8 SRNKRWSLNGMTALVTGGTRGIGHATVEELARFGAIVHTCSRNQIELDARLHEWKNKGFK 67 Query: 69 VSGSVCDVSSRAQREKLMQTISSVFNGKXXXXXXXXXXSIQKPTVEVTAEEFSTIMATNF 128 V+GSVCD+SSR QREKL++T++S+F GK + KPTV++TAE+ ST+ +TNF Sbjct: 68 VTGSVCDLSSREQREKLIETVTSIFQGKLNILINNAAIAFVKPTVDITAEDMSTVSSTNF 127 Query: 129 ESVYHLSQIAHPLLKXXXXXXXXXXXXXXXXXXHKNISAYSVTKGAMNQLTKNLACEWAK 188 ESV+HLSQ+AHPL K ++S Y KGAMNQLTKNLACEWAK Sbjct: 128 ESVFHLSQLAHPLFKASGNGSIVFISSVGGVRGIPSVSLYGAYKGAMNQLTKNLACEWAK 187 Query: 189 DNIRSNAVAPWYIKTPMV---EQMLTNQAFLEEVINRAPLRRVGDPKEVSSLVAFLCLPA 245 DNIR+N VAPW IKT M+ E+ FL+ + + P+ R G+P EVSSLVAFLCLPA Sbjct: 188 DNIRTNTVAPWVIKTSMIKPFEEGPEGSEFLDGIARQTPIGRAGEPDEVSSLVAFLCLPA 247 Query: 246 SSYITGQIICVDGGMT----VNGFES 267 +SYITGQIICVDGG+T VNG S Sbjct: 248 ASYITGQIICVDGGVTVTVNVNGLRS 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3366 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14312 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20159 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4966261 (340 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5522 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14935 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12823 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10115 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34249 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54458 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64592 258 3e-71 >Cs64592 Length = 221 Score = 258 bits (659), Expect = 3e-71, Method: Compositional matrix adjust. Identities = 124/154 (80%), Positives = 138/154 (89%) Query: 10 IPGSSRGVFGVPSAKKSEIEALVKLLESQNPTPEPTLNLDKVNGWWKLVYSTITILGSKR 69 + G +RG+FGVPSAKKSEIEALV+LLESQNPTP PT NLDKV G WKLVYSTITILGSKR Sbjct: 36 VQGINRGIFGVPSAKKSEIEALVELLESQNPTPHPTANLDKVGGTWKLVYSTITILGSKR 95 Query: 70 TKLGLRNFITLGDFLQIIDVEEAKAVNVIKFNARGFNFLNGELKIEASFKIASKSRVDIK 129 TKLGLR+FITLGDF Q IDV + KAVNVIKFN RG N LNG+L IEASFKIASKSRVDI Sbjct: 96 TKLGLRDFITLGDFFQSIDVAKGKAVNVIKFNVRGLNLLNGQLTIEASFKIASKSRVDIA 155 Query: 130 YDSSTINPDKLMNVFKQNYDLLLGIFNPEGWLEI 163 YD+STI P++LMN+F++NYDLLLGIFNP+GWLEI Sbjct: 156 YDNSTITPEQLMNMFRKNYDLLLGIFNPDGWLEI 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51319 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47510 (344 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47659 (393 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66689 155 5e-40 >Cs66689 Length = 145 Score = 155 bits (393), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 76/153 (49%), Positives = 97/153 (63%), Gaps = 8/153 (5%) Query: 241 MKLFDDNIPQRSFDNFQFVNFSKIMSENMEASKKETAFALSALMEIPFQYRATLRLQSID 300 M+ FDD IP R FDNFQFVNF+ IMS+N S+KETAFAL+ALMEIP QY+A + L + Sbjct: 1 MQKFDDKIPAREFDNFQFVNFTAIMSKNATPSEKETAFALAALMEIPIQYKAAVELGIMG 60 Query: 301 NNLVGGPRTRPLPPPKEVLDHDREALQHMMATTLSVEAVEQTAPVDQVCPICLTNPKNMA 360 + P PPP + R AL + S E Q CPICLTN K++A Sbjct: 61 RTTGRAKKIAPRPPPA---PYSRRALPERQPSRGSTPVAE-----TQACPICLTNAKDLA 112 Query: 361 FGCGHLTCKECGESISLCPLCREPINTRLKLYS 393 FGCGH+TC+ECG +S CP+CR+ I RL+L++ Sbjct: 113 FGCGHMTCRECGSRVSNCPICRQRITNRLRLFA 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7008 (238 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38985 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39875 (372 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55560 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3618 (254 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35823 (268 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47597 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9179 (371 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81333 675 0.0 >Cs81333 Length = 370 Score = 675 bits (1742), Expect = 0.0, Method: Compositional matrix adjust. Identities = 329/370 (88%), Positives = 348/370 (94%), Gaps = 2/370 (0%) Query: 2 EITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDMT 61 EITNV EYEAIAK+KLPKMVFDYYASGAEDQWTL +NR+AFS+ILFRPRILIDVSKIDM Sbjct: 3 EITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMN 62 Query: 62 TTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWATSSVEEVASTGP 121 TTVLGFKISMPIMIAPTAMQKMAHPEGEY GTIMTLSSW+TSSVEEVASTGP Sbjct: 63 TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGP 122 Query: 122 GIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 181 GIRFFQLYVYKDR+VVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK Sbjct: 123 GIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 182 Query: 182 NFEGLDLGKMDKADDSGLASYVAGQIDRTLSWKDVKWLQTITNLPILVKGVLTAEDTRLA 241 NF+GLDLGKMD+A+DSGLA+YVAGQIDR+LSWKDVKWLQTIT LPILVKGVLTAED R+A Sbjct: 183 NFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKDVKWLQTITKLPILVKGVLTAEDARIA 242 Query: 242 IQAGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRVPVFLDGGVRRGTDVFKALALG 301 +QAGAAGIIVSNHGARQLDYVPATIMALEEVVKA QGR+PVFLDGGVRRGTDVFKALALG Sbjct: 243 VQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG 302 Query: 302 ASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITRDHIVTEWEVP 361 ASGIFIGRPVV+SLAAEGE GVR+VL+MLREEFEL MALSGCRSLKEITRDHIVTEW+ Sbjct: 303 ASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDAS 362 Query: 362 RPGSRPLPRL 371 P RP+PRL Sbjct: 363 LP--RPVPRL 370 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35060 (266 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16453 64 1e-12 >Cs16453 Length = 223 Score = 64.3 bits (155), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 32/92 (34%), Positives = 57/92 (61%), Gaps = 4/92 (4%) Query: 177 NATNYFSSDNKLGEGGFGPVYKGILQGGQEIAVKMLSKTSRQGL----KEFKNEVESITK 232 +ATN F++++ +G+GG G VY+ + G+ AVK + +EF NE++++T+ Sbjct: 38 SATNDFNAEHCIGKGGHGSVYRAKVPSGEIFAVKKFHSPLPGEMSFQQEEFLNEIQALTE 97 Query: 233 LQHRNLVKLLGCCIYGRERMLIYEYMPNKSLD 264 ++HRN+VK C + + +IYEY+ + SLD Sbjct: 98 IRHRNIVKFYCFCSHPKHSFIIYEYLESGSLD 129 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60475 (405 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12571 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26965 (379 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54335 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21129 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18866257 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54996 (130 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68010 105 3e-25 >Cs68010 Length = 146 Score = 105 bits (261), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 54/99 (54%), Positives = 66/99 (66%), Gaps = 4/99 (4%) Query: 35 MKASMGSFAAAL--KDKNVWVMNVVAEDGPNTLKIIYDRGLIGTIHNWCEAFSTYPRTYD 92 M A F +AL K K+VWVMNVV G N L +I DRG +G +H+WCEAF TYPRTYD Sbjct: 1 MNAHSCGFNSALLEKGKSVWVMNVVPTIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTYD 60 Query: 93 LLHAWTVFS--DIERNXCSAEDLLIEMDRILRPTGFVII 129 L+HA + S R+ CS D+ E+DRILRP G+VII Sbjct: 61 LVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVII 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36276 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58683 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92452 126 2e-31 >Cs92452 Length = 220 Score = 126 bits (317), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 62/120 (51%), Positives = 82/120 (68%), Gaps = 9/120 (7%) Query: 3 MSNAIGQFGDTTLTKVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFV 62 M+ A G D+ K+FVGGLAWET + +R +FE++G+ILEAV+I+ K TGRSKGY FV Sbjct: 1 MAGAYGAEADSANRKLFVGGLAWETNSDTLRTYFEQFGDILEAVVITHKNTGRSKGYRFV 60 Query: 63 TFKEPEAAKKACEDTTPMINGRRANCNLASLGARRPRSAASSTPPHQGSNGGSRPTSAAP 122 TF++P +A +AC + +PMI GR+ANCNLA LG RP + P RP+SAAP Sbjct: 61 TFRDPGSALRACANPSPMIGGRKANCNLAHLGRTRPDLPSFGHP---------RPSSAAP 111 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8236 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51732 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11568 229 1e-62 >Cs11568 Length = 204 Score = 229 bits (584), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 119/188 (63%), Positives = 142/188 (75%), Gaps = 18/188 (9%) Query: 11 QIEDLNQRLEQMMEEK-------PKAHNDMPSVQDPXXX------XXXXXXXSREEVDSR 57 +++D+ RL++M EE K N+M S QD +REEVDSR Sbjct: 17 ELDDMKIRLKEMEEEATALRQMHAKVGNEMASKQDVGFHLPIDPGAGGSSQANREEVDSR 76 Query: 58 SVFVGNVDYSCTPEEVQQHFQACGTVNRVTIRSNKYGQPKGYAYVEFLETEAVQEALLLN 117 SVFVGNVDYSCTPEEVQQHFQ+CGTVNRVTIR++K+GQPKGYAYVEFL++EAVQEAL LN Sbjct: 77 SVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFGQPKGYAYVEFLQSEAVQEALHLN 136 Query: 118 ESELHGRQLKVSAKRTNVPGLKQFRPRR----VGFRSRSTHMPPYL-CPYGYGKVPRFRM 172 ESELHGRQLKV+ KRTNVPG+KQ RPRR + ++SR +PP+L PYGYGK+PRFRM Sbjct: 137 ESELHGRQLKVTVKRTNVPGMKQHRPRRPNPFMVYQSRGAIIPPFLYSPYGYGKIPRFRM 196 Query: 173 PMRYNPYY 180 PMRY+PYY Sbjct: 197 PMRYSPYY 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36198 (403 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51178 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 105 4e-25 >Cs47542 Length = 355 Score = 105 bits (262), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 75/212 (35%), Positives = 109/212 (51%), Gaps = 27/212 (12%) Query: 46 IPVIDF-SLLTSGNPDQRSKAIQDLHRACEEWGFFMVINHGVEESLMKGMIEACRGFFDL 104 IPVID SLL+ + D + L AC+EWGFF ++NHGV + ++ + + +GFF+L Sbjct: 47 IPVIDMQSLLSEESMDSE---LAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNL 103 Query: 105 TEEEK-------GEFEGKPVLAPIRCGTSSNTSLDKILFWRDFLKVFLHP----QFHSLN 153 + EEK G+ EG G + S ++ L W D + P + H Sbjct: 104 SMEEKKKYWQHPGDVEG--------FGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFP 155 Query: 154 KPPGFSEVSLE-YSQRIKKVVEELLKGISKSLGLEEWYIDKAMNMSSGLQVLVANLYPPC 212 K P +LE YS +K + L+ + K L +++ + + +G Q + N YPPC Sbjct: 156 KLPPLLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFF--ENGFQSMRMNYYPPC 213 Query: 213 PQPEHAMGLPPHSDYGLLTVLTQ-NEVGGLKC 243 PQPE MGL PHSD LT+L Q NEV GL+ Sbjct: 214 PQPEKVMGLTPHSDGSALTILLQINEVEGLQI 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19027 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53084 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12964 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59106187 84 1e-18 >Cs59106187 Length = 303 Score = 84.3 bits (207), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 59/174 (33%), Positives = 87/174 (50%), Gaps = 12/174 (6%) Query: 12 NYSYLIID--ESSKEAAVVDPVEP--QKVLQAAYEYGXXXXXXXXXXXXWDHAGGNEKIK 67 Y+YL+ D K A ++DPV+ + L E G DH G IK Sbjct: 74 TYTYLLADVNHPDKPALLIDPVDKTVDRDLNVIKELGLKLVYAMNTHVHADHVTGTGLIK 133 Query: 68 QLVPGIEVYGGSVDNVKGCTHPLQNGDKLSLGSDLAVLALHTPCHTRGHISYYVTGKEED 127 VPG++ K H +++GDK+S G DL + TP HT G ++Y V+G+ D Sbjct: 134 SKVPGVKSIISKASGSKADLH-VEHGDKVSFG-DLFLEVRATPGHTLGCVTY-VSGEGPD 190 Query: 128 VP---AVFTGDTLFVAGCGK--FFEGTAEQMYQSLCVTLASLPKPTRVYCGHEY 176 P FTGD L + GCG+ F G++ Q+Y+S+ + +LPK T +Y H+Y Sbjct: 191 QPQPRMAFTGDALLIRGCGRTDFQGGSSSQLYKSVHSQIFTLPKDTLIYPAHDY 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44542 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs21820 107 4e-26 >Cs21820 Length = 128 Score = 107 bits (266), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 47/81 (58%), Positives = 62/81 (76%) Query: 11 SFHTVNGKAYLFNKVVNISVGVHEEKMMMTGMYTVADIFCVGCGSIVGWRYETAHEKAQK 70 SF+ G+AYLF+ VVNI +G EE++M++GM+TV DIFC CG IVGW+Y AH+K QK Sbjct: 34 SFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHDKNQK 93 Query: 71 YKEGKSVLQRYRALTEATTEV 91 YKEGK VL+R+R + E T E+ Sbjct: 94 YKEGKFVLERWRIVEEVTEEL 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48734 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39656 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17620 (373 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566261 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26424 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81139 147 4e-38 >Cs81139 Length = 104 Score = 147 bits (372), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 66/82 (80%), Positives = 74/82 (90%) Query: 74 RLLDAPSLENAHAKIVSCGARHSAIITADGKMFSWGWNKYGQLGLGDVVDRNIPSQVTLD 133 RLLDAPSLEN H+K VSCGARH+A+I DGK+F WGWNKYGQLGLGDV+DRNIPSQVT++ Sbjct: 23 RLLDAPSLENVHSKSVSCGARHTAVIADDGKVFCWGWNKYGQLGLGDVIDRNIPSQVTIE 82 Query: 134 GCTPKNVACGWWHTLLLAESPT 155 GC P+NVACGWWHTLLLA PT Sbjct: 83 GCVPRNVACGWWHTLLLAVPPT 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30033 (447 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11404 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18766263 (296 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42482 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39848 (420 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39428 (380 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14248 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46232 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10829 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42420 319 3e-89 >Cs42420 Length = 250 Score = 319 bits (817), Expect = 3e-89, Method: Compositional matrix adjust. Identities = 163/243 (67%), Positives = 187/243 (76%), Gaps = 1/243 (0%) Query: 4 PVVDTDYLKEIDKARRDLRALIASKNCAPIMLRLAWHDAGTYDVHTKTGGPNGSIRTEEE 63 P V DY K ++K +R LR IA KNCAP+MLR+AWH AGTYDV TKTGGP G++R E Sbjct: 6 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAE 65 Query: 64 YSHGSNNGLKIAIDFCEEVKSKYPKITYADLYQLAGVVAVEITGGPTIDFVPGRKDSMIS 123 +H +NNGL IA+ E K ++P I+YADLYQLAGVV VE+TGGP I F PGR D Sbjct: 66 QAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP 125 Query: 124 PKEGRLPDAKKGVSHLRDIF-YRMGLSGKDIVALSGGHTLGRAHPERSGFDGPWTKNPLK 182 P+EGRLPDAK+G HLR +F +MGLS KDIVALSGGHTLGR H ERSGF+GPWT+NPL Sbjct: 126 PQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLI 185 Query: 183 FDNSYFVELLQGESEGLLKLPTDKALLDDPEFRGYVELYAKDEDAFFRDYAVSHKKLSEL 242 FDNSYF ELL GE +GLL+LP+DKALLDDP FR VE YA DEDAFF DYA +H KLSEL Sbjct: 186 FDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHLKLSEL 245 Query: 243 GFT 245 GF Sbjct: 246 GFA 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22593 (385 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21063 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22196 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17040 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7708 355 e-100 >Cs7708 Length = 215 Score = 355 bits (910), Expect = e-100, Method: Compositional matrix adjust. Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 1/208 (0%) Query: 1 MGSAPESVIKETNENLLAEKKVKVVFVLGGPGSGKGTQCANIVKHFGYTHLSAGDLLRAE 60 MG+ E+ +KE + + KK VVFVLGGPGSGKGTQCANIV+HFGYTHLSAGDLLRAE Sbjct: 1 MGTVVETPVKEADATVTV-KKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAE 59 Query: 61 IKSGSENGNMIQSMIKEGKIVPSEVTIKLLQRAILEDSNDKFLIDGFPRNEENRAAFEAV 120 IKSGSENG MIQ+MIKEGKIVPSEVTIKLLQ+A+ E NDKFLIDGFPRNEENRAAFEAV Sbjct: 60 IKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAV 119 Query: 121 TKIEPEFVLFFDCSEEEMERRILNRNQGREDDNVETIRKRFKVFLESSLPVIEYYESKGK 180 TKIEPEFVLFFDCSEEEMERRILNRNQGREDDNVETIRKRFKVFLESSLPV++YYE+KGK Sbjct: 120 TKIEPEFVLFFDCSEEEMERRILNRNQGREDDNVETIRKRFKVFLESSLPVVQYYEAKGK 179 Query: 181 VRKIDAAQSIEEVFEAVKAVFTPTNEQV 208 VRKIDAA+ + EVF+AVKAVFTP +E+V Sbjct: 180 VRKIDAAKPVAEVFDAVKAVFTPKDEKV 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50131 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12861 210 6e-57 >Cs12861 Length = 334 Score = 210 bits (535), Expect = 6e-57, Method: Compositional matrix adjust. Identities = 102/149 (68%), Positives = 117/149 (78%) Query: 27 SNYDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL 86 SNYDE +MQQSLLF DSLKDLK+LR QLYSAAEYFE Y DDQKQIV+ETLKDYA+KAL Sbjct: 17 SNYDEVAMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL 76 Query: 87 VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT 146 VNTVDHLGSVTYKVN LD+K+ EV TE + SCIEQR+RTC+E+I+ G QQSL++ T Sbjct: 77 VNTVDHLGSVTYKVNDLLDEKVDEVSDTEHRVSCIEQRLRTCQEYIDHEGLSQQSLVINT 136 Query: 147 PKHHKRYTFPXGETTNTTGHTIPTYQTCS 175 PK+HKRY P GET + T Y CS Sbjct: 137 PKYHKRYILPVGETMHGAIRTKSKYIGCS 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57970 (277 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27951 327 1e-91 >Cs27951 Length = 235 Score = 327 bits (837), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 151/235 (64%), Positives = 195/235 (82%), Gaps = 1/235 (0%) Query: 44 FDKQLSMENVRKLITEADGYQPHLIAPEQGYRRLIESSIVSIRGPAEAAVDAVHAILKEM 103 FD+ LS +NVRK+++EADGYQPHLIAPEQGYRRLI+S++ RGPAEA+VDAVH +LKE+ Sbjct: 1 FDRHLSPQNVRKVVSEADGYQPHLIAPEQGYRRLIDSALNYFRGPAEASVDAVHFVLKEL 60 Query: 104 VNKAISETAEFKQYPALRIEVANAACDSLDRMRDESKKATLKLVDMECSYLTVDFFRKLP 163 V ++I ET E K++P L+ E+A AA +L+R RD+SKK T++LV+ME SYLTVDFFRKLP Sbjct: 61 VRRSIGETQELKRFPTLQSEIAAAANKALERFRDDSKKTTMRLVEMESSYLTVDFFRKLP 120 Query: 164 QDIEKGGNPTH-SIFDRYNDSYLRRIGTTVLSYVNMVCATLRNSIPKSIVYCQVREAKRS 222 QD+E+GGNPT S DRY + + RRIG+ V SYV MV TL+N+IPK++V+CQV+EAKRS Sbjct: 121 QDMERGGNPTAPSAADRYTEGHFRRIGSNVSSYVGMVSETLKNTIPKAVVHCQVKEAKRS 180 Query: 223 LLDHFFTELGKLEPKQLASLLNEDPAVMARRTALAKRLELYRSAQAEIDAVAWSK 277 LLDHF+ +LGK E KQLA LL+EDP +M RR AKRLELY+SA+ EID+V+W++ Sbjct: 181 LLDHFYAQLGKKEGKQLAQLLDEDPMLMERRQQCAKRLELYKSARDEIDSVSWTR 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30100 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45299 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33590 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10928 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31562 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31466256 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21966263 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43954 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs45674 442 e-126 >Cs45674 Length = 235 Score = 442 bits (1137), Expect = e-126, Method: Compositional matrix adjust. Identities = 216/235 (91%), Positives = 227/235 (96%) Query: 45 ATRSTIIVPFSGISWFLDLFNYYVNSDEQDVFSKELQLDTKVFYFDIGENRRGRFLKVSE 104 ATRSTIIVP SGISWFLDLFNYYVNSD+ ++FSKELQLD+KVFYFDIGENRRGRFLKVSE Sbjct: 1 ATRSTIIVPSSGISWFLDLFNYYVNSDDHELFSKELQLDSKVFYFDIGENRRGRFLKVSE 60 Query: 105 ASVSRNRSTIIVPAGSTRDEGWAAFRNILAEINEASRLFILPNQQSSEPSERLVGLSDDV 164 ASVSRNRSTIIVPAGS+RDEGWAAFRNILAEINEASRL ILPNQQ SE SE LVGLSDDV Sbjct: 61 ASVSRNRSTIIVPAGSSRDEGWAAFRNILAEINEASRLLILPNQQGSEQSEHLVGLSDDV 120 Query: 165 GAGFISGHSTQPAPASELNVERSVELPAQDEIGNLGVSKVIRADQKRFFFDLGSNNRGHF 224 GAGFISGH +QPAPASELNV+RSV+LPAQDEIGN+GVSKVIRADQKRFFFDLGSNNRGHF Sbjct: 121 GAGFISGHGSQPAPASELNVDRSVDLPAQDEIGNMGVSKVIRADQKRFFFDLGSNNRGHF 180 Query: 225 LRISEVAGSDRSSIILPLSGLKQFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 279 LRISEVAGSDRSSIILPLSGLKQFHE+VGHFVEITKDRIEGMTGA+VR VDPPQR Sbjct: 181 LRISEVAGSDRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGASVRIVDPPQR 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57583 (212 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15680 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63858 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2896 (171 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs50927 100 2e-23 >Cs50927 Length = 147 Score = 99.8 bits (247), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 41/87 (47%), Positives = 58/87 (66%) Query: 83 IIKTVQEAWDKVEDKYAVSSLAAAGFVGLWVSTGMVSAIDKLPLVPGVLEIVGIGYSGWF 142 + K+VQ WD ED+ + L AG V LW S +++AIDKLP++P LE++GI +S WF Sbjct: 60 VFKSVQNVWDSSEDRLGLIGLGFAGIVALWASVNLITAIDKLPIIPNALELIGILFSTWF 119 Query: 143 AYKNLIFKPDREALIQKIKDTYKEIIG 169 Y+ L+FKPDRE L Q I + +I+G Sbjct: 120 VYRYLLFKPDREELFQIINKSVSDILG 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58015 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41423 (360 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37180 (79 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23500 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54396 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49860 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs6371 299 1e-83 >Cs6371 Length = 189 Score = 299 bits (766), Expect = 1e-83, Method: Compositional matrix adjust. Identities = 144/189 (76%), Positives = 153/189 (80%), Gaps = 1/189 (0%) Query: 1 MKGQGSYVPPPYIPLGQSDSEVEIVPHDSDLPVHRHTSDSPSQWSSGICACCDDMQSCCI 60 M Q YVPPPYIPLGQSDS +EIVP DL RH SD P QWSSGICAC DDMQSCCI Sbjct: 1 MTSQSGYVPPPYIPLGQSDSGLEIVPQKEDLSDPRHPSDGPVQWSSGICACFDDMQSCCI 60 Query: 61 GFFCPCFLFAKNAEFLGSGTLAGSCMTHLIFWALVNTVCCLLSDGTLLGLPGCFVACYAC 120 G FCP +LF KNAEFLGSGT GSC+TH I WA VNTVCCLL+DG LLGLPGCFV+CYAC Sbjct: 61 GLFCPWYLFGKNAEFLGSGTFTGSCLTHFITWAFVNTVCCLLTDGILLGLPGCFVSCYAC 120 Query: 121 GYRRALRSKYNLQEAPCGDFTTHFFCHLCAICQEYREIRERSGPET-PDLRLSVVTAPPV 179 GYRR LR+KYNL EAPCGDF THFFCHLCAICQEYREIRERS PDL L+VVT PP Sbjct: 121 GYRRTLRTKYNLPEAPCGDFVTHFFCHLCAICQEYREIRERSSDANPPDLSLAVVTVPPT 180 Query: 180 QTMETASKE 188 QTME+ SK+ Sbjct: 181 QTMESGSKQ 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1614 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54714 (254 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18120 (293 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23966261 (59 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs56622 74 3e-16 >Cs56622 Length = 79 Score = 73.9 bits (180), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 36/55 (65%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Query: 5 MYPDL-SFSEGATTTETIIAGVAPVKTHFEGSEMGVGAENGWKCGSNCSCDPCTC 58 MYPDL SF TET++ GVAPVK H EGSEMG GAE G KCG NC C+PC C Sbjct: 25 MYPDLRSFESTTVATETLVLGVAPVKMHSEGSEMGFGAEGGCKCGPNCKCNPCNC 79 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34353 (484 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43938 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18849 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43714 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 147 4e-38 >Cs169106187 Length = 148 Score = 147 bits (372), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 68/146 (46%), Positives = 92/146 (63%), Gaps = 5/146 (3%) Query: 5 ARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYP 64 A KR++++ K LQ+DPP S P ++ W A I GP D+P+ GG F +T+ F DYP Sbjct: 2 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYP 61 Query: 65 NKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANS 124 KPP V F +++FHPNI ++GSICLDIL+ QWSP ++ +L SI SLL DPNP+ P Sbjct: 62 FKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVP 121 Query: 125 EAARMFSENKREYNRRVREIVEQSWT 150 E A M+ +K +Y R SWT Sbjct: 122 EIAHMYKSDKAKYESTAR-----SWT 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12397 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41955 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50138 (302 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21011 (61 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29667 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46377 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48157 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6784 (141 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20414 (345 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51189 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26501 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24573 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20166258 (76 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57937 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40998 (212 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9195 235 3e-64 >Cs9195 Length = 211 Score = 235 bits (599), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 112/198 (56%), Positives = 149/198 (75%), Gaps = 1/198 (0%) Query: 15 PLAAMAEAFEELSKLVKTCPSYHLRLITFCDACSLVSVLFGCLGIAFKFAELEYVSKIRD 74 PL ++E+F+EL+ V + + + L F ACS VS LFGCLGIAFKFAE++YV+K+ D Sbjct: 9 PLTKISESFKELAATVNS-QAADVELAAFSRACSYVSPLFGCLGIAFKFAEMDYVTKVDD 67 Query: 75 LLEASKTYDTLEDIIDRDIENNTVRSAGSHSRNLRRVRQGLDLIRALFEQFLLSDDFSLR 134 L EASK+ TL+ +IDRDIE N VR AGSH+RNL RV++GLD++R LFEQ L ++ SL+ Sbjct: 68 LAEASKSILTLQSVIDRDIEGNCVRKAGSHTRNLLRVKRGLDMVRVLFEQILAAEGNSLK 127 Query: 135 EAASAAYSQVCAPYHTWAVRTAVSAGMYALPVREQLLVRLNENGQSAEKQMRRYINASLP 194 + AS AY+QV AP+H WA+R AV+AGMYALP R QLL +LNE+ SA QM+ YI S P Sbjct: 128 DPASKAYTQVFAPHHGWAIRKAVAAGMYALPTRAQLLRKLNEDETSARIQMQDYITTSAP 187 Query: 195 VIAYIDELYMARNISLDW 212 VI YID+L+++R + +DW Sbjct: 188 VILYIDKLFLSRELGIDW 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60751 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65703 (340 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28146 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60283 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26432 (342 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16230 275 6e-76 >Cs16230 Length = 157 Score = 275 bits (702), Expect = 6e-76, Method: Compositional matrix adjust. Identities = 130/157 (82%), Positives = 144/157 (91%) Query: 186 MLTPNQFEAELLTGFRIVAEKDGREACNILHASGPSKVVITSINMEGNLLLIGSHQKEKG 245 MLTPNQFEAE LTGFRI +E DGREAC ILHA+GP+KVVITSIN++GNL LIGSHQKEKG Sbjct: 1 MLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGNLFLIGSHQKEKG 60 Query: 246 HSPDQFKIVMPKIPAYFTGTGDLMTALLLGWSNKYPDNLNKAAELAVSSLQALLQRTLAD 305 SP+QFKIV+PKIPAYFTGTGDLMTALLLGWSNKY DNL+ AAELAVSSLQALLQRT+ D Sbjct: 61 QSPEQFKIVIPKIPAYFTGTGDLMTALLLGWSNKYRDNLDIAAELAVSSLQALLQRTVND 120 Query: 306 YVKAGFAPQSSSLEIRLVQSQDDIRHPEVKYKAERYT 342 YV AGF PQSSSLEIRL+QSQDDIR+P+VK+K E+Y Sbjct: 121 YVTAGFNPQSSSLEIRLIQSQDDIRNPQVKFKFEKYN 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48963 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48482 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53385 (399 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41364 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57845 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42836 (344 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37731 (359 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101477 229 3e-62 >Cs101477 Length = 242 Score = 229 bits (584), Expect = 3e-62, Method: Compositional matrix adjust. Identities = 111/163 (68%), Positives = 126/163 (77%), Gaps = 6/163 (3%) Query: 200 SAPATKAQVVGWPPIRSFRKNTLATTSKNTEVDGKAGP----GALFVKVSMDGAPYLRKV 255 S P K+QVVGWPP+RSFRKN +A N E D KA FVKVSMDGAPYLRKV Sbjct: 81 SKPPAKSQVVGWPPVRSFRKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKV 140 Query: 256 DLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGSEYVLTYEDKD 315 DL+ Y +YQELS AL KMFS FTIG GS G ++ ++ESKL DLL+GS+YV TYEDKD Sbjct: 141 DLKLYKSYQELSDALGKMFSSFTIGNCGSQGM--KDFMNESKLIDLLNGSDYVPTYEDKD 198 Query: 316 GDWMLVGDVPWQMFIETCKRLRIMKSCDAIGLAPRAVEKCKNR 358 GDWMLVGDVPW MF+++CKRLRIMK +AIGLAPRAVEKCKNR Sbjct: 199 GDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23925 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32066 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11077 (113 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666260 (593 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4806 (349 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69121 177 1e-46 >Cs69121 Length = 366 Score = 177 bits (450), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 114/342 (33%), Positives = 162/342 (47%), Gaps = 16/342 (4%) Query: 8 WFFFVQLLILV--------AESRAKVPAVIVFGDSSVDAGNNNRISTVLKSNFEPYGRDF 59 W+ + LL+L+ A++ +VP +FGDS VD GNNN++S++ ++N+ PYG DF Sbjct: 6 WWVVMVLLVLINIQNYYYGAKAAPQVPCYFIFGDSLVDNGNNNQLSSLARANYLPYGIDF 65 Query: 60 TGGRPTGRFSNGRIPPDFISEAFGLKPTVPAYLDPNYNISDFATGVCFASAGTGYDNQTS 119 G PTGRFSNG+ D I++ G +P Y D GV +ASA G +T Sbjct: 66 PNG-PTGRFSNGKTTVDVIAQLLGFDGYIPPYSAA--RGQDILRGVNYASAAAGIREETG 122 Query: 120 DVL-SVIPXXXXXXXXXXXXXXXRAYLG-QEKANEILSESLYLMSLGTNDFLENYY--IF 175 L I LG Q++A LS +Y + LG+ND+L NY+ ++ Sbjct: 123 RQLGDRISFSGQVKNYQNTVQQVVNLLGNQDQAANYLSRCIYSIGLGSNDYLNNYFQPLY 182 Query: 176 SGRSSQYTVPQYEDFLVGIAGNFIKEIYSLGARKVSXXXXXXXXXXXXERTTNFFGGSEC 235 QYT QY D L+ ++ +Y+ GARK + N G C Sbjct: 183 YSTGRQYTPEQYADLLIQQYTQQLQALYNYGARKFVLIGVGQIGCSPNQLAQNSPDGRTC 242 Query: 236 IERYNNVAMEFNGKLNTLVGKLNKKLPGIKVVLSNPYFILQQIIRKPSSYGYENAAVACC 295 ++R N+ + FN KL LV + N K + N Y I Q I P+ YG+ CC Sbjct: 243 VKRVNDANVIFNNKLRGLVDQFNNNDSDAKFIYINAYGIFQDITANPARYGFRVTNTGCC 302 Query: 296 ATGMFEMGYLCNRYNMLTCPDASKYVFWDSFHPTEKTNGIIS 337 G C CP+ +YVFWD+FHPTE N II+ Sbjct: 303 GVGRNNGQITCLPLQN-PCPNRREYVFWDAFHPTEAANTIIA 343 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5700 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55404 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12773 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17373 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32253 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30789 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30012 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60922 (249 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14526 (60 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24828 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64741 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 147 7e-38 >Cs99541 Length = 211 Score = 147 bits (371), Expect = 7e-38, Method: Compositional matrix adjust. Identities = 67/162 (41%), Positives = 101/162 (62%) Query: 12 KLVLLGDMGTGKTSLVLRFVKGQFYDFQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 K +++GD G GK+ L+L+F +F + TIG F ++++++ IK IWDTAGQE Sbjct: 8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQES 67 Query: 72 YHSLAPMYYRGXXXXXXXYDITSMDSFERAKKWVQELQRQGNPNLLMILVANKADLETKR 131 + S+ YYRG YDIT ++F W+++ ++ N N+ ++L+ NK DL +R Sbjct: 68 FRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRR 127 Query: 132 EVENEKGEQYAKENGLLFFETSAKTAQNVNELFYEIAKKLAK 173 V E+GEQ+AKE+GL+F E SAKTAQNV E F + A + K Sbjct: 128 AVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYK 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18966262 (322 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68010 184 2e-48 >Cs68010 Length = 146 Score = 184 bits (466), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 83/143 (58%), Positives = 108/143 (75%), Gaps = 2/143 (1%) Query: 182 MNARYGGLNAAFLEAKRSVWVMNVVPTRTQNTLPLILYQGFAGVLHDWCEPFPTYPRTYD 241 MNA G N+A LE +SVWVMNVVPT N LP+IL +GF GVLHDWCE FPTYPRTYD Sbjct: 1 MNAHSCGFNSALLEKGKSVWVMNVVPTIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTYD 60 Query: 242 MLHANGLLSHLTS--EGCNIMNLLLEMDRILRPEGWVVLSDNMVAIEKARALATQIRWEA 299 ++HA GLLS + C+ +++ E+DRILRPEGWV++ D IE ARAL T+++W+A Sbjct: 61 LVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIESARALTTRLKWDA 120 Query: 300 RVIDLQKGTDQRLLVCQKPFLKK 322 RVI+++ +D+RLL+CQKPF K+ Sbjct: 121 RVIEIESNSDERLLICQKPFFKR 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5081 (348 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80410 401 e-114 >Cs80410 Length = 246 Score = 401 bits (1031), Expect = e-114, Method: Compositional matrix adjust. Identities = 185/234 (79%), Positives = 210/234 (89%) Query: 114 DEHMGWAFPASETEEPGAEPDPLYGARSIRQLYELASANYTGKYSVPVLWDKKLKTIVNN 173 DEH GW FPA+ TEEPGAEPDPL GA++IR LYELAS NY+GK++VPVLWDKKLKTIVNN Sbjct: 5 DEHRGWVFPATNTEEPGAEPDPLNGAKTIRDLYELASTNYSGKFTVPVLWDKKLKTIVNN 64 Query: 174 ESSEIIRMLNSEFNDMAENAALDLYPPHLQPQIDEINEWIYNRINNGVYKCGFAKKQGPY 233 ES+EIIRM N+EFND+AENA+LDL+P + QID NEWIYN INNGVY+CGFA KQGPY Sbjct: 65 ESAEIIRMFNTEFNDIAENASLDLHPSDQRDQIDGTNEWIYNGINNGVYRCGFATKQGPY 124 Query: 234 NEAVGKLYEALDRCEEILSKQRYICGNLLSEADIRLFVTLIRFDEVYAVHFKCNKKLIRE 293 +EAV ++YEALD+CEEIL KQRYICGN L+EADIRLFVTLIRFDEVYAVHFKCNKKL+RE Sbjct: 125 DEAVKQVYEALDKCEEILGKQRYICGNRLTEADIRLFVTLIRFDEVYAVHFKCNKKLLRE 184 Query: 294 YPNLLNYSKDIFQIPGMSSTVNMDHIKRNYYGSHPSIDPLGIIPIGSHLDYSSP 347 YPNL NY+KDI+QIP MSSTVNM HIKR+YYGSHPSI+P GIIP+G +DYSSP Sbjct: 185 YPNLFNYTKDIYQIPSMSSTVNMQHIKRHYYGSHPSINPYGIIPLGPDIDYSSP 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16066256 (111 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35775 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27537 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9798 (45 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55270 (224 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6184 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs83508 70 2e-14 >Cs83508 Length = 269 Score = 70.1 bits (170), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 54/167 (32%), Positives = 84/167 (50%), Gaps = 11/167 (6%) Query: 83 GSSGTVIHPSIAVQIVQIIIGMLVMDTWQYFVHRYMHQNKFLYRHVHSQHHKLVVPYAIG 142 G ++ PS V + QII ++ D Y+ HR +H K+LY+HVHS HH+ P+ + Sbjct: 95 GMQSSLPLPSWKVVLSQIIFYFILEDFVFYWGHRILH-TKWLYKHVHSVHHEYATPFGLT 153 Query: 143 ALYNHPLEGLLL---DTVGGAISFLVSGMTARTAVIFFCFAVIKTVDDHCGLWLPGNIFH 199 + Y HP E L L VG AI +G T ++ V++TV+ HCG P ++ + Sbjct: 154 SEYAHPAEILFLGFATIVGPAI----TGPHLMTLWLWMVLRVLETVEAHCGYHFPWSLSN 209 Query: 200 LL-FQNNTAYHDIHHQRQGLKY-NYSQPFFPIWDKLLGTHMPYKLVR 244 + +HD HH+ K NYS F + D + GT Y+ ++ Sbjct: 210 FIPLYGGADFHDYHHRLLYTKSGNYSSTFVYM-DWIFGTDKGYRKLK 255 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6191 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4036 (296 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs70246 409 e-116 >Cs70246 Length = 301 Score = 409 bits (1051), Expect = e-116, Method: Compositional matrix adjust. Identities = 213/305 (69%), Positives = 235/305 (77%), Gaps = 13/305 (4%) Query: 1 MASPLLLFRNTTLSTLHNHYRHHRPPLPAVL----FSIKRRR--SHSLYSTQM---EGSX 51 MA+PL+L TL TL+++ +PPL + FS+ + SHS+ ST+M E + Sbjct: 1 MATPLILRNCPTLCTLNSN----QPPLRTLTLTKHFSVSTTKTWSHSINSTKMGKSEITE 56 Query: 52 XXXXXXXXXXXXXFVAGATGNTGKRIVEQLLAKGFAVKAGVRDLDKAKTTFPGGNPSLQI 111 FVAGATG++GKRIVEQLLAKGFAVKAGVRDLDKAKTT NPSLQI Sbjct: 57 EAEENVSVKQKKIFVAGATGSSGKRIVEQLLAKGFAVKAGVRDLDKAKTTLSKDNPSLQI 116 Query: 112 VKADVTEGSVKLAEAIGDDSDAVICATGFQRSWDLLAPWKVDNFGTVNLVEACRKLGVNR 171 VKADVTEGS KL+EAIGDDS+AV+CATGF+ WDL APWKVDNFGTVNLVEACRK GVNR Sbjct: 117 VKADVTEGSAKLSEAIGDDSEAVVCATGFRPGWDLFAPWKVDNFGTVNLVEACRKRGVNR 176 Query: 172 FILISSILVNGAAMGQILNPAYIFLNAFGLILIAKLQAEQYIRKSGINYTIIRPGGLRND 231 FILISSILVNGAAMGQILNPAYIFLN FGL LIAKLQAEQYIRKSGINYTIIRPGGLRN+ Sbjct: 177 FILISSILVNGAAMGQILNPAYIFLNVFGLTLIAKLQAEQYIRKSGINYTIIRPGGLRNE 236 Query: 232 PPTGNIVMEPEDTLSEGTISRDHXXXXXXXXXXXXXXSYKVVEIVSRTDAPKRSFKDLFA 291 PPTGNIVME EDTL EGTISRD SYKVVEI+SR DAPKRS++DLF Sbjct: 237 PPTGNIVMETEDTLYEGTISRDQVAEVAVEALLHPESSYKVVEIISRVDAPKRSYEDLFG 296 Query: 292 SIKQR 296 SIKQR Sbjct: 297 SIKQR 301 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15674 (389 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4554 (304 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62914 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs191106188 74 7e-16 >Cs191106188 Length = 122 Score = 73.6 bits (179), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 40/83 (48%), Positives = 46/83 (55%), Gaps = 3/83 (3%) Query: 3 LLEKLWDDVVAGPQPDRGLGKLRKLTTKPLSVKTD---EGESSKYQRSMXXXXXXXXXXX 59 +LEKLWDDVVAGPQPDRGLG+LRK+TT PL+VK E S K+QRS+ Sbjct: 1 MLEKLWDDVVAGPQPDRGLGRLRKITTTPLAVKEGGEAESSSGKFQRSLSMPASPGAPST 60 Query: 60 XXXXXXXXXXRKDNCLRLALQWG 82 RKDN R G Sbjct: 61 PVTPTTPLSARKDNVWRSVFHPG 83 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9128 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7822 (386 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66175 70 3e-14 >Cs66175 Length = 260 Score = 70.5 bits (171), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 69/242 (28%), Positives = 100/242 (41%), Gaps = 60/242 (24%) Query: 56 IRWGLCRLQGPREEMEDEAVVRSDGLDGFSFAAVFDGHAGFSSVKF---------LRDEL 106 +R+GL +QG R MED D SF V+DGH G + KF L+ E Sbjct: 22 VRYGLSSMQGWRATMEDAHAAYPDLDSSTSFFGVYDGHGGKAVAKFCAKYLHQQVLKHEA 81 Query: 107 YK--DCVAALQGGLL----------------LSGKNFNIIREALE------KAFESADA- 141 Y D V + Q L + G + +E K E+ D Sbjct: 82 YSAGDLVTSAQKAFLRMDEMMRGQRGWRELAILGDKMDKFSGMIEGFIWSPKGGEANDHF 141 Query: 142 -------------------KLLNWLETTGEDVESGSTATVLLIGDDMVFISHVGDSCVVL 182 +LL + SGSTA V +I D + +++ GDS VL Sbjct: 142 DDWTSEEYKQHGFLRYLINRLLIGPHSDFHGPTSGSTACVAIIRDKQLVVANAGDSRCVL 201 Query: 183 SRSGKAEELTNPHRPYGSNKSSLE-EIRRIREAGGWIVNGRICGDIAVSRSFGDMRFKTK 241 SR G+A L+ H+P LE E RI +AGG+I GR+ G + ++R+ GD+ + K Sbjct: 202 SRKGQALNLSKDHKP------DLEVEKDRILKAGGFIQVGRVNGSLNLARAIGDVEXQAK 255 Query: 242 KN 243 + Sbjct: 256 QK 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49213 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42152 (539 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs2665 139 6e-35 >Cs2665 Length = 178 Score = 139 bits (351), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 68/114 (59%), Positives = 77/114 (67%), Gaps = 1/114 (0%) Query: 11 LWSSATATSNAGLAIXXXXXXXXXXXXXXXXXXSSGRLKSPWSRKKKKHALSPRQWRNML 70 W A T+N GLAI G LKSPWSR+++KHAL P+QW+ Sbjct: 49 FWYPAVLTTNVGLAIAVTAMAGLALAATVLYS-HRGSLKSPWSRRRRKHALLPKQWKTFF 107 Query: 71 TPDGKLRDGGVKLVKKVRSGGVDPSIRAEVWPFLLGVYDLNSSKEERDIVKTQN 124 TPDGKL +GGVK +KKVRSGGVDPSIRAEVWPFLLGVYDL SSKEERD VK + Sbjct: 108 TPDGKLSEGGVKFLKKVRSGGVDPSIRAEVWPFLLGVYDLKSSKEERDSVKAEK 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56147 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20403 (179 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs6581 75 4e-16 >Cs6581 Length = 177 Score = 75.1 bits (183), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 36/78 (46%), Positives = 48/78 (61%), Gaps = 5/78 (6%) Query: 3 PMEKTKGKKRKSALVRSSIGAYAVQCEACLKWRLIDTEEEYEEIRSRFIEEPFVCSK--- 59 P + G +S ++ S+GA+ VQC C KWRLI T+E+YEEIR +E PF C K Sbjct: 95 PFGRYSGPNTQSRVL-PSVGAFTVQCADCFKWRLIPTKEKYEEIREHVLENPFTCEKARE 153 Query: 60 -KADVSCEDPTDIEYDAT 76 + DVSC+DP DI D + Sbjct: 154 WRPDVSCDDPPDISQDGS 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59502 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7766263 (346 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34312 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21350 (47 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31041 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41919 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38140 (432 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48497 (375 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37204 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78797 170 8e-45 >Cs78797 Length = 177 Score = 170 bits (431), Expect = 8e-45, Method: Compositional matrix adjust. Identities = 91/177 (51%), Positives = 109/177 (61%), Gaps = 9/177 (5%) Query: 9 SWICHIVACMGGCLGCCSKPTEIIGVYESPKGLTIQGRTAMRPSPVEDFWSTSTGEMDXX 68 +WI H +ACMGGC GCC+K T II V E KGL IQGR +PS +DFWSTST +++ Sbjct: 6 TWIDHFLACMGGCFGCCTKSTPIIAVDEPTKGLRIQGRAVKKPSISDDFWSTSTCDLENS 65 Query: 69 XXXXXXXXXXXXXXXXXFDPHSNAGSTSNPPEFVNHGLLLWNQTRQQWIGNQKSQNRKQV 128 + + TS+ +FVNHGL+LWNQ R QWIG+ KS+NR Q Sbjct: 66 AVQSQRSISSISTSNQTLN---HCSGTSSNSDFVNHGLILWNQVRMQWIGSSKSENRTQ- 121 Query: 129 QEPRIRSETSIDH----GWNATYESLLGTNKPLPQPIPLPEMVDFLVDVWEQEGLYD 181 Q +S T +D W ATYESLLGT P P+PIPL EMVD LVDVWE EGLYD Sbjct: 122 QSWESKSST-LDFLALSSWPATYESLLGTKNPFPRPIPLSEMVDLLVDVWEHEGLYD 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49382 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66220 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25481 290 1e-80 >Cs25481 Length = 188 Score = 290 bits (741), Expect = 1e-80, Method: Compositional matrix adjust. Identities = 145/189 (76%), Positives = 158/189 (83%), Gaps = 8/189 (4%) Query: 11 MWAFKKQFAIQLALSSFMSFMLQIGGRSPNKILFAKNTGKIFQTDFHPAYDANGMIEFSE 70 MWAFKKQFAIQLALSSFMSFMLQIGGRSPNKILFAKNTGKIFQTDFHPAYDANGMIEF+E Sbjct: 1 MWAFKKQFAIQLALSSFMSFMLQIGGRSPNKILFAKNTGKIFQTDFHPAYDANGMIEFNE 60 Query: 71 PVPFRLTRNLQAFFSHFGVEGLIVSAMCAAAQAVISPKQSQHLWHQLAMFFRDELLSWSW 130 PVPFRLTRN+Q+FFSHFGVEGLIVSAMCAAAQAV++PKQS+HLW+ L MFFRDELLSWSW Sbjct: 61 PVPFRLTRNMQSFFSHFGVEGLIVSAMCAAAQAVVAPKQSEHLWYHLGMFFRDELLSWSW 120 Query: 131 RRXXXXXXXXXXXXXXXXXIDFKHKITANVEQVIGRISGIAPQYLSEEEENA------VD 184 RR IDFK K++ NVE VIGRI+GIAPQ+ SEEEENA V+ Sbjct: 121 RR-PLGMPLGAAGGSGLNPIDFKDKVSTNVENVIGRINGIAPQF-SEEEENAQKESVLVE 178 Query: 185 PPHSVQRGV 193 PP SVQ+G Sbjct: 179 PPQSVQKGC 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15366264 (387 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58612 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14945 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96106185 274 3e-76 >Cs96106185 Length = 136 Score = 274 bits (700), Expect = 3e-76, Method: Compositional matrix adjust. Identities = 136/136 (100%), Positives = 136/136 (100%) Query: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60 Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 121 MPKDIQLARRIRGERA 136 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47095 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5807 (404 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35377 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs77124 125 1e-31 >Cs77124 Length = 182 Score = 125 bits (314), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 55/67 (82%), Positives = 65/67 (97%) Query: 2 SAKEVQELVKEERTVPLIIDFYATWCGPCILMAQELEMLAVEYESNALIVKVDTDDEYEF 61 +A+E+QELV+ ER VP+IIDFYATWCGPCILMAQE+E+LAVEYES+A+IVKVDTDDEYEF Sbjct: 80 TAQEIQELVRGERNVPIIIDFYATWCGPCILMAQEIELLAVEYESSAMIVKVDTDDEYEF 139 Query: 62 ARDMQVK 68 ARDMQV+ Sbjct: 140 ARDMQVR 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53282 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5650 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39117 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28689 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs87569 67 2e-13 >Cs87569 Length = 180 Score = 66.6 bits (161), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 42/137 (30%), Positives = 74/137 (54%), Gaps = 21/137 (15%) Query: 7 AAFTCIFALGGAVVGTITGAIKGQTTETGFFRGSGIGAVTGAITALQLLESV----AAGE 62 A FT FAL G ++G +TGA+ GQ TE+GF RG+ +GA++GA+ ++++ ES + E Sbjct: 43 AIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDE 102 Query: 63 S-----LSKAALLCSLVNGKVFMEWI------------STLETNYGETEDFYNISGAKGL 105 S L ++ SL++G++ E I +E ++ E + ++ +KGL Sbjct: 103 SGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGL 162 Query: 106 PHNFIEKLPKSNFCPSN 122 ++K+PK+ N Sbjct: 163 TGESVDKIPKNTITDKN 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10964 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs91241 219 2e-59 >Cs91241 Length = 177 Score = 219 bits (557), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 100/120 (83%), Positives = 113/120 (94%) Query: 47 TTWYKEKRWDSRRMLGSGGMPSSHSATVTALAVAIGFQEGTGGSAFAIAVVLACVVMYDA 106 TTWYKEKRWDS++ML SGGMPSSHSATV+ALAVAIG QEG+G +FAIAVVLAC+VMYDA Sbjct: 56 TTWYKEKRWDSKKMLDSGGMPSSHSATVSALAVAIGLQEGSGSPSFAIAVVLACIVMYDA 115 Query: 107 SGVRLHAGRQAELLNQIVCELPPDHPVSNVRPLRDSLGHTPLQVVAGSVLGCVVAYLMKS 166 SGVRLHAGRQAELLNQIVCE PPDHP+S+VRPLR+ LGHTPLQVVAG +LGCVVA+LM++ Sbjct: 116 SGVRLHAGRQAELLNQIVCEFPPDHPLSSVRPLRELLGHTPLQVVAGGILGCVVAFLMRN 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40628 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9466 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48920 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2998 (387 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47102 (411 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27289 382 e-108 >Cs27289 Length = 413 Score = 382 bits (981), Expect = e-108, Method: Compositional matrix adjust. Identities = 187/306 (61%), Positives = 228/306 (74%), Gaps = 12/306 (3%) Query: 72 GSTDEIKTLWVGDLHQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRAT 131 G EI+TLW+GDL WMD+ YL TCF HTGEV ++K+IRNKQTGQ EGYGF+EF SRA Sbjct: 76 GQPGEIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAG 135 Query: 132 AEKILHSYNGTLMPNTEQPFRLNWATFSTGDRRTDAGSDLSIFVGDLASDVTDALLQETF 191 AE++L ++NGT MPN EQ FRLNWA+F G++R D D +IFVGDLA+DVTD +LQETF Sbjct: 136 AERVLQTFNGTPMPNGEQNFRLNWASFGAGEKRDDT-PDHTIFVGDLAADVTDYMLQETF 194 Query: 192 ATRYPSVKGAKVVTDSNTGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRIGVATPK 251 RYPS KGAKVV D TGR+KGYGFVRFGDE+E+ RAM EMNG++CS+RPMRIG AT K Sbjct: 195 RARYPSTKGAKVVIDRLTGRTKGYGFVRFGDESEQLRAMTEMNGVFCSTRPMRIGPATNK 254 Query: 252 KASGXXXXXXXXALVLAGGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFS 311 K + N VA Q++ D NTT+FVG LDS VTDE LR+ FS Sbjct: 255 KTVSGQQQYPKASY-------QNSQVA---QSDDDPNNTTVFVGNLDSIVTDEHLRELFS 304 Query: 312 QFGEVVSVKIPVGKGCGFVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRND 371 Q+G++V VKIP GK CGFVQFA+R+ AE+AL+ LNGT +G Q +RLSWGR+P++KQ + D Sbjct: 305 QYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPSNKQAQPD 364 Query: 372 SNNQWN 377 NQWN Sbjct: 365 P-NQWN 369 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35303 (394 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66175 70 3e-14 >Cs66175 Length = 260 Score = 70.5 bits (171), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 31/63 (49%), Positives = 47/63 (74%) Query: 205 RTLMVANAGDCRAVLCRKGQAVDMSQDHRPSYPLERKRVEELGGFVDGEYLNGVLSVTRA 264 + L+VANAGD R VL RKGQA+++S+DH+P +E+ R+ + GGF+ +NG L++ RA Sbjct: 187 KQLVVANAGDSRCVLSRKGQALNLSKDHKPDLEVEKDRILKAGGFIQVGRVNGSLNLARA 246 Query: 265 LGD 267 +GD Sbjct: 247 IGD 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47006 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15777 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57603 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs72108 363 e-103 >Cs72108 Length = 189 Score = 363 bits (931), Expect = e-103, Method: Compositional matrix adjust. Identities = 175/189 (92%), Positives = 182/189 (96%) Query: 1 MSFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKP 60 MSFIGTQQKCK C KTVYPVEQLSADG+VYHKSCFKCSHC GTLKLSNYSSMEGVLYCKP Sbjct: 1 MSFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK 120 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCA+C KT YPLEK Sbjct: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCASCSKTVYPLEK 120 Query: 121 VTVESQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASMK 180 V VE+QAYHK+CFKCSHGGC ISPSNYAALEGILYCKHHF+QLFKEKGSYNHLIKSASMK Sbjct: 121 VAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMK 180 Query: 181 RSAASVPDA 189 R+AASVP+A Sbjct: 181 RAAASVPEA 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45791 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs3081 259 8e-72 >Cs3081 Length = 161 Score = 259 bits (663), Expect = 8e-72, Method: Compositional matrix adjust. Identities = 125/161 (77%), Positives = 139/161 (86%) Query: 1 MATEEKSVMVVGVDDSEHSFYALQWTLDHFFAPFPGTAPFKLVIVHAKPSPTTAIGLAGP 60 MAT E MVVG+DDSE S YALQWTLDHFFA PFKLVIVHA+PSP+ IGLAGP Sbjct: 1 MATAETQTMVVGIDDSEQSTYALQWTLDHFFANSTVNPPFKLVIVHARPSPSAVIGLAGP 60 Query: 61 GAADVLPYVEADLKKIAGRVVGKAHEICASKSVTDVILEVVEGDARNVMCEAVEKHHASI 120 GA +VLP+V++D KKIA RVV +A EIC+SKSV D ++EVVEGDARN++CEAVEKHHASI Sbjct: 61 GAVEVLPHVDSDFKKIAARVVEEAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI 120 Query: 121 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIKH 161 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK KH Sbjct: 121 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKTKH 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10131 (473 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25277 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 162 2e-42 >Cs99541 Length = 211 Score = 162 bits (411), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 87/206 (42%), Positives = 117/206 (56%), Gaps = 7/206 (3%) Query: 15 LIKLLLIGDSGVGKSCLLLRXXXXXXXXXXXXXXXXXXKIRTIELDGKRIKLQIWDTAGQ 74 L K ++IGD+GVGKSCLLL+ R I +D K IKLQIWDTAGQ Sbjct: 6 LFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQ 65 Query: 75 ERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKVLVGNKADMDE 134 E FR+IT +YYRGA G LLVYD+T +FN++ +W+ + QHA+ N+ +L+GNK D+ Sbjct: 66 ESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAH 125 Query: 135 SKRAVPTSKGQALADEYGIKFFETSAKTNLNVEEVFFSIAKDIKQRLAET--DSKAEPQT 192 +RAV T +G+ A E+G+ F E SAKT NVEE F A I +++ + D E Sbjct: 126 -RRAVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSNESYG 184 Query: 193 IKINQPD----QAANGGQAPQKSACC 214 IK+ G + Q CC Sbjct: 185 IKVGYGGIPGPSGGRDGSSSQAGGCC 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4366264 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42594 104 7e-25 >Cs42594 Length = 166 Score = 104 bits (259), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 50/71 (70%), Positives = 60/71 (84%) Query: 58 RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLSEADKAPYEAKAAKRKSDY 117 RP SAFFVF+EEFR+ YK++HP K+V+AVGK GGEKWKS+SEADKAPY AKA KRK +Y Sbjct: 40 RPASAFFVFMEEFREQYKKDHPKNKSVAAVGKTGGEKWKSMSEADKAPYVAKAEKRKVEY 99 Query: 118 EKLMAAYNKKQ 128 EK M YN++Q Sbjct: 100 EKDMKNYNRRQ 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20419 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18694 (293 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7245 (280 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20266261 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8576 (323 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34890 (312 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2820 (374 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3766256 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16415 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23194 (375 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9627 (481 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41435 (320 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs40476 82 9e-18 >Cs40476 Length = 122 Score = 81.6 bits (200), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 40/64 (62%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Query: 127 LFQGYYKDEVQTKEVIDGDGWLHTGDIGLWLPGGRLKIIDRKKNIFKLAQGEYIAPEKIE 186 LF GYYK+ T+E I DGW HTGDIG LP G +KIIDRKKN+ K++QGEY+A E +E Sbjct: 3 LFSGYYKNPDLTRESII-DGWFHTGDIGQILPNGVVKIIDRKKNLIKISQGEYVALEYLE 61 Query: 187 NVYA 190 NVY Sbjct: 62 NVYC 65 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32125 (277 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36904 (446 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95618 63 5e-12 >Cs95618 Length = 131 Score = 63.2 bits (152), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 32/80 (40%), Positives = 46/80 (57%), Gaps = 1/80 (1%) Query: 282 GEIVMRGNTVMKGYLKNPKANEETF-ANGWFHSGDLGVKHPDGYIQLKDRSKDIIISGGE 340 GEI +RG +MKGYL +P+A T GW H+GD+G D + + DR K+II G Sbjct: 52 GEICIRGPQIMKGYLNDPEATAATIDVEGWLHTGDIGYVDDDDEVFIVDRVKEIIKFKGF 111 Query: 341 NISSVEIENAVYLHPAVLEA 360 + EIE + HP++ +A Sbjct: 112 QVPPAEIEALLLSHPSIGDA 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29266 (341 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 319 3e-89 >Cs66150 Length = 305 Score = 319 bits (817), Expect = 3e-89, Method: Compositional matrix adjust. Identities = 152/256 (59%), Positives = 189/256 (73%) Query: 19 SPSYGQLSPTYYDDTCPNASSIVRGVIQEAFISDVRIGASLIRLHFHDCFVNGCDGSLLL 78 SPS QLSP++Y TCPN + + V+++AF SD+RIGASLIRLHFHDCFV+GCD S+LL Sbjct: 28 SPSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILL 87 Query: 79 DNTETIVSEKDAIPNANSTRGFEVVDSIKTALESSCPGIVSCADILAIAAEASVCMSGGP 138 D+T TI SEK A PN NS RGFEV+D++K A+E +CP +VSCADIL IAAE SV +SGGP Sbjct: 88 DSTNTIDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSGGP 147 Query: 139 SWTVLLGRRDSRIANQSGANTALPNPRQNITTLKAVFEAVGLNTTTDLVALSGAHTFGRG 198 SW V LGRRDSR AN++ AN LP P + LK+ F VGLN DLVALSGAHTFGR Sbjct: 148 SWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFGRA 207 Query: 199 ACRFFSDRIYNFSGTESPDPSLNSSYLETLSALCPQDGDGTVLANLDPTTPDGFDKNYFS 258 C+FF R+Y+F+ T PDP+L++++L+ L LCPQ G+G VLAN D TTPD FD YFS Sbjct: 208 QCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKYFS 267 Query: 259 NLQENRGLLQSDQELF 274 NL+ + + + F Sbjct: 268 NLRGRKAFCRVIKSCF 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14866265 (539 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51049 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56745 (547 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16453 89 9e-20 >Cs16453 Length = 223 Score = 89.4 bits (220), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 54/175 (30%), Positives = 89/175 (50%), Gaps = 12/175 (6%) Query: 257 EVLGKGTFGTAYKAILEMGTVVAVKRLK-----DVTISENEFREKIEGVGAMDHEHLVPL 311 +GKG G+ Y+A + G + AVK+ +++ + EF +I+ + + H ++V Sbjct: 47 HCIGKGGHGSVYRAKVPSGEIFAVKKFHSPLPGEMSFQQEEFLNEIQALTEIRHRNIVKF 106 Query: 312 RAYYYSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRSGIALGAARGIEYLHSQG 371 + ++Y+Y+ GSL +L + A L W R + G A + YLH+ Sbjct: 107 YCFCSHPKHSFIIYEYLESGSLDKILCNDASAKE--LGWTQRLNVIKGVADALFYLHNNC 164 Query: 372 -PSVSHGNIKSSNILLTKSYDARVSDFGLAHLVGP-SSTPNRVA---GYRAPEVT 421 P + H +I S N+LL Y+A VSDFG+A + P SS + +A GY AP +T Sbjct: 165 FPPIVHRDISSKNVLLDLGYEAHVSDFGIAKFLNPDSSNWSELAGTHGYVAPGIT 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13708 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 67 8e-14 >Cs36939 Length = 275 Score = 67.4 bits (163), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 6/65 (9%) Query: 35 LHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLKKKLMRMGI------DPNNHRLGERASG 88 L ALLGNRW+ IA LP RTDN++KNYWN+HLKKK+ ++ + + N+ E AS Sbjct: 5 LQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKVRKLQLAAAGCSEDNSQYRDELASA 64 Query: 89 TSKSF 93 +S+ Sbjct: 65 SSQQI 69 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34171 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39278 60 7e-12 >Cs39278 Length = 181 Score = 59.7 bits (143), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 30/44 (68%), Positives = 33/44 (75%) Query: 43 REARVLRYREKRRTRLFSKKIRYEVRRLNAEKRTRMKGRFVKRA 86 REARVLRYREKR+ R F K IRY R+ AE R R+KGRF KRA Sbjct: 106 REARVLRYREKRKNRKFEKTIRYHSRKAYAETRPRIKGRFAKRA 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27048 (386 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28701 (382 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53094 (331 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 189 3e-50 >Cs66150 Length = 305 Score = 189 bits (481), Expect = 3e-50, Method: Compositional matrix adjust. Identities = 105/250 (42%), Positives = 146/250 (58%), Gaps = 6/250 (2%) Query: 25 ASAQLKQNYYANICPNVENIVRGVVNMKFKQTFVTVPATLRLFFHDCFVQGCDASVIISS 84 + AQL ++Y++ CPNV N + V+ F + +RL FHDCFV GCDAS+++ S Sbjct: 30 SQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLDS 89 Query: 85 TGSNTAEK-DHPDNLSLAGDGFDTVIKAKAEVDKNPTCRNKVSCADILTMATRDVIALSG 143 T + +EK P+N S GF+ + KA V++ C VSCADILT+A +ALSG Sbjct: 90 TNTIDSEKFAAPNNNS--ARGFEVIDNMKAAVER--ACPRVVSCADILTIAAERSVALSG 145 Query: 144 GPSYAVELGRLDGLRSTSASVNGKLPQPTFNLDKLNSLFAANGLS-QTDMIALSAAHTLG 202 GPS+AV LGR D + A N LP P LD+L S F GL+ + D++ALS AHT G Sbjct: 146 GPSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFG 205 Query: 203 FSHCSKFANRIYNFSRENPVDPTLDKTYAAQLQSMCPKNVDPRIAIDMDPTTPKKFDNVY 262 + C F R+Y+F+ DPTLD T+ QL+ +CP+ + + + D TTP FDN Y Sbjct: 206 RAQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKY 265 Query: 263 YQNLQQGKGL 272 + NL+ K Sbjct: 266 FSNLRGRKAF 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2866265 (276 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 145 6e-37 >Cs30681 Length = 257 Score = 145 bits (365), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 86/201 (42%), Positives = 118/201 (58%), Gaps = 6/201 (2%) Query: 30 MANGSVASCLRERPPSEPPLDWTTRKRIALGSARGLSYLHDHCDPKIIHRDVKAANILLD 89 M N SV L R + L W TR +IA +ARGL+YLH+ D +II RD K++NILLD Sbjct: 1 MPNRSVQDHLTSR--FQATLPWNTRLKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLD 58 Query: 90 EEFEAVVGDFGLAKLMDYKD-THVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLE 148 E++ A + DFGLA+L +HV+TAV GTIG+ APEY+ TG+ + K+D++ +G+ L E Sbjct: 59 EQWNAKLSDFGLARLGPSDGLSHVSTAVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYE 118 Query: 149 LITGQRAFDLARLANDDDVMLLDWVXXXXXXXXXXXXV-DPDLQTNYVEAEVEQLIQVAL 207 LITG+R D R ++ LL+WV + DP L+ Y ++L VA Sbjct: 119 LITGRRPLDRNRPKSEQK--LLEWVRPHLTDAKKFTMILDPKLEGKYSIKLAQKLAAVAN 176 Query: 208 LCTQGSPMERPKMSEVVRMLE 228 C RPKMSEVV +L Sbjct: 177 KCLARQAKGRPKMSEVVEVLN 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26058 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2674 (389 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22173 (531 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9766265 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19510 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80871 355 e-100 >Cs80871 Length = 324 Score = 355 bits (910), Expect = e-100, Method: Compositional matrix adjust. Identities = 175/256 (68%), Positives = 206/256 (80%), Gaps = 11/256 (4%) Query: 1 MDSKMEEKDFLACCGSKKFAEEMTSSGPFANLDQAIDAARDIWFNKVDVNGWLEAFAAHP 60 M ++E++ L CCGS KFA+EM S+ PFA+L+QA+ AAR IWFN VDVNGWL+AF+AHP Sbjct: 1 MMVVLDEEELLGCCGSTKFAKEMASASPFASLNQAVSAARHIWFNLVDVNGWLDAFSAHP 60 Query: 61 QIGQNPSAKHPSDTSAQWSKGEQSTALQTATDSSLQELSDWNARYWKKFGFVFLICASGR 120 QIGQ+PS+ QWSK EQSTAL TA +SS QELSDWN RY +FGF+F+ICASGR Sbjct: 61 QIGQSPSS--------QWSKAEQSTALATANESSSQELSDWNNRYRLRFGFIFIICASGR 112 Query: 121 TASEILAELKRRYPNRPIVEFEIAAQEQMKVTELRLAKLFSTQVKAASISTQNPETAAKK 180 TA+EILAELK+RY NRPI+EFEIAAQEQMK+TELRLAKLFS + KA+S + Q TA K Sbjct: 113 TAAEILAELKKRYTNRPIIEFEIAAQEQMKITELRLAKLFSAKAKASSATFQYSATA--K 170 Query: 181 AGEDRVSIIGAHLTATSEASAGKTPQISPRTRPPITTHVLDVARGSPAAGIEVRLEMWKG 240 EDRVSII HL A++EASAGK QI RTR PITTHVLDV++GSPAAG+EVRLEMWKG Sbjct: 171 TAEDRVSIIEGHLCASTEASAGKISQIPTRTRLPITTHVLDVSQGSPAAGVEVRLEMWKG 230 Query: 241 NQPRPLFGKED-EGWL 255 QPRPLFG+ D GW+ Sbjct: 231 IQPRPLFGETDVSGWV 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1799 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11167 (492 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs38944 546 e-157 >Cs38944 Length = 281 Score = 546 bits (1408), Expect = e-157, Method: Compositional matrix adjust. Identities = 256/275 (93%), Positives = 269/275 (97%) Query: 38 GPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQT 97 GPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFE THD+SNLTCADFLRAPGVQT Sbjct: 7 GPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQT 66 Query: 98 PVILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHA 157 PVI+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFF+RDGMKFPDMVHA Sbjct: 67 PVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHA 126 Query: 158 LKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLINKAG 217 LKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVG+P+DYRHMEGSGVNTY LINKAG Sbjct: 127 LKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPRDYRHMEGSGVNTYMLINKAG 186 Query: 218 KAHYVKFHWKPTCGVKCLLEEEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLFIQTIDPD 277 KAHYVKFHWKPTCGVKCLLE+EAI+VGG+NHSHATQDLYDSIAAGNYPEWKL+IQ +DPD Sbjct: 187 KAHYVKFHWKPTCGVKCLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLYIQIMDPD 246 Query: 278 HEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNRNI 312 HEDKFDFDPLDVTKTWPEDILPLQPVGR+ ++I Sbjct: 247 HEDKFDFDPLDVTKTWPEDILPLQPVGRVGFEQDI 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1285 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs98775 187 6e-50 >Cs98775 Length = 146 Score = 187 bits (474), Expect = 6e-50, Method: Compositional matrix adjust. Identities = 90/150 (60%), Positives = 119/150 (79%), Gaps = 5/150 (3%) Query: 1 MGVVATLEYFSDLL-SSKKGKKRKQLQTVDLKVRMDCEGCQLKVKKALSSLKGVKSVDVN 59 MGV L++ DL ++ +GKKRK +QTVD+KV+MDC+GC+ KV+ A+SS++G KSV+VN Sbjct: 1 MGV---LDHLFDLFETTPRGKKRKPMQTVDIKVKMDCDGCERKVRNAVSSIRGAKSVEVN 57 Query: 60 LKQQKASVTGYADAKKVLKKAQSTGKKAELWPYVPYNLVAHPYVAQVYDKKAPPGYVRSS 119 KQ + +VTGY D KVLKK +STGK+AE WPYVPYNLVA+PYVAQ YDKKAP GYV++ Sbjct: 58 RKQSRVTVTGYVDPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNV 117 Query: 120 ENPAITAMSPLEEQYTTMFSDDNPNACSIM 149 A+ + + +E+ TT+FSD+NPNACSIM Sbjct: 118 VQ-ALPSPNATDERLTTLFSDENPNACSIM 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57051 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31880 (249 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64862 129 3e-32 >Cs64862 Length = 266 Score = 129 bits (324), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 61/80 (76%), Positives = 72/80 (90%) Query: 168 IDTLKLGACVDLLGGLVHIGLGDPVANECCPVLSGLVELEAAVCLCTTLKIKLLNLNIFV 227 I+ LKLG C+D+LGGLVHIGLG+PV N CCPVL GL+ELEAA+CLCTT+++KLLNLNIF+ Sbjct: 170 INALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFI 229 Query: 228 PLALQLLITCGKTPPPGYTC 247 PLAL LITCGKTPPPG+ C Sbjct: 230 PLALPALITCGKTPPPGFVC 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21666261 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs105603 328 4e-92 >Cs105603 Length = 271 Score = 328 bits (841), Expect = 4e-92, Method: Compositional matrix adjust. Identities = 158/235 (67%), Positives = 182/235 (77%), Gaps = 1/235 (0%) Query: 1 MFRLSNNLVGILNFITFLLSVPILGAGIWLSHRASTDCEKFLEKPVIALGVFLMVVSLAG 60 MFRLSNNL+GILN +TFLLS+PIL AGIWLS++ T+CEKFL+KPVI LGVFLM+VSLAG Sbjct: 1 MFRLSNNLIGILNILTFLLSIPILWAGIWLSNKGVTECEKFLDKPVIILGVFLMIVSLAG 60 Query: 61 LIGACCRVSXXXXXXXXXXXXXXXXXXXXTIFAFVVTNKGAGEVLSGKGYKEYRLGDYSN 120 LIGACCR+S TI AFVVTNKGAGEVLSG+GYKEYRLGDYS+ Sbjct: 61 LIGACCRISWLLWVYLVVMFLLIVLLFCFTIMAFVVTNKGAGEVLSGRGYKEYRLGDYSD 120 Query: 121 WLQKRVNNTKNWNRIKSCLQDGKVCQSLSQDKVGETVQQFYAEQLSPIQSGCCKPSNDCG 180 WLQKRVNNTKNWN+IKSCL D KVC S + +TV+QFY+E LS +QSGCCKPSNDCG Sbjct: 121 WLQKRVNNTKNWNKIKSCLIDSKVCSSFHDKYLNDTVEQFYSEHLSSVQSGCCKPSNDCG 180 Query: 181 FTYVTPTNWTSTNAATYTNSDCSLWNNEPSILCFNCQACKAGVLDNLKRDWEKVA 235 F Y PT WT N ++ TN DC W N+ S LC+NCQ+CKAG+LD LK DW+KVA Sbjct: 181 FNYAGPTQWTKGNTSS-TNPDCGAWGNDASTLCYNCQSCKAGLLDQLKSDWKKVA 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62748 (238 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39715 63 3e-12 >Cs39715 Length = 158 Score = 63.2 bits (152), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 7/127 (5%) Query: 114 RFAAIGIDTPGLVALLGAHSVGRTHCVKLVHRLYPEVDPVLNTDHVEHMLHKCP--DAIP 171 RF A+G+ LVAL G H++G+ C +Y E + ++ CP + Sbjct: 13 RFNALGLSNKDLVALAGGHTIGQARCTSFRAHIYNETN--IDASFARTRQGNCPRANGTG 70 Query: 172 DPKAVQYVRNDRGTPMKLDNNYYRNILDNKGLLIVDHQLATDKRTKPYVKKMAKSQDYFF 231 D D TP DNNY++N+++ KGLL D QL T V+ + + F Sbjct: 71 DNNLAPL---DLQTPTSFDNNYFKNLVNRKGLLHSDQQLFNGGSTDSQVRTYSNNPSTFS 127 Query: 232 KEFCRAI 238 +F + Sbjct: 128 SDFVAGM 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18033 (261 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52183 (405 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51307 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78299 454 e-130 >Cs78299 Length = 259 Score = 454 bits (1168), Expect = e-130, Method: Compositional matrix adjust. Identities = 215/259 (83%), Positives = 241/259 (93%), Gaps = 1/259 (0%) Query: 1 MAVGVVVCFASL-ISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLY 59 MA+ ++CF S+ +SLF+ AKIPG ++GG WQSAHATFYGGSDASGTMGGACGYGNLY Sbjct: 1 MALFRMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY 60 Query: 60 SQGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPS 119 SQGYGVNTAALSTALFNNGLSCGACFELKC DP WC+ G+P+ILITATNFCPPN+A PS Sbjct: 61 SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPS 120 Query: 120 DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGMRFTINGFRYFNLVL 179 DNGGWCNPPRPHFDLAMPMFLK+A+YRAGIVPV++RRVPCRK+GG+RFTINGFRYFNLVL Sbjct: 121 DNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL 180 Query: 180 ITNVAGAGDIVRASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWN 239 +TNVAGAGDIVR SVKG+ T W+S+SRNWGQNWQSN+ LVGQ+LSFRVTGSDRRTSTSWN Sbjct: 181 VTNVAGAGDIVRVSVKGANTQWLSMSRNWGQNWQSNSQLVGQALSFRVTGSDRRTSTSWN 240 Query: 240 IAPAHWQFGQTFSGKNFRV 258 +APA+WQFGQTFSGKNFRV Sbjct: 241 VAPANWQFGQTFSGKNFRV 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15978 (274 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38640 (513 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs61125 176 5e-46 >Cs61125 Length = 240 Score = 176 bits (446), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 97/257 (37%), Positives = 161/257 (62%), Gaps = 27/257 (10%) Query: 54 IASLVDTAFIGQLGPVELAAVGVSIAVFNQVSRIAIFPLVSVTTSFVAEEDTIGILDSEP 113 +A L++TA+IG+LGP+ELA+ GVS ++FN +S++ PL+SV TSFVAE+ Sbjct: 1 MAQLMETAYIGRLGPLELASAGVSTSIFNILSKVFNIPLLSVATSFVAED---------- 50 Query: 114 EVSKSVEMGSAVNGETKKLIPKGSGERPYDLEMHGSGHDTPKFESKRHIPSASAALVVGG 173 + S+ + + P ++ +G T ++ +PS S ALV+ Sbjct: 51 -----ISRSSSKDSTSDSSCP--------NVSYNGCDEST----DRKLLPSVSTALVLAL 93 Query: 174 ILGLIQAIFLISGAKPILNFMGVHSDSPMLAPAQEYLTLRSLGAPAVLLSLAMQGVFRGF 233 +G+++A+ + G+ L+ MG+ S S M PAQ +L+LR++GAPAV+LSLA+QG+FRGF Sbjct: 94 TIGILEALAMYFGSGLFLDIMGISSASSMRIPAQRFLSLRAIGAPAVVLSLAIQGIFRGF 153 Query: 234 KDTKTPLYATVAGDVTNIILDPIFMFVFHMGVGGAAIAHVISQYIISVILFWKLMQQVEL 293 KDT+TP++ G+ + + + P+ M+ F +GV GAAI+ V SQY++++++ W L ++ L Sbjct: 154 KDTRTPVFCLGLGNFSAVFMFPMLMYYFKLGVTGAAISTVGSQYMVTLLMIWYLNKRTIL 213 Query: 294 LPPSTKVLRFGRFLKNG 310 P+ K L FG +L++G Sbjct: 214 SIPNMKNLHFGDYLRSG 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2428 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6806 (388 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs45360 276 2e-76 >Cs45360 Length = 378 Score = 276 bits (706), Expect = 2e-76, Method: Compositional matrix adjust. Identities = 140/332 (42%), Positives = 191/332 (57%), Gaps = 20/332 (6%) Query: 60 GSSCEFSDGKWVYDLSYPLYDSSCPYLSTPVTCQKNGRPDSDYEKWRWKPHGCSIPRFDA 119 G C GKWVYD SYPLY S CP++ CQK GRPD Y K+RW+P CSIPRF+ Sbjct: 60 GGKCNIFQGKWVYDASYPLY-SHCPFVDPEFDCQKYGRPDDIYLKYRWQPFSCSIPRFNG 118 Query: 120 LHFLGRMRRKRIMLVGDSIMRNQWESLVCLVQGVIPTGRKTVTYDGPSMAFHALDFETSI 179 L+FL + R K+IM VGDS+ NQW+SL C++ +P + +V + +F I Sbjct: 119 LYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWVPKTKYSVVRTAVLSSITFQEFGLQI 178 Query: 180 EFCWAPFLVELKKGPQNKRILHLDLIEENAKYWRGVDVLVYDSAHWWTHSDKWSSWDYYM 239 +LV+L + P +L LD I + WRG+D+L++++ HWWTH+ + +DY Sbjct: 179 LLYRTTYLVDLVREPAGT-VLRLDSI-KGGNAWRGMDMLIFNTWHWWTHTGRSQPFDYIR 236 Query: 240 EANTVLRSMNPMVAYQKGLTTWAKWVDLNLDPHKTRVIFRSVSPRHNRQNGWK-----CY 294 E + + MN +VA+ KGLTTWA+WV+ N+DP KT+V F+ +SP H W C Sbjct: 237 EGRKLYKDMNRLVAFYKGLTTWARWVNFNVDPTKTKVFFQGISPTHYEGRDWNEPSKSCS 296 Query: 295 NQKQPLEFFSHQLHVPEQMVVLKGVLKGMRFPVYLQDITMMSALRKDGHPSVYTRAMDQE 354 Q +P + + P VVL+ V +R PVYL DIT +S RKD HPS Y D Sbjct: 297 GQTKPYFGYKYPAGTPMPWVVLQKVFSRLRKPVYLLDITRLSQYRKDAHPSEYGGHSD-- 354 Query: 355 QKQHPRDFTSDCSHWCLPGVPDAWNEMLSALL 386 DCSHWCLPG+PD WN+++ A L Sbjct: 355 ----------DCSHWCLPGLPDTWNQLMYAAL 376 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47074 (437 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21354 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22056 (487 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12166257 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 118 4e-29 >Cs99541 Length = 211 Score = 118 bits (296), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 63/162 (38%), Positives = 99/162 (61%), Gaps = 7/162 (4%) Query: 8 LLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQ 67 L K II+GD+GVGK+ L+ Q+ +K+F + TIG +F + + +++ LQIWDTAGQ Sbjct: 6 LFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQ 65 Query: 68 ERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKV 127 E F+S+ ++YRGA +LVYD+ ++F++L +W E+ A+ N +++GNK Sbjct: 66 ESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANA----NMTIMLIGNKC 121 Query: 128 DVDGGNSRVVSDKKARAWCASKGNIPYFETSAKEGINVEEAF 169 D+ + R VS ++ + G I + E SAK NVEEAF Sbjct: 122 DL--AHRRAVSTEEGEQFAKEHGLI-FMEASAKTAQNVEEAF 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41852 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50199 (415 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs61199 191 1e-50 >Cs61199 Length = 399 Score = 191 bits (485), Expect = 1e-50, Method: Compositional matrix adjust. Identities = 165/440 (37%), Positives = 212/440 (48%), Gaps = 91/440 (20%) Query: 12 LPSHFLTDEDTLMDKENFNDNGANPVGAEIHG------------------FPSEFPYEFD 53 LP L+D+ L+DKEN PV E FP+EFP++FD Sbjct: 15 LPPQSLSDDFVLVDKEN----AYTPVAVEKKHALKSMNLNLSLDPNPSLVFPTEFPFDFD 70 Query: 54 SFGSSSALNXXXXXXXXXXXXXXXXXXLLTQLKRQLAHSTLHDTQKLAPSFSSENQEKTW 113 S L+ ++ + LA T T+KL EK+W Sbjct: 71 S------LDSALSSPVDSVVGSTETETTVSDEEDFLAGLTQRLTRKL---------EKSW 115 Query: 114 VLSGSPQSTLSAVGNWSGRSTVSSNGSPNGRSRVSSPPTTPLSEKTDAWDLIYAAAGQVA 173 GSP+STL+ +G+ S S S N S S VSSPPTTP + D WDLI AAAGQ+A Sbjct: 116 ---GSPESTLNGLGSMSVSSNGSPNSS---SSLVSSPPTTPFGGQNDTWDLISAAAGQIA 169 Query: 174 RLKMSGD---GPKYQ-----QGRGLLGPPRSPMPVPTQPAKNANTGFYSYQS----LSNN 221 RLKMS P Y + GLL PP+S PV KN GFYS ++ L+ N Sbjct: 170 RLKMSNGSEAAPTYTTNVSGRATGLLAPPKSSNPV--HVIKNPYFGFYSIENVNFDLAAN 227 Query: 222 ISQTSQSQHIRQEQVLKQQCSVWGREAKEAWFSXXXXXXXXXXXIHSRRSVGLESGRCGR 281 +Q +++QEQ+LK Q + +A R+ G +GRCG+ Sbjct: 228 TTQVQYQHYVKQEQMLKAQSQRLQQIQPKA------------------RNFGYVNGRCGQ 269 Query: 282 PLGLPPSAWPPLXXXXXXXXXXXGMRAVFLGGSG-LKRESAGTGVFLPRRFGNAS---DS 337 P SAWPPL R VF+ GSG ++R AGTGVFLPRR+GN + DS Sbjct: 270 --QQPQSAWPPLQAQQHQQKPQQ-QRPVFVAGSGCVRRGCAGTGVFLPRRYGNINNPHDS 326 Query: 338 RKKPGCSTVLLPARVVQALNLNFEDMGSHSQPHFNGGVAPDY--EALMARRNALISQQKR 395 RKK G +P A+N H+Q FN P+Y +A++ARRNALI+ QKR Sbjct: 327 RKKSGSPNGFVPTTTTPAMNF-------HAQQRFNCSFGPNYVADAIIARRNALITLQKR 379 Query: 396 NLRPEATMNHEIRLPQEWTY 415 LR EA NHEI LP+EWTY Sbjct: 380 GLRQEAARNHEIHLPKEWTY 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10257 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64862 83 2e-18 >Cs64862 Length = 266 Score = 82.8 bits (203), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 36/59 (61%), Positives = 51/59 (86%) Query: 152 IDTLKLGACVDLLGGLVHIGIRSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLNVNII 210 I+ LKLG C+D+LGGLVHIG+ + ++ CCPVL+GL++L+AA+CLCT I++KLLN+NI Sbjct: 170 INALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIF 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5906 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs6004 308 2e-86 >Cs6004 Length = 214 Score = 308 bits (790), Expect = 2e-86, Method: Compositional matrix adjust. Identities = 144/188 (76%), Positives = 165/188 (87%), Gaps = 4/188 (2%) Query: 1 MECNVHP-CSDLPPLPRVGVEFQLEKTIDQIKWYGKGPFECYPDRKAAAHVGVYEQNVGD 59 +ECN P SDLPPLPRVGVEF LE+++D+IK+YG+GPFECYPDRKAAAHV VYEQ VGD Sbjct: 30 VECNFKPNTSDLPPLPRVGVEFHLEQSMDKIKFYGRGPFECYPDRKAAAHVDVYEQIVGD 89 Query: 60 MHVPYIVPVECSGRADVRWVTFQNKDGFGIYASVYGSSPPMQMNASYYSTAELERATHKE 119 MHVPYIVP EC+ RADVRWVTFQNK+G GIYAS+Y SSPPMQ+NASYY+T EL+RATH E Sbjct: 90 MHVPYIVPGECAARADVRWVTFQNKEGIGIYASMYSSSPPMQLNASYYTTTELDRATHNE 149 Query: 120 ELIKGDDIECSQVHLDHKHMGLGGDDSWSPCVHEKYLIPAVPYSFSTRLSPITAAITGYD 179 +L+K D IE VHLDHKHMGLGGDDSW+PCVH+KYL+PAV YSFS RLSP+TAA +GY Sbjct: 150 QLVKEDKIE---VHLDHKHMGLGGDDSWTPCVHDKYLVPAVAYSFSIRLSPLTAATSGYG 206 Query: 180 ICKSQLQN 187 I KSQ+QN Sbjct: 207 IYKSQMQN 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46095 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10194 335 2e-94 >Cs10194 Length = 251 Score = 335 bits (860), Expect = 2e-94, Method: Compositional matrix adjust. Identities = 167/210 (79%), Positives = 186/210 (88%) Query: 1 MAFNKLTDSGSSTPAGLVAAALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLL 60 MAFNKLT +G++TP+GLVAA++AH FALFVAV+VGANISGGHVNPAVTFGAF+GG+I+LL Sbjct: 42 MAFNKLTHNGANTPSGLVAASVAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLL 101 Query: 61 RGILYWIAQLLGSVVACLLLKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYA 120 RGILYWIAQLLGS VACLLLKF T G TSAF+LSSGV WNA+VFEIVMTFGLVYTVYA Sbjct: 102 RGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYA 161 Query: 121 TAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWSWANHWVYWA 180 TA+DPKKG+LG IAPIAIGFIVGANILAGGAFDGASMNPAVSFGPA+VSWSW NHWVYW Sbjct: 162 TALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWV 221 Query: 181 GPLXXXXXXXXXYDLIFIDSTHEQLPTTDY 210 GPL Y+ FI+ +HEQLPTT+Y Sbjct: 222 GPLIGGGLAGIVYEFFFINQSHEQLPTTEY 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2096 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36106190 231 3e-63 >Cs36106190 Length = 283 Score = 231 bits (589), Expect = 3e-63, Method: Compositional matrix adjust. Identities = 107/148 (72%), Positives = 124/148 (83%) Query: 1 MIMQCLGAICGAGMVKWFQRRDFETLGGGINAVASGYSKLAGLGAEIVGTFVLVYTVLSA 60 M+ QCLGAICG G+VK F + ++ +LGGG N VASGY+K + LGAEI+GTFVLVYTV SA Sbjct: 125 MVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSA 184 Query: 61 TDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRGNAWDDM 120 TD KR+ARDSHVP+LAPLPIGFAVF+VHLATIPITGTGINPARS GAA+IYN AWDD Sbjct: 185 TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDH 244 Query: 121 WIFWVGPFIGATLATLYHQIVIRAISFK 148 WIFWVGPF+GA A YHQ ++RA + K Sbjct: 245 WIFWVGPFVGALAAAAYHQYILRAAAIK 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7366262 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13274 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20752 (307 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13591 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17425 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18472 149 2e-38 >Cs18472 Length = 412 Score = 149 bits (375), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 81/116 (69%), Positives = 89/116 (76%), Gaps = 14/116 (12%) Query: 6 MALVKPISKFST--STPNPRAPY---------SKVFRISMSATSQ---PSTGKRPSKKAA 51 MALVKPISKFST +T PR Y ++ I MSATS+ +T ++PSKK+ Sbjct: 1 MALVKPISKFSTIATTTKPRFSYPKATCTSLSTRFCTIKMSATSEQAAAATAQKPSKKSN 60 Query: 52 KTAIKETLLTPRFYTTDFDEMETLFNTEINKNLNQTEFEALLQEFKTDYNQTHFVR 107 KTAIKETLLTPRFYTTDFDEMETLFNTEINK LNQ EFEALLQEFKTDYNQTHFVR Sbjct: 61 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVR 116 Score = 121 bits (304), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 55/74 (74%), Positives = 65/74 (87%) Query: 99 DYNQTHFVRKLDRMVEINQQLIAVGESDDIPVVKNLKKIPLIAGLASEILAAYLMPPVES 158 D F R+LDRMVEIN++L+AVG +DDIP+VKNLK+IPLIA LASE+LA YLMPPV+S Sbjct: 339 DVENPEFKRRLDRMVEINERLLAVGATDDIPLVKNLKRIPLIAALASELLATYLMPPVDS 398 Query: 159 GSVDFAEFEPQLVY 172 GSVDFAEFEP+LVY Sbjct: 399 GSVDFAEFEPELVY 412 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv927 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49339 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2666262 (383 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs173106183 72 1e-14 >Cs173106183 Length = 286 Score = 71.6 bits (174), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 55/225 (24%), Positives = 97/225 (43%), Gaps = 43/225 (19%) Query: 18 SDEELFT-CLQGMINGSPLPDNVIIEVNPYQHNPSCLPDRV------WYLTSSEDTKF-- 68 +DEEL L+ P P ++I EV+ Y+ +P LP++ WY S D K+ Sbjct: 18 TDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEFGEKEWYFFSPRDRKYPN 77 Query: 69 --------AEGFWKPKGEPYEIFSNSSITGWRTTFEFYEGTTPHVLKTDWVLQQYKIT-- 118 G+WK G I+ S G + FY+G P +KTDW++ +Y++ Sbjct: 78 GTRPNRATVSGYWKATGTDKAIYGGSKYLGVKKALVFYKGRPPKGIKTDWIMHEYRLNDP 137 Query: 119 --QKGQSKNIKPMASSSLCRVFQSREQSSSHEMQKELGVANVADENHTCSKPSVVSNTDN 176 Q + + LCR+++ R+ S + ++ +E+ +C Sbjct: 138 TRQPYKHNGSMKLDDWVLCRIYKKRQTGSRSVLDAKV------EEDQSC----------- 180 Query: 177 STGQGSKSESQVQHGNG--ETGLLAAPERSLNHPVDNLPEIDYFS 219 Q K+ V+H N E L+ R+ + + +L E++YF+ Sbjct: 181 -VDQLGKTGGYVEHANASDEQKLMVKFPRTCS--LAHLVELEYFA 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15037 (398 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22651 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61295 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22560 (277 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37239 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25409 81 1e-17 >Cs25409 Length = 359 Score = 80.9 bits (198), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 35/58 (60%), Positives = 44/58 (75%) Query: 53 VYRGVRMRTWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNSAILNFP 110 +YRGVR R WGKWV+EIR P+ ++R+WLGTF T E AA A+D AA ++G A LNFP Sbjct: 165 LYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAYKLRGEFARLNFP 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26961 (285 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15890 201 6e-54 >Cs15890 Length = 150 Score = 201 bits (512), Expect = 6e-54, Method: Compositional matrix adjust. Identities = 111/152 (73%), Positives = 118/152 (77%), Gaps = 5/152 (3%) Query: 137 MKGQSNG-VRGFSSPARD-QDRRGXXXXXXXXXXXXXXKS-ASSETAHDXXXXXXXXXXX 193 M+GQSNG VRGF+SP R D+RG KS ASSETAHD Sbjct: 1 MRGQSNGGVRGFASPDRGAHDKRGTRHNNHNHHNNDYNKSGASSETAHDSKKGGSSSASG 60 Query: 194 XXEAVPPVWPPKFVIALTNKEKEEDFMAIKGSKLPQRPKKRAKFIQRTLNLVSPGAWLCD 253 EA PPVWPPKFVIALTNKEKEEDFMAIKGSKLPQRPKKRAKFIQRT+NLVSPGAWLCD Sbjct: 61 --EAAPPVWPPKFVIALTNKEKEEDFMAIKGSKLPQRPKKRAKFIQRTVNLVSPGAWLCD 118 Query: 254 LTLERYEVREKKISKKKPRGLKAMGNMESDSE 285 LTLERYEVREKKISKK+PRGLKAMG+M+SDSE Sbjct: 119 LTLERYEVREKKISKKRPRGLKAMGSMDSDSE 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14030 (80 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18823 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52096 232 2e-63 >Cs52096 Length = 216 Score = 232 bits (592), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 115/217 (52%), Positives = 148/217 (68%), Gaps = 38/217 (17%) Query: 1 MGSEGPPAVTIHVTGFKKFHGVSDNPTETIVSNLQEYMKKNGLPKGLILGSCNILETAGQ 60 MGSEGP AVTIH+ GFKKF G+++NPTET+V+NL+ Y+++ GLP G+ LGSC +LE AG Sbjct: 1 MGSEGPKAVTIHINGFKKFQGIAENPTETVVNNLKAYVERRGLPAGVTLGSCTVLEAAGD 60 Query: 61 GALVPLYQTLQSAISGKDSESSNSKRIIW------------------------------- 89 GAL L +TL+S+IS +SN++++IW Sbjct: 61 GALPTLLKTLESSIS---QTNSNNEQVIWIHVGVNSGSSKFALERRAVNEATFLCPDQLG 117 Query: 90 ----KVPIIPADGGISRTRETSLPVEEITKTLTKMGYEVMPSDDAGRFVCNYVYYHSLRF 145 ++P++ DGGISR+R+TSL E I K L K G++V+ SDDAGRFVCNYVYYHSLRF Sbjct: 118 WQPQQIPVVLEDGGISRSRQTSLSTEAILKFLKKKGFDVVISDDAGRFVCNYVYYHSLRF 177 Query: 146 AEQSGIQSLFVHVPLFLTIDEETQMQFAASLLEVLAS 182 AEQ G +SLFVHVPLF TIDE+TQMQF A+L E +AS Sbjct: 178 AEQKGHKSLFVHVPLFSTIDEDTQMQFVATLFEAVAS 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18824 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52096 181 3e-48 >Cs52096 Length = 216 Score = 181 bits (459), Expect = 3e-48, Method: Compositional matrix adjust. Identities = 96/200 (48%), Positives = 120/200 (60%), Gaps = 54/200 (27%) Query: 1 MGSEGPPAVTIHVTGFKKFHGVSDNPTETIVSNLQEYMKKNGLPKGLILGSCNILETAGQ 60 MGSEGP AVTIH+ GFKKF G+++NPTET+V+NL+ Y+++ GLP G+ LGSC +LE AG Sbjct: 1 MGSEGPKAVTIHINGFKKFQGIAENPTETVVNNLKAYVERRGLPAGVTLGSCTVLEAAGD 60 Query: 61 GALVPLYQTLQSAISGKDSESSNSKRIIW------------------------------- 89 GAL L +TL+S+IS +SN++++IW Sbjct: 61 GALPTLLKTLESSIS---QTNSNNEQVIWIHVGVNSGSSKFALERRAVNEATFLCPDQLG 117 Query: 90 --------------------TSLPVEEITKTLTKMGYEVMPSDDAGRFVCNYVYYHSLRF 129 TSL E I K L K G++V+ SDDAGRFVCNYVYYHSLRF Sbjct: 118 WQPQQIPVVLEDGGISRSRQTSLSTEAILKFLKKKGFDVVISDDAGRFVCNYVYYHSLRF 177 Query: 130 AEQNGIQSLFVHVPLFLTID 149 AEQ G +SLFVHVPLF TID Sbjct: 178 AEQKGHKSLFVHVPLFSTID 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17597 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64199 297 5e-83 >Cs64199 Length = 180 Score = 297 bits (761), Expect = 5e-83, Method: Compositional matrix adjust. Identities = 141/180 (78%), Positives = 163/180 (90%) Query: 1 MGWIGETVDSIKSIQIRQVLSQAVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEP 60 MGWIGE+++S+KS++IR L Q ++LGMIV+SALIIWK LMCITGSESPVVVVLS SMEP Sbjct: 1 MGWIGESIESVKSMKIRDSLFQFITLGMIVSSALIIWKGLMCITGSESPVVVVLSESMEP 60 Query: 61 GFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKVHERQDTGEVDVLTKGDNNY 120 GF+RGDILFL MSKDPIR GEIVVFN+ GR+IPIVHRVI+VHE++ +GEV +LTKGDNN Sbjct: 61 GFQRGDILFLQMSKDPIRTGEIVVFNIQGRDIPIVHRVIEVHEQRQSGEVRILTKGDNND 120 Query: 121 GDDRLLYAHGQLWLQRHHIMGRAVGFLPYVGWVTIIMTEKPLIKYVLIGALGLLVITSKD 180 DDR+LYA GQ WL++ HIMGRAVGFLPYVGW TIIMTEKP+IKY+LIGALGLLVITSKD Sbjct: 121 VDDRMLYAQGQFWLKQEHIMGRAVGFLPYVGWATIIMTEKPIIKYILIGALGLLVITSKD 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57243 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50164 (249 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11919 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21920 (109 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2737 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35366259 (371 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36473 (67 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3577 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15312 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31219 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8820 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3139 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33548 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67400 132 3e-33 >Cs67400 Length = 188 Score = 132 bits (333), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 73/167 (43%), Positives = 103/167 (61%), Gaps = 8/167 (4%) Query: 6 KLDLISNLPLSIIESILVRLPIREAVRTSILSSKWRYRWSGITDLVXXXXXXXXXXXXXX 65 +LD +S+LP +I+ IL +LPIR+AVRTS+LS KWRY+W+ + LV Sbjct: 16 ELDRLSSLPAHVIDQILSQLPIRDAVRTSVLSKKWRYKWATVPHLVFDNHCVSTSSQDQT 75 Query: 66 XIT--------QVLLLHAGPIHKFQITTSNLRICPDIDQWILFLSRNDVKEILLELGECE 117 I VLLLH GPI KF+++ +L DID+WIL++SR+ VKE +LE+ + + Sbjct: 76 FIKNKLVNIVDHVLLLHNGPILKFKLSHRDLLGVSDIDRWILYMSRSCVKEFILEIWKGQ 135 Query: 118 WFTVPSCLFSCQKLTRLELVRCELHPPPTFKGFLHLKILNLHQVSIT 164 + VPS LF C L LEL C L PP TFKGF + + L+LH + ++ Sbjct: 136 RYKVPSSLFLCPNLIHLELFNCLLKPPITFKGFXNXESLDLHTLPLS 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48206 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10966264 (513 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31981 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2138 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv569 (284 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28791 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32375 (334 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10294 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20032 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12295 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21042 (231 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6266261 (425 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74261 168 1e-43 >Cs74261 Length = 193 Score = 168 bits (425), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 77/138 (55%), Positives = 107/138 (77%), Gaps = 1/138 (0%) Query: 53 WAGLPPELLRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIVKSPEFSGKLTFPI 112 WAGL PELL ++I+R+E +E +WP R++VVACA VC+ WRE+ K+IVKSP SGK+TFP Sbjct: 57 WAGLLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPS 116 Query: 113 SLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRNRRTTCTEYVIS 172 LKQPGPR+ QC I+R+K T++L+L L+P+ E GKFLL+A+R RR +EY+IS Sbjct: 117 CLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPS-FSEKGKFLLAARRYRRGAHSEYIIS 175 Query: 173 MDADNISRSSSTYIGKLR 190 +DA ++S+ S+ Y+GKLR Sbjct: 176 LDAGDLSQGSNAYVGKLR 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47042 (270 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9212 (176 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27272 115 2e-28 >Cs27272 Length = 257 Score = 115 bits (289), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 50/101 (49%), Positives = 73/101 (72%) Query: 75 MVETMFEKYNFAGVFIQIQAVLTLYAQGLLTGLVIDSGDGVTHVVPVVDGYSFPHLTKRM 134 M + MFE +N +++ IQAVL+LYA G TG+V+DSGDGV+H VP+ +GY+ PH R+ Sbjct: 1 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 60 Query: 135 NVAGRHITSYLVDLLSRRGYAMNRTADFETVREIKEKLCYI 175 ++AGR +T L+ +L+ RGY TA+ E VR++KEKL Y+ Sbjct: 61 DLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYV 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43299 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57609 (568 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19151 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53716 (254 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28883 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55264 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8059 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37676 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14923 (117 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29537 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17700 (423 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8462 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs62644 67 2e-13 >Cs62644 Length = 272 Score = 67.4 bits (163), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Query: 163 DGYRWRKYGQKAVKNSPFPRSYYRCTNSK---CTVKKRVERSSEDPSIVITTYEGQH-CH 218 DG+ WRKYGQK + N+ PRSY+RCT+ C K+V+R +DP + TTY G H C Sbjct: 136 DGHAWRKYGQKEILNTKHPRSYFRCTHKYVQGCRATKQVQRRDDDPQMYDTTYIGHHTCR 195 Query: 219 HTVGFPR 225 + FP+ Sbjct: 196 DIISFPQ 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35126 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52976 383 e-109 >Cs52976 Length = 206 Score = 383 bits (984), Expect = e-109, Method: Compositional matrix adjust. Identities = 183/206 (88%), Positives = 196/206 (95%) Query: 1 MSASEEEISRLFRIRKTVMQMLKDRGYFVGDFEINMTKHQFVSKFGENMKREDLVINKAK 60 M+ S+EEI RLFRIR+TVMQML+DRGYFVGDFEINM+K QF++KFGENMKREDLVINKA Sbjct: 1 MTLSDEEIKRLFRIRRTVMQMLRDRGYFVGDFEINMSKEQFIAKFGENMKREDLVINKAL 60 Query: 61 RTDSSDQIYVFFPEEQKVGVKTMKTYTNRMKSENVFRAILVVQQNLTPFARTCINEISTK 120 R DSSDQIYVFFP+EQKVGVKTMKTYTNRMKSENVFRAILVVQQNLTPFARTCI EIS K Sbjct: 61 RNDSSDQIYVFFPDEQKVGVKTMKTYTNRMKSENVFRAILVVQQNLTPFARTCIQEISAK 120 Query: 121 FHLEVFQEAELLVNIKEHVLVPEHQVLTSEEKKTLLERYTVKETQLPRIQVSDPIAGYFG 180 FHLEVFQEAELLVNIKEHVLVPEHQVLT+EEKKTLL+RYTVKETQLPRIQV+DP Y+G Sbjct: 121 FHLEVFQEAELLVNIKEHVLVPEHQVLTNEEKKTLLKRYTVKETQLPRIQVTDPXCRYYG 180 Query: 181 LKRGQVVKIIRPSETAGRYITYRYVV 206 LKRGQVVKIIRPSETAGRY+TYRYVV Sbjct: 181 LKRGQVVKIIRPSETAGRYVTYRYVV 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48987 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15880 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26272 (357 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17782 59 5e-11 >Cs17782 Length = 216 Score = 59.3 bits (142), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 7/74 (9%) Query: 109 KKKKDYYEVLGLEKSCTVEDIRKAYRKLSLKVHPDKNKAPG-------AEEAFKAVSKAF 161 +K ++Y VLGL K CT ++R AY+KL+L+ HPD+ A G A++ F+ + A+ Sbjct: 6 EKSSNFYAVLGLNKECTATELRNAYKKLALRWHPDRCSASGNAKFVDEAKKKFQTIQHAY 65 Query: 162 QCLSNEESRKKYDL 175 LS+ R YD+ Sbjct: 66 SVLSDANKRLLYDV 79 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49124 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs6371 82 6e-18 >Cs6371 Length = 189 Score = 81.6 bits (200), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 54/164 (32%), Positives = 83/164 (50%), Gaps = 21/164 (12%) Query: 35 PANEP--WTTGIFGCTEDTESCWTGLFCPCVLFGRNIESLREDTPWTTPCICHAI--CVE 90 P++ P W++GI C +D +SC GLFCP LFG+N E L T +T C+ H I Sbjct: 37 PSDGPVQWSSGICACFDDMQSCCIGLFCPWYLFGKNAEFLGSGT-FTGSCLTHFITWAFV 95 Query: 91 GGIALAIGTGVFHGIDPRTSFLICEGLLFAWWMCGIYTGLVRQSLQKKYHLQNSPCDPCM 150 + + G+ G+ G + + CG R++L+ KY+L +PC + Sbjct: 96 NTVCCLLTDGILLGL---------PGCFVSCYACG-----YRRTLRTKYNLPEAPCGDFV 141 Query: 151 VHCCMHWCALCQEHREMKGRLSED--LVMPMTIVNPPPVQEMNS 192 H H CA+CQE+RE++ R S+ + + +V PP Q M S Sbjct: 142 THFFCHLCAICQEYREIRERSSDANPPDLSLAVVTVPPTQTMES 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13327 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10163 83 4e-18 >Cs10163 Length = 156 Score = 82.8 bits (203), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 42/118 (35%), Positives = 68/118 (57%) Query: 140 FAKWVEKATAPAIGSSLKLYEVVQSLGFKTFLLTGRSENQRSVTVENLINAGFQNWDKLI 199 + + +E+A +LKL+ +Q G+ LL+ + E QR+ T E LI+AG++ W LI Sbjct: 26 YIECIEEAKHLKHMFTLKLFMKLQVRGWPVILLSRKHEGQRNATTELLISAGYRGWSSLI 85 Query: 200 LRGSNDHGKQATVYKSEKRSEMVKEGYRIVGNSGDQWSDLLGSEMSLRSFKLPNPMYY 257 +R N+ + Y S +R+ + KEG+ I G +Q L+G + R FK+PNP+YY Sbjct: 86 MRLDNEMQMDSREYLSRRRAILQKEGFHITGLISNQMDALIGQSLGKRVFKIPNPLYY 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46771 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17532 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15181 (239 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73710 132 3e-33 >Cs73710 Length = 84 Score = 132 bits (333), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 59/75 (78%), Positives = 70/75 (93%) Query: 158 LFRPFIGFKEIRVVHKEPRHSGDKAMVLCFVEFNDASCSRTALEALQGYKFDDKKPDSPT 217 LFRPF+G++EIRV+HKEPR +GD+AMVLCFVEF+D C+RTA++AL GYKFDDKKPDSPT Sbjct: 2 LFRPFVGYREIRVIHKEPRRTGDRAMVLCFVEFDDPKCARTAMDALYGYKFDDKKPDSPT 61 Query: 218 LRIQFAHFPFRLPSD 232 L+IQFAHFPF LPSD Sbjct: 62 LKIQFAHFPFHLPSD 76 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43278 (281 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52403 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs29412 142 4e-36 >Cs29412 Length = 180 Score = 142 bits (357), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 71/119 (59%), Positives = 85/119 (71%) Query: 78 GTSSVEGVVTLSQEDDGPTTVSVRITGLTPGNHGFHLHEFGDTTNGCMSTGAHFNPNGMT 137 G +SV+G + Q +G T V +ITGL PG HGFH+H GDTTNGC STG HFNP Sbjct: 18 GATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKD 77 Query: 138 HGAPEDDVRHAGDLGNIVANAEGVAEATIVDTQIPLSGPNAVIGRALVVHELEDDLGKG 196 HGAP D+ RH GDLGNIVA +GVAE +I D IPLSG ++++GRA+VVH DDLGKG Sbjct: 78 HGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHADPDDLGKG 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3410 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs85196 297 4e-83 >Cs85196 Length = 149 Score = 297 bits (761), Expect = 4e-83, Method: Compositional matrix adjust. Identities = 147/149 (98%), Positives = 147/149 (98%) Query: 1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG 60 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG Sbjct: 1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG 60 Query: 61 NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120 NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE Sbjct: 61 NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120 Query: 121 EVDEMIREADVDGDGQINYEEFVKVMMAK 149 EVDEM READVDGDG INYEEFVKVMMAK Sbjct: 121 EVDEMXREADVDGDGXINYEEFVKVMMAK 149 Score = 66.2 bits (160), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 38/88 (43%), Positives = 55/88 (62%), Gaps = 1/88 (1%) Query: 73 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVD 132 MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ T+ E+ +MI E D D Sbjct: 1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Query: 133 GDGQINYEEFVKVMMAKRRKMRVEEKSK 160 G+G I++ EF+ +M K + EE+ K Sbjct: 60 GNGTIDFPEFLNLMARKMKDTDSEEELK 87 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32048 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10640 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7724 362 e-102 >Cs7724 Length = 276 Score = 362 bits (930), Expect = e-102, Method: Compositional matrix adjust. Identities = 176/279 (63%), Positives = 216/279 (77%), Gaps = 8/279 (2%) Query: 1 MSLSIDSSSQVLENGYEHAELLSGNNDEHEGVMVNMEKPMDSKVFLTALRASISLWRKQG 60 MS S++SSS + + L+G ND + GV+V M +PMD ++F + L++SIS WR+Q Sbjct: 1 MSASVNSSSATVN------KFLNGINDNYGGVVVQMNEPMDPQLFASLLKSSISHWRQQA 54 Query: 61 KRGVWIKLPIGLANLIETAVKEGFHYHHAEPDYLMLVHWISESTTSTIPANATHRVGIGA 120 K+GVWIKLPI LANL+E AVKEGF +HHAEP+YLMLV+WI +T+PANA+HRVG+GA Sbjct: 55 KKGVWIKLPIELANLVEPAVKEGFWFHHAEPNYLMLVYWIP-GGANTLPANASHRVGVGA 113 Query: 121 IVMNDQRELLVVQEKSGKLKGTGIWKIPTGVVDAGEDIFKAAVREVKEETNIDTEFVEIL 180 VMN +RE+LVVQE SG+ +GTGIWK PTGVVD GEDI AAVREVKEET+IDTEFVE+L Sbjct: 114 FVMNGKREVLVVQENSGRFRGTGIWKFPTGVVDEGEDICVAAVREVKEETSIDTEFVEVL 173 Query: 181 GFRQTHKSFFEKSDLFFLCMMRPLSFDVQKQELEIDAAKWMPFEEYTAQQIVEKPGFYKC 240 FRQ+H+SFFEKSD+FFLCM+RPLSFD+QKQE EI+AA+WMP EEY AQ V+ K Sbjct: 174 AFRQSHQSFFEKSDIFFLCMLRPLSFDIQKQESEIEAAEWMPLEEYAAQPYVQNQELLKY 233 Query: 241 ITDICLAKVDG-DYIGFSPRLVKSSFTDQLSYFYLNEQD 278 I DIC AKVD Y GFSP S+F+D+ YFYLN D Sbjct: 234 IVDICSAKVDTRGYHGFSPVPTTSAFSDKKHYFYLNSVD 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33277 (254 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56385 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs810 82 5e-18 >Cs810 Length = 224 Score = 81.6 bits (200), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 52/170 (30%), Positives = 79/170 (46%), Gaps = 26/170 (15%) Query: 2 DLYKFRYIRLIVAESLRLYPQPPLLIRRSLKSDSLPGGYKGKKDGHSIPAGTDIFLSVYN 61 D+ +Y+R IV E+LR+YP P+ R D GGY +P GT + ++++ Sbjct: 64 DMKNLKYLRAIVKETLRIYPPGPVTGIREAMEDCEIGGYH-------VPKGTRLIVNIWK 116 Query: 62 LHRSPYFWDRPHEFEPERFLVPRNSDIEGWSGFDPSRSPGALYPNEIVADFAFLPFGGGP 121 LHR P W+ P EF PERFL ++D++ + F ++PF G Sbjct: 117 LHRDPRMWENPCEFRPERFLTT-HADVDVNT-----------------QHFEYIPFSFGR 158 Query: 122 RKCVGDQFALMESTIALTMLLQKFDVELKGG-PESVELVTGATIHTKNGL 170 R C G L + L +LQ FD+ GG P +++ G + N L Sbjct: 159 RSCPGMTSGLQIVQLTLARILQGFDLATVGGTPVGMQIGLGLALPKSNPL 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25666263 (139 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16336 (400 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66175 94 3e-21 >Cs66175 Length = 260 Score = 93.6 bits (231), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 76/241 (31%), Positives = 113/241 (46%), Gaps = 61/241 (25%) Query: 102 ECPKFGMTSVRGRRRDMEDAVSIHPSFWGQDAQNCTGLHYYGVYDGHGCSHVAMKCKDRM 161 E ++G++S++G R MEDA + +P D + T ++GVYDGHG VA C + Sbjct: 20 ENVRYGLSSMQGWRATMEDAHAAYP-----DLDSSTS--FFGVYDGHGGKAVAKFCAKYL 72 Query: 162 HE---------------------IAKEEIERCGQSWEQV------MERSFSRMDKEVV-- 192 H+ + +E+ R + W ++ M++ FS M + + Sbjct: 73 HQQVLKHEAYSAGDLVTSAQKAFLRMDEMMRGQRGWRELAILGDKMDK-FSGMIEGFIWS 131 Query: 193 -----------EWCNGQWSSNCRCE------LRTPQCD----AVGSTAVVAIVTPEKVVV 231 +W + ++ + L P D GSTA VAI+ +++VV Sbjct: 132 PKGGEANDHFDDWTSEEYKQHGFLRYLINRLLIGPHSDFHGPTSGSTACVAIIRDKQLVV 191 Query: 232 SNCGDSRAVLCRNGVAIPLSSDHKPDRPDELLRIQAAGGRVIYWDVPRVLGVLAMSRAIG 291 +N GDSR VL R G A+ LS DHKPD E RI AGG + V RV G L ++RAIG Sbjct: 192 ANAGDSRCVLSRKGQALNLSKDHKPDLEVEKDRILKAGGFI---QVGRVNGSLNLARAIG 248 Query: 292 D 292 D Sbjct: 249 D 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46390 (287 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54022 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14573 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26683 (361 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv966263 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs2330 240 1e-65 >Cs2330 Length = 152 Score = 240 bits (613), Expect = 1e-65, Method: Compositional matrix adjust. Identities = 111/124 (89%), Positives = 120/124 (96%) Query: 120 MKKNDDSLYWQNVQLYTFGAIFNMARLILDDYRSGFEKGPWWHRLFNGYSVTTWMVVLNL 179 MKKN+DSLYWQNVQLYTFGAIFNM RL+LDD+R GFEKGPWW RLF+GY++TTWMVV NL Sbjct: 1 MKKNNDSLYWQNVQLYTFGAIFNMFRLLLDDFRGGFEKGPWWQRLFDGYNITTWMVVFNL 60 Query: 180 GSTGLLVSWLMKYADNIVKVYSTSMAMLLTMVLSVFLFNFKPTLQLFLGIVICMMSLHMY 239 GSTGLLVSWLMKYADNI+KVYSTSMAMLLTMVLSV+LFNFKPTLQLFLGI+ICMMSLHMY Sbjct: 61 GSTGLLVSWLMKYADNIIKVYSTSMAMLLTMVLSVYLFNFKPTLQLFLGIIICMMSLHMY 120 Query: 240 FAPP 243 FAPP Sbjct: 121 FAPP 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47838 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9548 (91 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51475 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1146 (60 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3066260 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33091 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs56622 73 6e-16 >Cs56622 Length = 79 Score = 73.2 bits (178), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Query: 27 MYRD-KSFSEGSTTTETIIAGVAPVKTHFEGAEMGVGAENGCKCGANCQCDPCTC 80 MY D +SF + TET++ GVAPVK H EG+EMG GAE GCKCG NC+C+PC C Sbjct: 25 MYPDLRSFESTTVATETLVLGVAPVKMHSEGSEMGFGAEGGCKCGPNCKCNPCNC 79 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17978 (673 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57824 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36934 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8066264 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17705 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3610 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35614 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51521 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24500 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16664 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35865 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12246 251 4e-69 >Cs12246 Length = 153 Score = 251 bits (641), Expect = 4e-69, Method: Compositional matrix adjust. Identities = 113/137 (82%), Positives = 128/137 (93%) Query: 25 SKWPPWLRPLLQTSFFVQCKLHADSHRSECNMYCLDCMNGALCSLCLNFHKDHRAIQIRR 84 ++WPPWL+PLL+ SFFVQCKLH DSH+SECNMYCLDCMNGA CSLCL++HKDHRAIQIRR Sbjct: 8 NRWPPWLKPLLRESFFVQCKLHPDSHKSECNMYCLDCMNGAFCSLCLDYHKDHRAIQIRR 67 Query: 85 SSYHDVIRVSEIQKFLDITGVQTYIINSARIVFLNERPQPRPGKGVTNTCQVCERSLLDS 144 SSYHDVIRVSEIQK LDI+GVQTY+INSAR+VFLNERPQPRPGKGVTNTC+VC+RSLLDS Sbjct: 68 SSYHDVIRVSEIQKVLDISGVQTYVINSARVVFLNERPQPRPGKGVTNTCEVCDRSLLDS 127 Query: 145 FTFCSLGCKIVGTSKSF 161 F FCSLGCK+ + +F Sbjct: 128 FRFCSLGCKVTLITTNF 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31250 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39436 (356 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93799 82 9e-18 >Cs93799 Length = 160 Score = 82.0 bits (201), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 54/165 (32%), Positives = 87/165 (52%), Gaps = 10/165 (6%) Query: 184 VSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPS---LITALSPITGNEAHYS 240 +SKTLAE+AAW++A++N D + I P +GPF + S L L + HY Sbjct: 1 MSKTLAEKAAWEFAEKNGTDVVAIHPATSLGPFPQPYVNASGAVLQRLLQGSKDTQEHYW 60 Query: 241 IIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFK 300 + VH+ D+ A + LFE A GRY+C++ + A+ + + +PEY I FK Sbjct: 61 L----GAVHVKDVAKAQVLLFETSAASGRYLCTNGIYQFAEFAEKVSKLFPEYPI-HRFK 115 Query: 301 GVDENLKSVC-FSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLL 344 G + C ++K+L LG +F +E+ AV++ +A+G L Sbjct: 116 GETQPGLVACENAAKRLISLGLDFT-PVEETIREAVESLKAQGHL 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21069 (278 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27617 131 8e-33 >Cs27617 Length = 249 Score = 131 bits (330), Expect = 8e-33, Method: Compositional matrix adjust. Identities = 69/171 (40%), Positives = 95/171 (55%), Gaps = 2/171 (1%) Query: 6 YDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSE--LSSHQKKI 63 YD VTT+SP GR+FQ+EYA +AV IG++ K +V+ S+ L ++I Sbjct: 8 YDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDGIVMGVEKLIASKMMLPGSNRRI 67 Query: 64 FKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESPLPVGRLVVQLADKAQVCTQRS 123 V H G+A+AGL ADGR + +SE NY Y P+PV L ++A +CT Sbjct: 68 HSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYW 127 Query: 124 WKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER 174 W RP+G G+++ G D G LY PSG + Y AIG QAAKT +E+ Sbjct: 128 WLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEK 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv345 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs6371 84 8e-19 >Cs6371 Length = 189 Score = 84.3 bits (207), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 49/140 (35%), Positives = 71/140 (50%), Gaps = 21/140 (15%) Query: 48 APLQPKVKAPRVP------WSSGLCDCFSDPRNCCITCWCPCITFGQIAEIVDKGS--SA 99 P + + PR P WSSG+C CF D ++CCI +CP FG+ AE + G+ + Sbjct: 25 VPQKEDLSDPRHPSDGPVQWSSGICACFDDMQSCCIGLFCPWYLFGKNAEFLGSGTFTGS 84 Query: 100 CGVNGALYTLIACV------------TGC-ACCYSCFYRAKMRQQYLLKPSPCGDCLVHC 146 C + + + V GC CY+C YR +R +Y L +PCGD + H Sbjct: 85 CLTHFITWAFVNTVCCLLTDGILLGLPGCFVSCYACGYRRTLRTKYNLPEAPCGDFVTHF 144 Query: 147 CCEYCSLCQEYRELKNRGFD 166 C C++CQEYRE++ R D Sbjct: 145 FCHLCAICQEYREIRERSSD 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39452 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36906 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 67 2e-13 >Cs36939 Length = 275 Score = 67.0 bits (162), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 26/40 (65%), Positives = 34/40 (85%) Query: 76 LIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLRRKL 115 +II L ALLGNRW+ IA LP RTDN++KNYWN+HL++K+ Sbjct: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKV 40 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39143 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2866 (318 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs79560 510 e-147 >Cs79560 Length = 319 Score = 510 bits (1314), Expect = e-147, Method: Compositional matrix adjust. Identities = 242/319 (75%), Positives = 268/319 (84%), Gaps = 1/319 (0%) Query: 1 MEAFPVINMEMLNGEERGATMEMIKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKC 60 ME FPVI++E +NG ER A +E I +ACENWGFFELVNHGI E MD VE+LTK HYRKC Sbjct: 1 MENFPVISLENINGAERAAILEKINEACENWGFFELVNHGIEPEFMDTVERLTKAHYRKC 60 Query: 61 MEQRFKELVAAKALEGVQTEIKDMDWESTFFLRHLPVSNVSDFPDLDEEYRKVMKDFAXX 120 MEQRFKELVA++ALEG+QTE+ DMDWESTF++RHLP S +++ PDLDEEYRKVMK+FA Sbjct: 61 MEQRFKELVASRALEGIQTEVNDMDWESTFYVRHLPQSTINEVPDLDEEYRKVMKEFALK 120 Query: 121 XXXXXXXXXXXXXXXXXXXXGYLKKAFHGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDA 180 GYLKK FHG+ GP FGTKVSNYPPCPKPDLIKGLRAHTDA Sbjct: 121 LEKLAEELLDLLCENLGLEKGYLKKVFHGANGPTFGTKVSNYPPCPKPDLIKGLRAHTDA 180 Query: 181 GGIILLFQDDTVSGLQLLKDGQWVDVPPMRHSIVVNLGDQLEVITNGKYKSVLHRVVAQT 240 GGIILLFQDD VSGLQLLKDGQW+DVPP+RHSIVVNLGDQ+EVITNGKYKSV HRVV+QT Sbjct: 181 GGIILLFQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVVSQT 240 Query: 241 DG-NRMSIASFYNPGNDAVIYPAPALLEKEAENDQVYPKFVFDDYMKLYSGLKFQAKEPR 299 DG RMS+ASFYNPG+DAVIYPAPALLEKEAE QVYPKFVF+DYMKLY LKFQAKEPR Sbjct: 241 DGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKKQVYPKFVFEDYMKLYVPLKFQAKEPR 300 Query: 300 FEAMKNVEASVNMGPIATA 318 FEAMK VE +VN+GPIATA Sbjct: 301 FEAMKAVETNVNLGPIATA 319 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21962 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666258 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24178 170 6e-45 >Cs24178 Length = 138 Score = 170 bits (431), Expect = 6e-45, Method: Compositional matrix adjust. Identities = 88/136 (64%), Positives = 100/136 (73%), Gaps = 4/136 (2%) Query: 4 NIGDDAEGQRNSLELTKSISDKHLDLLRPSSRYYSIFKGQAVDAVEREKGKYTLLRDVED 63 NIG+ EG + LEL KS+SDKHLDLLRPS+RY SI K A D +REKG+YTL+RD ED Sbjct: 6 NIGE-TEGLKTGLELVKSVSDKHLDLLRPSARY-SISK--APDTADREKGRYTLIRDPED 61 Query: 64 FQVGIYDKPLPCFGCGIGWFSFLLGFLCPLMWYYATILYFGNCYRKDPRERXXXXXXXXX 123 FQ GIYDKPLPCFGCG+GWFSFLLGF+ PLMWYY T LYFGN RKDPRER Sbjct: 62 FQFGIYDKPLPCFGCGVGWFSFLLGFVFPLMWYYGTFLYFGNHCRKDPRERAGLAASAIA 121 Query: 124 XXXXXXVLLIILAFRL 139 V+L+I+ FRL Sbjct: 122 AMACSVVMLVIVVFRL 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4613 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs56038 186 2e-49 >Cs56038 Length = 183 Score = 186 bits (471), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 107/180 (59%), Positives = 130/180 (72%), Gaps = 7/180 (3%) Query: 1 MVSSLLSPL--SDTVLHSSPPKITVSEKPTIPQKKTQLGFTKKPSWTSPLLQKSI----- 53 MVSS SPL ++ + +P + K T + S +S Q+ I Sbjct: 1 MVSSSFSPLLSANFTVCGNPNNLHAIIPSGCNNKHTHFSESSLSSSSSLSFQRVIHKAVV 60 Query: 54 PLAASVAILLWSNPANAGFLSGFSGIESVPGPELPQVDFLNKFNEENQKKYAEFDERFKS 113 PLAASV +LL PA AGFLSGFSGIESVPGPELPQ++FLN+FNEENQKKYAEFD RFK Sbjct: 61 PLAASVTVLLSPVPAKAGFLSGFSGIESVPGPELPQIEFLNRFNEENQKKYAEFDARFKE 120 Query: 114 SPLLKELLERSKLNQEKNRKEIQDKYCIRGAEWGVGDCSVEGMSPADKDNFIATLKQKLG 173 SPLLK+LLE+SK N+EKNR+EI++KYC+RGAEWGVGDCS EGMSP +++NFI+ LKQK G Sbjct: 121 SPLLKKLLEKSKENKEKNRQEIENKYCLRGAEWGVGDCSAEGMSPEERENFISMLKQKAG 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4074 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13570 (277 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8475 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4344 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48246 (109 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6654 (311 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52540 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65961 93 3e-21 >Cs65961 Length = 210 Score = 92.8 bits (229), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 66/199 (33%), Positives = 100/199 (50%), Gaps = 14/199 (7%) Query: 4 PNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIR 63 +QQ DY FKL+++GD G GK++ + + FE+ PTIGV+ K++ Sbjct: 6 ASQQEFDYL-FKLLMIGDSGVGKSSLLLSFTSDNFEE-LSPTIGVDFKVKYVDVGGKKLK 63 Query: 64 FYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVP-TWHR--DLCRVCENIPI 120 WDTAGQE+F L YY Q I+++DVT R T+ N+ W + DL ++ Sbjct: 64 LAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIK 123 Query: 121 VLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLH 178 +L GNKVD ++ +V K+ + F R+ + E SAK+ N ++ F L K+ +L Sbjct: 124 LLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLL 183 Query: 179 FVESPAL-------APPEV 190 S L PPE Sbjct: 184 AEGSKGLKKNIFKQKPPEA 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13242 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs173106183 231 4e-63 >Cs173106183 Length = 286 Score = 231 bits (590), Expect = 4e-63, Method: Compositional matrix adjust. Identities = 112/167 (67%), Positives = 131/167 (78%), Gaps = 9/167 (5%) Query: 19 FRFYPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRD 78 FRF+PTDEEL+VHYL+ +A+S P PV+II EVD+YKFDPW+LP KA FGE+EWYFFSPRD Sbjct: 13 FRFHPTDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEFGEKEWYFFSPRD 72 Query: 79 RKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMH 138 RKYPNG RPNRA SGYWKATGTDK + GG++ +GVKKALVFY G+PPKGIKT+WIMH Sbjct: 73 RKYPNGTRPNRATVSGYWKATGTDKAIY--GGSKYLGVKKALVFYKGRPPKGIKTDWIMH 130 Query: 139 EYRLADNKVNTKPPGCDMGNKKNSLRLDDWVLCRIYXKNTRIERWIL 185 EYRL D T+ P G S++LDDWVLCRIY K R +L Sbjct: 131 EYRLND---PTRQPYKHNG----SMKLDDWVLCRIYKKRQTGSRSVL 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53586 (298 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16598 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60416 (266 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28799 (443 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22451 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61348 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43883 (313 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5881 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19291 (79 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25162 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27770 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25266258 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30774 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38247 (359 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54021 311 6e-87 >Cs54021 Length = 255 Score = 311 bits (797), Expect = 6e-87, Method: Compositional matrix adjust. Identities = 145/254 (57%), Positives = 186/254 (73%) Query: 1 MVKSPEEEHPQKAFGWAARDPSGTLSPFHFSRRENGDEDVTVKILYCGVCHSDLHSVKNE 60 M ++PE+EHP+ AFGWAA+D SG LSPFHFSRR G++DVT K+ +CG+CHSDLH +KNE Sbjct: 1 MGQAPEQEHPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNE 60 Query: 61 WGFTRYPIVPGHEIVGIVIQLGNNVKKFKMGDRVGVGVLVGSCKTCETCQQDLENYCPSM 120 WG T YPIVPGHEIVG+V ++G+ V KFK+GD+VGVG +VGSC +C++C DLENYCP + Sbjct: 61 WGNTIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCHSCDSCAIDLENYCPKV 120 Query: 121 IFTYNSTSQDGTRTYGGYSDIVVVDQRYVLRIPDNMPLDAGAPLLCAGITVYSPMKYYGM 180 I TY + DGT TYGGYSDI+V D+ +V+RIP+ PLDA APLLCAGITVYSP+++YG+ Sbjct: 121 IMTYANKYHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGL 180 Query: 181 TEPXXXXXXXXXXXXXXXXXXXXXAFGLKVTVISTSPNKEDEAINKLGADCFLVSTNPEK 240 +P +G P+K+ EAI +LGA+ FLVS + + Sbjct: 181 DKPGMHVGCXRLGRSRPCRPSIRKGYGGSGDCDQYPPSKKSEAIERLGAEFFLVSRDQNE 240 Query: 241 VQAALGTMDYIIDT 254 +QAALGTMD IIDT Sbjct: 241 MQAALGTMDGIIDT 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49187 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61685 (73 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs136106187 64 4e-13 >Cs136106187 Length = 131 Score = 63.9 bits (154), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 28/33 (84%), Positives = 32/33 (96%) Query: 3 LLEKLWDDVVAGPQPDRGLGKLRKLTTKPLSVK 35 +LEKLWDDVVAGPQPDRGLG+LRK+TT PL+VK Sbjct: 1 MLEKLWDDVVAGPQPDRGLGRLRKITTTPLAVK 33 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19425 (280 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27366265 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80225 189 2e-50 >Cs80225 Length = 192 Score = 189 bits (480), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 107/205 (52%), Positives = 134/205 (65%), Gaps = 22/205 (10%) Query: 1 MAMATTVQSTVA-------TAMTRV-ANRTRDLQVVPPRSVLRLQRSAVQVRCTKEDGQS 52 MA + QS +A T +TR AN+ ++ +P LR + + VRCT ED Q Sbjct: 1 MAASLATQSMLASPVAARVTGITRSGANQLSSVKYLP---SLR-KNVNLSVRCTAEDEQH 56 Query: 53 ERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVSTKFGDVFAFSGPAPERINGRLAMVGF 112 ++ ++ST F DVFAFSGPAPERINGRLAM+GF Sbjct: 57 QQQKDDQPTIPKAEPQPPKKP----------RMSTGFSDVFAFSGPAPERINGRLAMIGF 106 Query: 113 VAAMGAEIWKGEDVFAQISNGGIPWFLGTAVVLSLASLIPLFKGVSVESKSEGLMTSDAE 172 VAA+G EI KG+DVFAQ+S GG WFLGT+V+L++ASL+PLFKGVSVESKS+G MTSDAE Sbjct: 107 VAALGVEISKGQDVFAQLSYGGDAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAE 166 Query: 173 MWNGRFAMLGLVALAFTEYLKGGAL 197 +WNGRF ML LVALAFT+++KGG L Sbjct: 167 LWNGRFDMLDLVALAFTDFVKGGTL 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27702 (449 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs34689 487 e-139 >Cs34689 Length = 264 Score = 487 bits (1253), Expect = e-139, Method: Compositional matrix adjust. Identities = 227/254 (89%), Positives = 237/254 (93%) Query: 177 VSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXXXXXX 236 VST+VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNR Sbjct: 1 VSTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 60 Query: 237 XXXXXXRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVF 296 RFDGA+NVD+TEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ F Sbjct: 61 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAF 120 Query: 297 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGIN 356 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVA IKTKRT+QFVDWCPTGFKCGIN Sbjct: 121 EPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAAIKTKRTIQFVDWCPTGFKCGIN 180 Query: 357 YQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEG 416 YQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRID KFDLMY+KRAFVHWYVGEGMEEG Sbjct: 181 YQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEG 240 Query: 417 EFSEAREDLAALEK 430 EFSEAREDLAALEK Sbjct: 241 EFSEAREDLAALEK 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57944 (398 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31386 (341 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8066257 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7970 200 1e-53 >Cs7970 Length = 119 Score = 200 bits (509), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 93/112 (83%), Positives = 105/112 (93%) Query: 130 MKGDYHRYLAEFKTGPGRKEAAESTLLAYKSAQDIALAELAPTHPIRLGLALNFSVFYYE 189 MKGDY+RYLAEFK G RK AAE+T+L+YK+AQDIAL +LAPTHPIRLGLALNFSVFYYE Sbjct: 1 MKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYE 60 Query: 190 ILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDI 241 ILNS ++AC +AKQAF+EAI+ELDTLGEESYKDSTLIMQLLRDNLTLWTSD+ Sbjct: 61 ILNSSEKACTMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM 112 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24047 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14066262 (475 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12480 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2709 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65961 97 1e-22 >Cs65961 Length = 210 Score = 97.4 bits (241), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 67/199 (33%), Positives = 101/199 (50%), Gaps = 14/199 (7%) Query: 4 PNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIR 63 +QQ DY FKL+++GD G GK++ + + FE+ PTIGV+ K++ Sbjct: 6 ASQQEFDYL-FKLLMIGDSGVGKSSLLLSFTSDNFEE-LSPTIGVDFKVKYVDVGGKKLK 63 Query: 64 FYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVP-TWHR--DLCRVCENIPI 120 WDTAGQE+F L YY Q I+++DVT R T+ N+ W + DL ++ Sbjct: 64 LAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIK 123 Query: 121 VLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLH 178 +L GNKVD ++ +V K+ + F R+ + E SAK+ N ++ F L K+ P+L Sbjct: 124 LLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLL 183 Query: 179 FVESPAL-------APPEV 190 S L PPE Sbjct: 184 AEGSKGLKKNIFKQKPPEA 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2810 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36587 306 1e-85 >Cs36587 Length = 202 Score = 306 bits (785), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 149/203 (73%), Positives = 172/203 (84%), Gaps = 1/203 (0%) Query: 33 LATPFPIEKAPTRKITTAGNGVKIFELLKYPVRGLVFEGGDTLQDLANTVADSCICLQDN 92 +A PFPIEKAPT+KI + G+GVKI ELL YPVRGLVFEGG++L+DL+NTV+D+CICLQ+N Sbjct: 1 MALPFPIEKAPTKKIISTGSGVKISELLNYPVRGLVFEGGNSLEDLSNTVSDACICLQEN 60 Query: 93 NIPFNVLIADAGKRIFLFAQCYAEKQALGEVNQELLDTQVNPAVWEVSGHIVLKRKEDYE 152 NIP+NVLIAD GKRIFL QCYAEKQALGEV+ ELLDTQVNPAVWE+SGH+VLKRK+DYE Sbjct: 61 NIPYNVLIADCGKRIFLLPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYE 120 Query: 153 GASEQNAWRLLAEVSLSEERFQEVNALIFEAIACGDDEKGNLTEDMIEEPDVTPPSHEDA 212 ASE+NAWRLLAEVSLSEER+QEVNALIFEAIA GDD G + E +I E D P S + Sbjct: 121 EASEENAWRLLAEVSLSEERYQEVNALIFEAIARGDDANGGVAESVIGEADAKPKSGGEV 180 Query: 213 GAINNSSYPAAMVAGKQECLVQQ 235 AIN +S P AMV+G ECLV Q Sbjct: 181 DAINKNSCP-AMVSGTPECLVLQ 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34343 (364 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20639 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27166265 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59577 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs34148 119 3e-29 >Cs34148 Length = 97 Score = 119 bits (297), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 55/61 (90%), Positives = 58/61 (95%) Query: 97 MLDHRAALLRPFSETKTLGLWDVNCTVKGGGLSGQVGAIRLGISRALQNWEPGLRPQLRE 156 MLDHRAALLRPFSETKTLGLWDV+CTVKGGG+SGQVGAIRLGISRALQNWEP LRP LR Sbjct: 1 MLDHRAALLRPFSETKTLGLWDVDCTVKGGGVSGQVGAIRLGISRALQNWEPDLRPALRS 60 Query: 157 A 157 + Sbjct: 61 S 61 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18266257 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3156 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 145 2e-37 >Cs169106187 Length = 148 Score = 145 bits (366), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 67/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%) Query: 5 ARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEEYP 64 A KR++++ K LQ+DPP S P ++ W A I GP D+P+ GG F +T+ F +YP Sbjct: 2 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYP 61 Query: 65 NKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANS 124 KPP V F +++FHPNI ++GSICLDIL+ QWSP ++ +L SI SLL DPNP+ P Sbjct: 62 FKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVP 121 Query: 125 EAARMFSENKREYNRRVREIVEQSWT 150 E A M+ +K +Y R SWT Sbjct: 122 EIAHMYKSDKAKYESTAR-----SWT 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24641 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19385 (57 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32731 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv464 (382 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44201 418 e-119 >Cs44201 Length = 378 Score = 418 bits (1074), Expect = e-119, Method: Compositional matrix adjust. Identities = 227/378 (60%), Positives = 263/378 (69%), Gaps = 12/378 (3%) Query: 6 MEESNKSECHLTSAAAFVEGGIQEACDDACSICLEAFCDSDPSTVTSCKHEFHLQCILEW 65 MEE+ + + LTS AAFVEGGIQ+ACDDACSICLE F DSDPST+TSC+HEFHLQC+LEW Sbjct: 1 MEENKQCDARLTSPAAFVEGGIQDACDDACSICLEPFSDSDPSTLTSCRHEFHLQCVLEW 60 Query: 66 CQRSSQCPMCWQPISLKDPTSQELLEAVERERTFRFNPSRNATIFHHPTLGDFELQHLPV 125 CQRSSQCPMCWQPISLKDPTSQELLEAVE+ER NPSRN TIFHHP LGDFELQ LPV Sbjct: 61 CQRSSQCPMCWQPISLKDPTSQELLEAVEQERRASVNPSRNTTIFHHPALGDFELQGLPV 120 Query: 126 GANDAELEERIIQHLXXXXXXXXXXXXXXXEGQRTRSAAQGRPQFLVFSAHPSTPQAGPA 185 GA DAELEERIIQHL E QR RS+AQ RPQF VFS HP+T A P Sbjct: 121 GATDAELEERIIQHLAAAAAMGRARHIGRRESQRNRSSAQARPQFFVFSTHPNTSTADPV 180 Query: 186 SSSPAQR-GEDEPAPAITAAMPSSLPTAVGXXXXXXXXXXXXXXAEEITASASGSIIHTT 244 SSSP QR GE P + + A G + ++ASASGS + Sbjct: 181 SSSPTQREGEPTPTVTVPTPSSPA---AAG-------EESPEQSTQLLSASASGSSALAS 230 Query: 245 NQHGTSSNNRRSPGQSLPSGQDKAGPSEFQSFSESLKSRFNAVSMRYKESISKSTRGWKE 304 +QH ++ NNRRSP Q P+ QD+AGPS+FQSFSESLKSRFNAVSMRYKESISKSTRGWKE Sbjct: 231 SQHESTLNNRRSPNQPSPNSQDRAGPSDFQSFSESLKSRFNAVSMRYKESISKSTRGWKE 290 Query: 305 RLFSRNTSMADIGSDVKRKVNAGIATVSRMMEHLETRDNXXXXXXXXXXXXXXXXXXXLG 364 R FSR + +D+GS+V+R+ +AGI VS MME LETRDN Sbjct: 291 RFFSRYNTTSDLGSEVRREDDAGIERVSGMMERLETRDNNSSSTASVSNSPNNSVPES-N 349 Query: 365 DQRMAETSAHNPLGDTNV 382 +Q+++ET+ +NP+ DTN Sbjct: 350 NQQISETAHNNPMNDTNA 367 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59553 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9025 (428 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64873 94 2e-21 >Cs64873 Length = 170 Score = 94.4 bits (233), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 46/142 (32%), Positives = 81/142 (57%), Gaps = 8/142 (5%) Query: 290 NQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMPQEERLTRYKGFKEGHKRILVATDLV 349 Q +IFV++ + A+ L+K L + + I QEER K FK+G ++L++TD++ Sbjct: 15 GQTIIFVRTKNSASALHKALKDFGYEVTTIMGATIQEERDKIVKEFKDGLTQVLISTDVL 74 Query: 350 GRGIDIERVNIVINYDMP--------DSADTYLHRVGRAGRFGTKGLAITFVSSASDSDV 401 RG D ++VN+++NYD P + YLHR+GRAGRFG KG+ + D + Sbjct: 75 ARGFDQQQVNLIVNYDPPVKHGKHLEPDCEVYLHRIGRAGRFGRKGVVFNLLMDGDDMII 134 Query: 402 LNQVQERFEVDIKELPEQIDTS 423 + +++ F++ + E+ ++ S Sbjct: 135 MEKIERYFDIKVTEVILRVRNS 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66022 (324 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3516 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61830 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30486 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27563 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25025 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55974 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48158 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30821 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40027 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21575 (337 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27480 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33540 92 1e-21 >Cs33540 Length = 185 Score = 92.4 bits (228), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 42/89 (47%), Positives = 61/89 (68%) Query: 1 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY 60 MVGLD +GKTTI+ K+ + PT+GFN++TV Y+ + +WDVGGQ IR WR+Y Sbjct: 21 MVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTVTYQKYTLNIWDVGGQRTIRSYWRNY 80 Query: 61 FQNTQGLIFVVDSNDRDRVVEARDELHKI 89 F+ T GL++VVDS+D R+ + + EL + Sbjct: 81 FEQTDGLVWVVDSSDLRRLDDCKMELDNL 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8676 (391 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56231 (362 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs132106182 105 6e-25 >Cs132106182 Length = 183 Score = 105 bits (263), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 65/167 (38%), Positives = 85/167 (50%), Gaps = 16/167 (9%) Query: 208 DDDEGNPPLLRRMIEDCGELHFMSALHSFTRRVIYSNVGYDHIVGWRTSSIRRNSELPKW 267 D PPLL RM DC + F+SAL +F R++Y+NV YDH+VGWRTSSIRR +EL K Sbjct: 2 DGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKP 61 Query: 268 EDVVNEKYPHIVFEEHC---------------KACDAEQCEPSSXXXXXX-XXXXXXXXX 311 + Y H+V E+C KA +A Q EP++ Sbjct: 62 PRRSLDGYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMIR 121 Query: 312 XXSCVSWEKVDVSFHACRQRFAAHSVIQVKDYVAHREGADVIQHMID 358 + W+KVDVSFH+ F AH+ I VK+ H G VI H+ D Sbjct: 122 GLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVAD 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25966261 (250 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42420 370 e-104 >Cs42420 Length = 250 Score = 370 bits (949), Expect = e-104, Method: Compositional matrix adjust. Identities = 191/250 (76%), Positives = 200/250 (80%) Query: 1 MGKSYPTVSXXXXXXXXXXXXXLRGLIAEKNCAPIMLRIAWHSAGTFDVKTRTGGPFGTM 60 M K+YPTVS LRG IAEKNCAP+MLRIAWHSAGT+DVKT+TGGPFGTM Sbjct: 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60 Query: 61 KKPEELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEVTGGPEIPFHPGRE 120 + E AH ANNGLDIAVRLLEP KEQFP ISYAD YQLAGVV VEVTGGP+IPFHPGR+ Sbjct: 61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120 Query: 121 DKPEPPPEGRLPDATKGCDHLRQVFVTQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT 180 DK EPP EGRLPDA +G DHLRQVF QMGLSDKDIVALSG HTLGRCHKERSGFEGPWT Sbjct: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180 Query: 181 SNPLIFDNSYFXXXXXXXXXXXXXXPSDKALLSDPAFRPLVEKYAADEDAFFEDYKEAHL 240 NPLIFDNSYF PSDKALL DP FRPLVEKYAADEDAFF DY EAHL Sbjct: 181 RNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHL 240 Query: 241 KLSELGFADA 250 KLSELGFA+A Sbjct: 241 KLSELGFAEA 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37379 (504 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15084 167 3e-43 >Cs15084 Length = 178 Score = 167 bits (422), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 86/173 (49%), Positives = 116/173 (67%), Gaps = 6/173 (3%) Query: 331 APLCFNTNLTVKPKKVTPEFDPCSDYYVYAYLNRADVQKALHANVTKLKYDWEPCSD-VI 389 APLC ++ T V P FDPCS+ YV++YLN VQK+LHANVT ++ W+ CSD V+ Sbjct: 11 APLCSSSFST---SSVLP-FDPCSEIYVHSYLNSPQVQKSLHANVTGIRGPWQDCSDTVL 66 Query: 390 QNWTDSPSTIIPLLHEFMENGLRVWVFSGDTDGRVPVTSTMASIDTMKLSVKTPWHPWFV 449 ++W DSP T++P + E M +G+ V+++SGDTDG VP S SI+ + VKT W+P ++ Sbjct: 67 RHWKDSPLTVLPSIQELMTSGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYI 126 Query: 450 AGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLISHFLSGTPLPRRSS 502 GEVGGY Y+ +LTF T+RGAGH VPS +P RAL+ S FL G P S Sbjct: 127 QGEVGGYVVGYQ-NLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPPAAKS 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55708 (453 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs2665 176 5e-46 >Cs2665 Length = 178 Score = 176 bits (445), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 79/97 (81%), Positives = 91/97 (93%) Query: 42 TDRGTLKSPWSRRRRKHALLAKQWKSLFTPDGKFTDGGVKFLKKVRSGGVDPSIRVEVWP 101 + RG+LKSPWSRRRRKHALL KQWK+ FTPDGK ++GGVKFLKKVRSGGVDPSIR EVWP Sbjct: 80 SHRGSLKSPWSRRRRKHALLPKQWKTFFTPDGKLSEGGVKFLKKVRSGGVDPSIRAEVWP 139 Query: 102 FLLGVYDVKSSREERDSIRAQKRKEYENLRKQCRRIL 138 FLLGVYD+KSS+EERDS++A+KRKEYENLRK+CR I+ Sbjct: 140 FLLGVYDLKSSKEERDSVKAEKRKEYENLRKECRIII 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44608 (373 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23856 (418 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30318 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv161 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48016 105 1e-25 >Cs48016 Length = 254 Score = 105 bits (262), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 48/94 (51%), Positives = 69/94 (73%) Query: 1 MIDIHSMQEFLSALSQAGDKLVIVEFYGTWCASCRALFPKLCKTAQDYPNIIFLKVNFDE 60 M ++ S Q+ + +L AGDKLV+V+F+ C C+AL PK+C+ A+ P++ FL+VN++E Sbjct: 65 MREVASAQDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEE 124 Query: 61 NKSMCKSLNVKMLPCFHFYRGSDGLLESFSCSLA 94 +KSMC SLNV +LP F FYRG+ G L SFSC+ A Sbjct: 125 HKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNA 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58658 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23575 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65605 100 1e-23 >Cs65605 Length = 169 Score = 100 bits (248), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 6/140 (4%) Query: 34 MCNKLASRHVRVGLADPSDVPRCDICENAPAFFYCEVDGTSLCLQCDMIVHVGGKRTHGR 93 M NKLAS HVR L PS +CD+C+ AF +CE G +CL CDM+ H+G H R Sbjct: 1 MNNKLASSHVRHDLP-PSSFGKCDLCDREKAFLFCEKGGMCICLTCDMVFHIG----HPR 55 Query: 94 YLLLRQRVEFPGDKPGRLEELRLQSGEPGEARREQNWPPMMTLRETQPNHMASSVPMLEN 153 +L++RQ+++FP + P + + + E +REQN P MT+ E Q NH + + Sbjct: 56 FLVMRQKIQFPVEDPIWGKPISRPLNQ-AEIKREQNDPLEMTIGEDQQNHKVFPTAVADV 114 Query: 154 NTHGDGKMDNKLIDLNARPQ 173 K NK+IDLN +P+ Sbjct: 115 RATSKAKRGNKMIDLNRKPR 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35193 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8116 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8566262 (176 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49777 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42863 113 5e-28 >Cs42863 Length = 115 Score = 113 bits (283), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 57/95 (60%), Positives = 73/95 (76%), Gaps = 1/95 (1%) Query: 2 GGDREIRREKVHPHGTTQNQWLMQPQ-TMEQLMAILAERDAAIQERNLALSEKKAVLAQR 60 GG RE R K + Q QWLM Q +M+Q+M I+AERDAA+QERNLA SEKKA +A+R Sbjct: 4 GGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDAALQERNLATSEKKAAIAER 63 Query: 61 DLAILERDAAIVERDNALLERDNVISTLRYRGNSM 95 D+A L+RD AI ER+NA+LERDN I++L+YR NS+ Sbjct: 64 DMAFLQRDTAIAERNNAILERDNAIASLQYRENSL 98 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21507 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1891 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3623 (481 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15084 135 1e-33 >Cs15084 Length = 178 Score = 135 bits (340), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 80/176 (45%), Positives = 101/176 (57%), Gaps = 6/176 (3%) Query: 307 VGLIDFYNIYAPVCIRSSNSSRKPKRHGGFDPCEADYVLRYLNLPQVQEALHANRTKIPY 366 +G I+ +IYAP+C S ++S FDPC YV YLN PQVQ++LHAN T I Sbjct: 1 MGNINILDIYAPLCSSSFSTSSVLP----FDPCSEIYVHSYLNSPQVQKSLHANVTGIRG 56 Query: 367 AWEVCS-SVITSWTDSPSTMFPIYKRLISSGLHILIYXXXXXXXXXXXXTRYSINALNLK 425 W+ CS +V+ W DSP T+ P + L++SG+ + IY RYSIN L K Sbjct: 57 PWQDCSDTVLRHWKDSPLTVLPSIQELMTSGISVYIYSGDTDGTVPTISIRYSINKLGAK 116 Query: 426 VIRPWHPWSESTKVVGGYRVVYEGLTFATIRGAGHEVPRFQPRRAFALMESFVAGK 481 V W+P +V GGY V Y+ LTF TIRGAGH VP QP RA A SF+ GK Sbjct: 117 VKTAWYPCYIQGEV-GGYVVGYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGK 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6066265 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30299 (117 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56365 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1787 (583 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs61125 293 3e-81 >Cs61125 Length = 240 Score = 293 bits (751), Expect = 3e-81, Method: Compositional matrix adjust. Identities = 154/235 (65%), Positives = 184/235 (78%), Gaps = 2/235 (0%) Query: 155 LAQLMETAYIGRLGPVELASAGVSISIFNIISKLFNIPLLSISTSFVAEDISKNAINNSA 214 +AQLMETAYIGRLGP+ELASAGVS SIFNI+SK+FNIPLLS++TSFVAEDIS+++ +S Sbjct: 1 MAQLMETAYIGRLGPLELASAGVSTSIFNILSKVFNIPLLSVATSFVAEDISRSSSKDST 60 Query: 215 SEEFYQEESTNGTPFVGVTERMQXXXXXXXXXXXXGIGIFEAFALYFGSGWFLNLMGIPS 274 S+ S NG T+R IGI EA A+YFGSG FL++MGI S Sbjct: 61 SDSSCPNVSYNGCD--ESTDRKLLPSVSTALVLALTIGILEALAMYFGSGLFLDIMGISS 118 Query: 275 ASSMHAPARRFLSLRALGAPAVVVSLALQGILRGFKDTKTPVLCLGVGNFAAVFLFPILM 334 ASSM PA+RFLSLRA+GAPAVV+SLA+QGI RGFKDT+TPV CLG+GNF+AVF+FP+LM Sbjct: 119 ASSMRIPAQRFLSLRAIGAPAVVLSLAIQGIFRGFKDTRTPVFCLGLGNFSAVFMFPMLM 178 Query: 335 YYFQLGVTGAAISTVVSQYIVTFLMIWHLNKRAVLLPPKMGTLQFGDYIKSGGFL 389 YYF+LGVTGAAISTV SQY+VT LMIW+LNKR +L P M L FGDY++SG L Sbjct: 179 YYFKLGVTGAAISTVGSQYMVTLLMIWYLNKRTILSIPNMKNLHFGDYLRSGNCL 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30250 (404 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101256 443 e-126 >Cs101256 Length = 284 Score = 443 bits (1140), Expect = e-126, Method: Compositional matrix adjust. Identities = 220/283 (77%), Positives = 238/283 (84%), Gaps = 1/283 (0%) Query: 11 PSLQANGKGFAEFSGLRNSSACLSFNRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKL 70 P ++ +GF+EFSGLRNS A L F RK+SDDF SV+A QTSA+GS+S GYRK +AKL Sbjct: 1 PRVRPRVRGFSEFSGLRNS-ASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKL 59 Query: 71 KVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAV 130 KVAINGFGRIGRNFLRCWHGRKDSPL+V+ +NDTGGVKQASHLLKYDS LG FEADVK V Sbjct: 60 KVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPV 119 Query: 131 GDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKHIQAGAKKVLIT 190 G D ISVDGKVI++VS+RNP++LPWGDL IDLVIEGTGVFVDR+GAGKHIQAGAKKVLIT Sbjct: 120 GTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLIT 179 Query: 191 APGKGDIPTYVVGVNADEYNHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSY 250 APGKGDIPTYVVGVNAD Y DEPIISNASCTTNCLAPFVKVLDQKFGIIKG MTTTHSY Sbjct: 180 APGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGNMTTTHSY 239 Query: 251 TGDQXXXXXXXXXXXXXXXXXXNIVPTSTGAAKAVALVLPTLK 293 TGDQ NIVPTSTGA KAVALVLP LK Sbjct: 240 TGDQRLLDASHRELRRARAAALNIVPTSTGAGKAVALVLPALK 282 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43574 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2868 (513 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3579 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36782 (137 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18425 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54530 165 2e-43 >Cs54530 Length = 247 Score = 165 bits (417), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 82/99 (82%), Positives = 93/99 (93%) Query: 4 IAFGRFDDSFSLASFKAYLAEFHSTILFVFAGVGSVMAYNKLTSDAALDPAGLVAVAVAH 63 IAFGRFDDSFSL SFKAYLAEF ST+LFVFAGVGS +A+NK+T+DAALDP+GLVA+A+ H Sbjct: 3 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICH 62 Query: 64 GFALFVAVAISANISGGHVNPAVTFGLVVGGQITILTGM 102 GFALFVAVA+ ANISGGHVNPAVTFGL +GGQITILTG+ Sbjct: 63 GFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGI 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32211 (76 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5147 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs3081 228 2e-62 >Cs3081 Length = 161 Score = 228 bits (582), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 109/158 (68%), Positives = 131/158 (82%), Gaps = 1/158 (0%) Query: 1 METTERPVLVIGIDDSSHSFYALEWTLDHFF-SSPQTKPFKLVIVYARPPASSVVGFAGP 59 M T E +V+GIDDS S YAL+WTLDHFF +S PFKLVIV+ARP S+V+G AGP Sbjct: 1 MATAETQTMVVGIDDSEQSTYALQWTLDHFFANSTVNPPFKLVIVHARPSPSAVIGLAGP 60 Query: 60 GLPDIIAHVDSDLKKAAARIVDKAKQMCNSKSVEDVTVSVMEGDARSIICDAVNIHHASI 119 G +++ HVDSD KK AAR+V++AK++C+SKSV D V V+EGDAR+I+C+AV HHASI Sbjct: 61 GAVEVLPHVDSDFKKIAARVVEEAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI 120 Query: 120 LVVGSHGYGALKRAVLGSVSDYCAHHAHCTVMIVKKPK 157 LVVGSHGYGA+KRAVLGSVSDYCAHHAHCTVMIVK+PK Sbjct: 121 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPK 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9940 (456 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47129 (614 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8620 (351 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14939 (456 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3617 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7681 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35730 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17866264 (310 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2078 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7645 (492 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12644 61 2e-11 >Cs12644 Length = 127 Score = 61.2 bits (147), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 1/106 (0%) Query: 5 VKDVESKEE-LDNVVRQGAPVILHFWASWCEASKHMDQVFSHLSTDFPHAVFFRVEAEEQ 63 V VES E + QG PV++HF A WC S M+ +F L++ +P +F V+ ++ Sbjct: 17 VDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPDVLFLSVDVDDV 76 Query: 64 PVISEAYSVSAVPYFVFFKDGKTVDTMEGADPSSLANKVAKVAGSI 109 ++ V A+P F+ ++G VD + GA+P + ++ SI Sbjct: 77 KDVASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSI 122 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52045 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16991 (380 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27028 408 e-116 >Cs27028 Length = 238 Score = 408 bits (1049), Expect = e-116, Method: Compositional matrix adjust. Identities = 189/237 (79%), Positives = 215/237 (90%), Gaps = 1/237 (0%) Query: 133 KQRMPLIYVKLYTYQIFRGLAYIHSVPGVCHRDLKPQNLLVDPLTHQVKLCDFGSAKVLV 192 Q +P++YV+LYTYQI R L Y+H V GVCHRD+KPQNLLV+P THQ+K+CDFGSAK+LV Sbjct: 2 NQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVNPHTHQLKICDFGSAKMLV 61 Query: 193 KGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVE 252 GE NISYICSR+YRAPELIFGATEYTT+ID+WS GCVLAELLLGQPLFPGE+ VDQLVE Sbjct: 62 PGEPNISYICSRYYRAPELIFGATEYTTAIDMWSIGCVLAELLLGQPLFPGESGVDQLVE 121 Query: 253 IIKVLGTPTREEIRCMNPSYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR 312 IIK+LGTPTREEI+CMNP+YT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSPSLR Sbjct: 122 IIKILGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEALDLVSRLLQYSPSLR 181 Query: 313 CTALEACAHPFFDELREPNARLPNGRPLPPLFNF-KQELSGASPELVNKLIPEHVRR 368 CTALEACAHPFFD+LR+PN LPNGRPLP LFNF QEL+GAS EL +LIPEH R+ Sbjct: 182 CTALEACAHPFFDDLRDPNTCLPNGRPLPTLFNFTAQELAGASNELRQRLIPEHARK 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29350 (351 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52599 (379 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19263 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24434 79 2e-17 >Cs24434 Length = 163 Score = 79.3 bits (194), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 46/129 (35%), Positives = 69/129 (53%), Gaps = 2/129 (1%) Query: 2 IVRRALKNSTVVAGGGAIDMEISRYLRQHARTIAGKSQLFINSYAKALEVIPRQLCDNAG 61 + R +KN +V GGGA ++ +S L+Q + +I G + + A A E IPR L N G Sbjct: 3 VARNIIKNPKLVPGGGATELTVSATLKQKSSSIEGIEKWPYEAAAIAFEAIPRTLAQNCG 62 Query: 62 FDATDVLNKLRQKHALPSGEGGLFGVDINTGGIADSFANFVWEPAVVKINAINAATEAAC 121 + + L+ KHA +GE G+D NTG I+D +W+ VK A EAAC Sbjct: 63 INVIRTMTALQGKHA--NGENAWIGIDGNTGAISDMKERKIWDAYNVKAQTFKTAIEAAC 120 Query: 122 LVLSVDETV 130 ++L +D+ V Sbjct: 121 MLLRIDDIV 129 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3316 (531 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21685 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19366264 (356 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs113106184 616 e-178 >Cs113106184 Length = 384 Score = 616 bits (1588), Expect = e-178, Method: Compositional matrix adjust. Identities = 299/341 (87%), Positives = 311/341 (91%) Query: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPHKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 T+KIIAEYIWIGGSGMD+RSKARTL GPVSDP KLPKWNYDGSSTGQAPGEDSEVILYPQ Sbjct: 44 TDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 103 Query: 76 AIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHNAAKIFSHPEVLAEETWYGIEQEYTLL 135 AIFKDPFRRGNNILVMCD YTPAGEPIPTNKRH AAKIFSH +V+AEE WYGIEQEYTLL Sbjct: 104 AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYTLL 163 Query: 136 QNSVKWPIXXXXXXXXXXXXXXXXXXXADKAFGRDIVDSHYKACLYAGINISGINGEVMP 195 Q VKWP+ ADKA+GRDIVDSHYKACLYAGINISGINGEVMP Sbjct: 164 QKDVKWPLGWPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP 223 Query: 196 GQWEFQVGPAVGISAGDELWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYSTK 255 GQWEFQVGPAVGISAGD+LWVARYILERITEIAGVV+SFDPKPIQGDWNGAGAH NYSTK Sbjct: 224 GQWEFQVGPAVGISAGDQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHANYSTK 283 Query: 256 SMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGASI 315 SMRNDGG+E+IKKAIEKLGLRH EHIAAYGEGNERRLTG+HETADINTF WGVANRGASI Sbjct: 284 SMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGNERRLTGKHETADINTFKWGVANRGASI 343 Query: 316 RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAESTILWKP 356 RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAE+TILWKP Sbjct: 344 RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 384 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32155 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44223 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs98970 260 1e-71 >Cs98970 Length = 267 Score = 260 bits (664), Expect = 1e-71, Method: Compositional matrix adjust. Identities = 130/260 (50%), Positives = 172/260 (66%), Gaps = 7/260 (2%) Query: 1 GGGVSSLNVQLRKELDLYASLVNCFNLPGLPTRHQNVDIVVIRENTEGEYSGLEHEVVPG 60 G G SLN+ LRKEL+LYA++ C++LPG TR+ +V+++ IRENTEGEYSGLEH+VV G Sbjct: 9 GKGHRSLNLTLRKELNLYANVRPCYSLPGYKTRYDDVNLITIRENTEGEYSGLEHQVVRG 68 Query: 61 VVESLKVITKFCSERIAKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREVATKYP 120 VVESLK+IT+ S R+A+YAF YA + R++V+A+HKANIM+ DGLFL+ CREVA KYP Sbjct: 69 VVESLKIITRQASLRVAEYAFHYAKTHGRERVSAIHKANIMQKTDGLFLKCCREVAEKYP 128 Query: 121 GIKYSEIIVDNCCMQLVSKPEQFDVMVTPNLYGNLVXXXXXXXXXXXXXXXXXXXXADHA 180 I Y E+++DNCCM LV P FDV+V PNLYG+++ Sbjct: 129 EITYEEVVIDNCCMMLVKNPAAFDVLVMPNLYGDIISDLCAGLIGGLGLTPSCNIGEGGI 188 Query: 181 VFEQG--ASAGNVGHQKLVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVISEG 238 + SA ++ + L ANP ALLLSS MLRHL+ ADR++ A+ I+EG Sbjct: 189 ALAEAVHGSAPDIAGKNL-----ANPTALLLSSVTMLRHLELHDKADRIQNAILSTIAEG 243 Query: 239 KYRTKDLGGDSSTQEIVDAV 258 KYRT DLGG S+T + A+ Sbjct: 244 KYRTADLGGSSTTSDFTKAI 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6766262 (451 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv351 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs22449 117 1e-28 >Cs22449 Length = 278 Score = 117 bits (294), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 76/233 (32%), Positives = 109/233 (46%), Gaps = 36/233 (15%) Query: 78 LRHPNILRLYGYFYDQKRVYLILEYAAKGELYKEL--QKCKYFSERRAATYVASLARALI 135 L HP + LY F + V LI +Y GEL+ L Q K E Y A + AL Sbjct: 2 LDHPFVPALYASFQTKTHVCLITDYCPGGELFLLLDRQPTKVLKEDAVRFYAAEVVVALE 61 Query: 136 YCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTF------------NRRR------- 176 Y H + +I+RD+KPEN+L+ G + + DF S T +RR Sbjct: 62 YLHCQGIIYRDLKPENVLLQGNGHVSLTDFDLSCLTSCKPQLLLPTTNEKKRRHKGQQNP 121 Query: 177 -----------TMCGTLDYLPPEMVESVEHDASVDIWSLGVLCYEFLYGVPPFEAKEHSD 225 + GT +Y+ PE++ H ++VD W+LG+L YE LYG PF K Sbjct: 122 VFMAEPMRASNSFVGTEEYIAPEIIAGAGHTSAVDWWALGILLYEMLYGYTPFRGKTRQK 181 Query: 226 TYRRIVQVDLKFPPKPIVSSTAKDLISQMLVKDSSQRLPLH----KLLEHPWI 274 T+ I+ DLKFP S AK L+ ++L +D RL H ++ +HP+ Sbjct: 182 TFANILHKDLKFPSSTPTSLHAKQLMYRLLHRDPKSRLGSHEGANEIKKHPFF 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2430 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12987 300 1e-83 >Cs12987 Length = 204 Score = 300 bits (767), Expect = 1e-83, Method: Compositional matrix adjust. Identities = 146/203 (71%), Positives = 164/203 (80%) Query: 62 PLTGXXXXXXXXXXXXXXXXXTVPQESLSRHKYTNDCESAINEQINVEYNVSYAYHAMYA 121 PLTG P SL+R KY ++CE+AINEQINVEYNVSY YHA+YA Sbjct: 2 PLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALYA 61 Query: 122 YFDRDNVALKGLANFFKESSLEEREHAEKLMEYQNKRGGKVKLQSILMPHSEFDHPEKGD 181 YFDRDN+AL+GLA FFKESS EEREHAEK MEYQN RGGKVKL SI+ P SEFDH EKGD Sbjct: 62 YFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKGD 121 Query: 182 ALHAMELALSLEKLTNEKLLHLHSIADRSNDPQLADFIESEFLIEQVEAIKKISEYVAQL 241 AL+AMELALSLEKLTNEKLL LHS+ADR+NDPQ+A+F+ESEFL EQVEAI KI++YV+QL Sbjct: 122 ALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQVEAINKIAKYVSQL 181 Query: 242 RRVGKGHGVWHFDQMLLNGGVVA 264 R VGKGHGVWHFDQMLL+ G A Sbjct: 182 RMVGKGHGVWHFDQMLLHEGDAA 204 Database: orange.as.orf Posted date: Mar 27, 2017 5:37 AM Number of letters in database: 227,106 Number of sequences in database: 1113 Lambda K H 0.323 0.131 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1113 Number of Hits to DB: 156,312,618 Number of extensions: 6301262 Number of successful extensions: 18264 Number of sequences better than 1.0e-10: 820 Number of HSP's gapped: 17225 Number of HSP's successfully gapped: 937 Length of database: 227,106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 133 (55.8 bits)