BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36536 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27515 138 4e-35 >Contig27515 Length = 163 Score = 138 bits (348), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 4/117 (3%) Query: 12 YYSVLGIRRDASSSDIRTAYRKLALKWHPDRWAKNQALAGEAKRRFQQIQEAYSVLSDAS 71 YYSVLG+ D+S +IR AYRKLA+KWHPDRW + +L GEAKR+FQQIQEAYSVLSD Sbjct: 12 YYSVLGVGSDSSVEEIRRAYRKLAMKWHPDRWTRTPSLLGEAKRKFQQIQEAYSVLSDQR 71 Query: 72 KKSMYDAGFYDPMEEDQD--FCDFMQEMVSMMNNVGDEPDS--VEDLQKMFVDMVSG 124 K+SMYD G YDP ++++D FCDF+QEMVS+M E S +EDLQ MF +MV G Sbjct: 72 KRSMYDVGLYDPDDDEEDEGFCDFVQEMVSLMAESRREAKSYTMEDLQAMFREMVKG 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41993 (429 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27855 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34062 (303 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6871 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12666265 (1221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41067 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20450 306 1e-85 >Contig20450 Length = 148 Score = 306 bits (784), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 147/148 (99%), Positives = 147/148 (99%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRAKYETTARSWTQKYAMG 148 PEIAHMYKTDR KYETTARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRNKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30371 (362 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23723 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7180 282 3e-78 >Contig7180 Length = 199 Score = 282 bits (722), Expect = 3e-78, Method: Compositional matrix adjust. Identities = 130/178 (73%), Positives = 159/178 (89%), Gaps = 1/178 (0%) Query: 1 MAFTGTLDKCKACDKTVYVVDLLSADGASYHKTCFKCSHCKGTLVMSNYSSMDGVLYCKP 60 M+F GT KCKAC+KTVY V+ LSADG SYHK+CFKC+HCKGTL +SNYSSM+GVLYCKP Sbjct: 1 MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFEQLFKESGNFSKNFQTSAKPADKLN-ELSRAPSKLSSMFSGTQDKCSACRKTVYPLEK 119 HFEQLFKE+GNF+KNFQ+ AK A+KL EL+R+PSK +SMFSGTQDKC+ C KT YPLEK Sbjct: 61 HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK 120 Query: 120 VTLEGESYHKSCFKCAHGGCPLTHSSYAALNGVLYCKHHFSQLFMEKGNYSHVLEAAT 177 VT+E ++YHKSCFKC+HGGCP+T S+YAAL G+LYCKHHFSQLF EKG+Y+H++++A+ Sbjct: 121 VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSAS 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33773 (104 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22383 76 2e-16 >Contig22383 Length = 371 Score = 75.9 bits (185), Expect = 2e-16, Method: Composition-based stats. Identities = 37/97 (38%), Positives = 56/97 (57%) Query: 3 QDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFG 62 Q R+ V + FR+G LV TD+ RG+DI+ + VVIN+DFP E Y+HR+GR+GR G Sbjct: 142 QSERDYVLNQFRSGRTPILVATDVAARGLDIKDIRVVINYDFPTGVEDYVHRIGRTGRAG 201 Query: 63 HLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQ 99 GLA +D + + L +++PP + + Sbjct: 202 ATGLAYTFFGDQDAKYASDLIKVLEGANQRVPPEVRE 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47924 (371 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11175 615 e-178 >Contig11175 Length = 375 Score = 615 bits (1586), Expect = e-178, Method: Compositional matrix adjust. Identities = 298/375 (79%), Positives = 331/375 (88%), Gaps = 4/375 (1%) Query: 1 MAALSSFFKRKSSIPFTSLAIR-RWFS---TQPILDSPSFSQRIRDLPKDLPGTNIKKEV 56 MAAL SF K++SS+ A+R R FS +QPI DSPSF+QRI +LPKDLP T IK +V Sbjct: 1 MAALRSFLKKRSSVLCNGGAVRHRLFSAQVSQPIPDSPSFAQRIGNLPKDLPATQIKTQV 60 Query: 57 SQLIGKTPLVFLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMITDAENKQLITPGKTV 116 SQLIG+TP+V+LNKVTEGCGA++AVKQEM QPTASIKDRPAL+MI DAE K LITPG+T Sbjct: 61 SQLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGETT 120 Query: 117 LIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTV 176 LIEPTSGNMGISMAFMAAMKGYKMVLT+PSYTSLERRV MR FGADLILTDPTKGMGGTV Sbjct: 121 LIEPTSGNMGISMAFMAAMKGYKMVLTLPSYTSLERRVCMRCFGADLILTDPTKGMGGTV 180 Query: 177 KKAYELLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTRGQVDIFIMXXXXXXXXXXX 236 KKAY+LLESTP+AFMLQQFSNPANT+VHFETTGPEIWEDT GQVDIF+M Sbjct: 181 KKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGV 240 Query: 237 XRYLKSQNPNVKIYGLEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSE 296 +YLKS+NPNV+IYG+EP ESNVLNGGKPGPH ITGNGVGFKPDILDMD+ME V+ V SE Sbjct: 241 GQYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSITGNGVGFKPDILDMDMMERVIEVRSE 300 Query: 297 DAVNMARQLALKEGLMVGISSGANTVAALRLARRPENKGKLIVTIHPSFGERYLSSVLFQ 356 DAVNMARQLALKEGLMVGISSGANTVAA+ LA++PENKGKLIVT+H SFGERYLSSVLFQ Sbjct: 301 DAVNMARQLALKEGLMVGISSGANTVAAMELAKKPENKGKLIVTVHASFGERYLSSVLFQ 360 Query: 357 ELRKEAENMQPVSVD 371 +LR+EAENMQPV+VD Sbjct: 361 DLRQEAENMQPVAVD 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11117 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13016 (651 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48719 (132 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22278 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15561 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11372 132 5e-33 >Contig11372 Length = 541 Score = 132 bits (333), Expect = 5e-33, Method: Compositional matrix adjust. Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 2/105 (1%) Query: 2 EWFFFCPRDRKYPNGSRTNRATRAGYWKATGKDRKVVACQSTVIGYRKTLVFYRGRAPLG 61 EWFFFCP+DRKYPNG R NRAT GYWKATGKDR+ + +IG +KTLVF+ GRAP G Sbjct: 66 EWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQ-IKSDKILIGMKKTLVFHIGRAPKG 124 Query: 62 DRTDWVMHEYRLCDDPSQGSG-FQGAFALCRVVKKNDPTQKSSDF 105 RT+WVMHEYR G+ Q +F LCR+ KK D T + S+F Sbjct: 125 KRTNWVMHEYRATQKELDGTNPGQSSFVLCRLFKKQDETIEDSNF 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55076 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42061 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18597 (309 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9175 263 4e-72 >Contig9175 Length = 294 Score = 263 bits (671), Expect = 4e-72, Method: Compositional matrix adjust. Identities = 153/314 (48%), Positives = 187/314 (59%), Gaps = 25/314 (7%) Query: 1 MARATARIPAIHRNFLSANLELGFTAGQAASLSDMAFGFLEDGEGWPESFSSTGGCSENG 60 MA A RIP I R ++ ++ G SL+DM GF+E+ E PE+ +T G E+ Sbjct: 1 MAGAMVRIPVIRR----SSDDIYEFPGTTVSLADMVLGFIEEVEVPPEN--TTSGSDEDD 54 Query: 61 ALXXXXXXXXXXXXXXXXXXXXXFWESQHQILHTTLCRTSSLELGIRNATKEALKEIQMD 120 FWE Q Q+L TLC+TSS+E IR ATKEA++EI Sbjct: 55 ------------ENSCSVEENKAFWEEQDQLLQATLCKTSSVESKIRQATKEAVREINSS 102 Query: 121 D-NVCVCLRPVVGGCRSCLLREVSDRLRNAGYNSAICKSKWRSSPNIPSGEHTFLDVVHN 179 CVC RPV GGCR CL E+ RL ++GYN AICKSKWRSS N P+GEHT+L+V+ Sbjct: 103 SAEYCVCSRPVAGGCRKCLRTEICKRLIDSGYNCAICKSKWRSSTNAPAGEHTYLEVLDK 162 Query: 180 SNAKKGEVRVIIELNFRAEFEMARASEEYNRLIRRLPEVFVGKVERLHTLVKILXXXXXX 239 S +K+GE+RV+IELNFRAEFEMARASE YNRLI LPEVFVGK +RL L+KIL Sbjct: 163 S-SKRGEIRVVIELNFRAEFEMARASENYNRLISWLPEVFVGKADRLRALIKILCCAAKT 221 Query: 240 XXXXXXXXXGPWRKHRYMQAKWXXXXXXXXXXXXXXXXXXGRLPKPKASMLTVDLME-KL 298 GPWRKH+Y+QAKW G PKPKAS+LT DL+E + Sbjct: 222 CMKEKKMHLGPWRKHKYVQAKWFGTLERSTPGSLPVGFSHGP-PKPKASILTFDLLEAAM 280 Query: 299 P-NMHC--TAVEVV 309 P +HC TAVEVV Sbjct: 281 PAGLHCAGTAVEVV 294 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666260 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51183 (643 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20266261 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24077 188 5e-50 >Contig24077 Length = 232 Score = 188 bits (477), Expect = 5e-50, Method: Compositional matrix adjust. Identities = 117/226 (51%), Positives = 128/226 (56%), Gaps = 43/226 (19%) Query: 2 VTSNQTIKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDRSISFAELLVKLGELCGKSVC 61 +T TIKFLCSYGGKILPRYPDGKLRY GGETRVLAV RSISF+EL KL ELCG SV Sbjct: 8 LTKVTTIKFLCSYGGKILPRYPDGKLRYLGGETRVLAVPRSISFSELSSKLTELCGPSVT 67 Query: 62 ---LRCQLPTEDLDALVSVTSDEDLANLIEEYDRVASPPASLKIRAFLXXXXXXXXXXXX 118 LRCQLPTEDLDALVS+ SDEDL NLIEEYDR AS A++KIRAFL Sbjct: 68 AVSLRCQLPTEDLDALVSIKSDEDLVNLIEEYDRAAS-SANMKIRAFLSLIPTARTPKSI 126 Query: 119 XXXXXXX--------------------XXXXXXXXRFTMPAA--VDLCHHQISPQ----- 151 RF MP++ VD C Q+ PQ Sbjct: 127 SSPSTSSASAASTTSSSGNSSSSNNYFSAASGSTPRFPMPSSTPVDRCLRQMPPQPSPST 186 Query: 152 VPFQKSSRKVPHYG--YHV---HGNP-------SHVYLIHNGNHWQ 185 VPFQ+ KVPH YH HG+ S YL+HNGNHWQ Sbjct: 187 VPFQRPPSKVPHCANIYHARQGHGSNKPASTTGSRPYLVHNGNHWQ 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6911 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29839 94 1e-21 >Contig29839 Length = 95 Score = 94.0 bits (232), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 7/90 (7%) Query: 70 FED--HQPHFLEACFLCNKPLGDNRDIYMYRGDTPFCSEECRQEQIEMDEATEKNRSISS 127 +ED ++PHFL+AC LC KPLG+N DI+MYRG+TPFCS++CRQEQI+ DE EK+ +SS Sbjct: 11 YEDQTNEPHFLDACHLCRKPLGNNSDIFMYRGNTPFCSKDCRQEQIKFDENKEKSWKLSS 70 Query: 128 IKAFRKEQKTSSTPSKSQNYPFRTGTVAAA 157 + +K+ + + N RTG VA A Sbjct: 71 SR-----RKSDPNKNSTANKTVRTGFVAVA 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46936 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9402 201 3e-54 >Contig9402 Length = 328 Score = 201 bits (512), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 102/160 (63%), Positives = 131/160 (81%), Gaps = 3/160 (1%) Query: 1 MSSLAGISEELAEIDGQISDIFRALSNGFQKLEKIKDTSRQSRQLEELTGKMRECKRLIK 60 M+S +S +L +I G+I D FRAL+NGFQKL+KIKD++RQS+QLEELTGKMRECKRLIK Sbjct: 1 MASNLPMSPQLEQIHGEIHDNFRALANGFQKLDKIKDSNRQSKQLEELTGKMRECKRLIK 60 Query: 61 EFDREVKDLEIRNDPETNKMLNEKKQSMVKELNSYVALKKQYATNLENKRIDLFDAPA-- 118 EFDREVKD E RN P+ NK LN++KQSM+KELNSYV L+K Y +L NK+++LFD A Sbjct: 61 EFDREVKDEESRNPPDVNKQLNDEKQSMIKELNSYVQLRKTYMNSLGNKKVELFDMGAGV 120 Query: 119 -DDVGEENVLLASSMTNQQLMDNGNRMMDETDQVIERSKK 157 + +ENV +AS+M+NQ+L+++G + MDETDQVIERSKK Sbjct: 121 SEPTADENVQMASAMSNQELINSGMKTMDETDQVIERSKK 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58456 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18083 118 4e-29 >Contig18083 Length = 316 Score = 118 bits (296), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 58/133 (43%), Positives = 84/133 (63%), Gaps = 3/133 (2%) Query: 4 NLKVDPGQLMNMFEKGRQQIRMNYYPPCVHASKVIGVTPHSDICGLTLLAQVNEVQGLQI 63 +L + P +L FE R+NYY PC V+G H D LT+LAQ +V+GL + Sbjct: 146 SLGLPPTRLHGYFENQASFARLNYYAPCPKPDLVLGTGGHRDPSALTVLAQ-EDVEGLDV 204 Query: 64 --KKNGKWIPIRPVPGAFIVNIGDILEIMSNGEYKSIEHRAVVNPETERLSIAAFHSPSV 121 K +G W+ ++PVP +F++N+GD+L++ SN Y+S+EHRA+V+ ETER SI F PS Sbjct: 205 LRKSDGAWVRVKPVPDSFVINVGDVLQVWSNDLYESVEHRAMVHAETERYSIPIFFHPSH 264 Query: 122 ETIIGPLPELVKE 134 + + PL ELV E Sbjct: 265 DITMKPLDELVDE 277 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25326 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13566256 (272 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31941 110 4e-26 >Contig31941 Length = 280 Score = 110 bits (274), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 50/84 (59%), Positives = 67/84 (79%) Query: 183 DDDLNALLQEEEDLVNAHRKQVEETMNIVREEMNLLVEADQPGNQLDDYVSRLKSILSQK 242 D ++NA+L EEE L+ AHRK++E+TM IVREEM LL E DQPG+ +D+YV++L +LS+K Sbjct: 190 DGNINAILVEEEALIAAHRKEIEDTMEIVREEMKLLAEVDQPGSLIDNYVTQLSFVLSRK 249 Query: 243 AAGIMQLQAHLAHFQKRLKEHNVL 266 AAG++ LQA LA FQ RLKE +L Sbjct: 250 AAGLVSLQARLARFQHRLKEQEIL 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54613 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38743 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14266265 (196 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3176 147 1e-37 >Contig3176 Length = 234 Score = 147 bits (372), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 80/195 (41%), Positives = 117/195 (60%), Gaps = 7/195 (3%) Query: 4 ELKLFRTWSSVFALRIVWALKIKGVQYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGKP 63 ++K+ S F +R AL +K V YE + E +KS LLQ NPVHKKVPVL+H KP Sbjct: 5 DVKVLGMAPSPFVMRARIALNLKSVDYEFLQETFGSKSELLLQSNPVHKKVPVLIHGDKP 64 Query: 64 IAESLVILEYIDETWRETP-LLPEDPYERAMARFWAKFGDNKVLTSIVWGVFFKERKEQE 122 + ESL+I+EYIDE W P +LP DPY+RA ARFWA + K S+ G+ + +E + Sbjct: 65 VCESLIIVEYIDEVWASGPSILPSDPYDRATARFWAAYISEKWYPSMK-GIGLAQGEEAK 123 Query: 123 EAMLEAM-EHLQFLEDEL----NGKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVD 177 +A +E + E L LE+ G FFGG+ IG++D+A G + + E++ G+K++D Sbjct: 124 KAAIEQVTEGLALLEEAFEKSSKGNVFFGGDEIGYLDIAFGCFLGWLRVNEKLHGIKLLD 183 Query: 178 EDKFPLLAAWMQEYA 192 + K P L W ++ Sbjct: 184 QTKTPGLVKWADKFC 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57098 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38863 (146 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48983 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4947 (441 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16098 260 2e-71 >Contig16098 Length = 339 Score = 260 bits (665), Expect = 2e-71, Method: Compositional matrix adjust. Identities = 141/322 (43%), Positives = 191/322 (59%), Gaps = 14/322 (4%) Query: 125 GDRVKNWITLNEPLQTAVNGYGVGIFAPGRQEH----------SSTEPYXXXXXXXXXXX 174 GDRVK W TLNEP + NG+ VG APGR + S+ EPY Sbjct: 1 GDRVKQWTTLNEPHSVSNNGFAVGSQAPGRCSYWQNRNCLGGDSAIEPYLATHHLLLAHA 60 Query: 175 XXXSIYRNKYKDKQGGQIGLVVDCEWAEAFSDKIEDKVAAARRLDFQLGWFLDPIYFGDY 234 +Y++KY+ Q G IG+ ++ W S+ EDK AA R LDF GWF++P+ GDY Sbjct: 61 AAVKVYKDKYQAFQKGLIGITLNTYWFVPASETKEDKHAALRSLDFMFGWFMEPLTSGDY 120 Query: 235 PEVMHEKLGDRLPKFSEEQIALLTNSVDFVGLNHYTSRFIAHN---ESSVEHDFYKDQKL 291 P+ M +G+RLP F+ E+ LLT S DF+GLN+YT+R+ +++ SS+ + D + Sbjct: 121 PQSMRSLVGNRLPVFTNEESMLLTGSFDFLGLNYYTARYSSNDVPDNSSLPASYVTDSHV 180 Query: 292 ERIAEWDGGEVIGEKAASPWLYVVPWGIRKVLNYIAQRYNSPPIYVTENGMDDEDNDTSP 351 + E +G IG AS WLYV P G+ +L YI ++YN P IY+TE+G+ + ++ Sbjct: 181 KVTIELNGVP-IGPPTASDWLYVYPKGVYDLLLYIKKKYNDPLIYITESGVSEFNDPKLS 239 Query: 352 LHEMLDDKLRVFYFKGYLASVAQAIKDGVDVRGYFAWSLLDNFEWSQGYTKRFGLVYVDY 411 L E L+D RV Y+ +L V AIK+G V+GY AWSLLDNFEW GY RFG+ YVDY Sbjct: 240 LQEALNDTNRVDYYYRHLCYVRAAIKNGSKVKGYIAWSLLDNFEWEIGYAVRFGINYVDY 299 Query: 412 RNDLSRHPKSSALWFLRFLRGD 433 N L R+PK SA WF FL+ D Sbjct: 300 NNGLKRYPKLSAHWFKSFLKKD 321 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2422 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11104 553 e-159 >Contig11104 Length = 287 Score = 553 bits (1425), Expect = e-159, Method: Compositional matrix adjust. Identities = 260/285 (91%), Positives = 274/285 (96%) Query: 1 MFKATYEAITQGNPMWNQLSVPSSTLYTWDPKSTYIHDPPYFKSMTMSPPGPHGVKDAYC 60 MF ATYEAIT+GNPMWNQLSVPS TLY WDPKSTYIH+PPYFK MTMSPPG HGVK+AYC Sbjct: 1 MFMATYEAITKGNPMWNQLSVPSGTLYAWDPKSTYIHEPPYFKDMTMSPPGAHGVKNAYC 60 Query: 61 LLNFGDSITTDHISPAGSIHKDSPAARYLMERGVDRRDFNSYGSRRGNDEIMARGTFANI 120 LLNFGDSITTDHISPAGSIHKDSPAA+YL+ERGVDRRDFNSYGSRRGNDE+MARGTFANI Sbjct: 61 LLNFGDSITTDHISPAGSIHKDSPAAKYLLERGVDRRDFNSYGSRRGNDEVMARGTFANI 120 Query: 121 RIVNKLLKGEVGPKTLHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKG 180 R+VNK LKGEVGPKT+HIP+GEKLSVFDAAMRYKSEG DTIILAGAEYGSGSSRDWAAKG Sbjct: 121 RLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKG 180 Query: 181 PMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSEI 240 PMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK G+DA++LGLTG ERYTIDLPSSVSEI Sbjct: 181 PMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSEI 240 Query: 241 KPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNLI 285 +PGQDITVVTDNGKSF CT+RFDTEVELAYFDHGGILQY IRNLI Sbjct: 241 RPGQDITVVTDNGKSFICTLRFDTEVELAYFDHGGILQYVIRNLI 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24203 (439 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11070 (295 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3769 122 5e-30 >Contig3769 Length = 178 Score = 122 bits (307), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 65/114 (57%), Positives = 85/114 (74%), Gaps = 2/114 (1%) Query: 23 NSVSPGETPEHG--ASADGYASEGFVPGSSSSRERKKGTPWTEEEHRMFLLGLQKLGKGD 80 N++S E P+ + GYAS+ V S RER++G WTEEEH++FL+GLQ +G+GD Sbjct: 55 NNLSQYERPQQADTNAEAGYASDEVVHASGHRRERRRGVAWTEEEHKLFLVGLQMVGRGD 114 Query: 81 WRGISRNYVISRTPTQVASHAQKYFIRQTNVSRRKRRSSLFDIVADESVDTPMV 134 WRGISRN+V +RTPTQVASHAQKYF+R+ N +RR+RRSSLFDI D V+T + Sbjct: 115 WRGISRNFVKTRTPTQVASHAQKYFLRRNNHNRRRRRSSLFDITTDTPVNTMKI 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15700 (307 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32102 338 9e-95 >Contig32102 Length = 494 Score = 338 bits (866), Expect = 9e-95, Method: Compositional matrix adjust. Identities = 162/310 (52%), Positives = 212/310 (68%), Gaps = 8/310 (2%) Query: 2 PFLYAKDFIDVLKMKHASGSYKEMVLYVEACESGSIFEGLMPDDLNIYVTTASGPDEESW 61 P++YA D I+VLK KHA+G+YK +V Y+EACESGSIFEGL+P+ LNI+ TTAS +E SW Sbjct: 189 PYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSW 248 Query: 62 GTYCPGMEPAPPPEYITCLGDLFSVAWLEDSETHNLKKQTIEDQYQRVKVRTSNHNTYSV 121 GTYCPG P+PPPEY TCLGDL+SVAW+EDS+ HNL+ +T+ QY+ VK+RT+N N+ Sbjct: 249 GTYCPGEYPSPPPEYDTCLGDLYSVAWMEDSDVHNLRSETLHQQYELVKMRTANDNS-GF 307 Query: 122 GSHVMVYGNESIKTELLYLYQGFDPATDK---LPQNKFDLDIRMDVINQRDADLLFLWQR 178 GSHVM YG+ + L++Y G +PA D L +N L +NQRDADLL W + Sbjct: 308 GSHVMQYGDVGLSKNNLFVYMGTNPANDNYTFLGENS--LRPSSKAVNQRDADLLHFWHK 365 Query: 179 YKRSKADSEKK-EILKQLTQTMQHRVHLDQSIELIGMXXXXXXXXXXXXXAVRPRGLPVV 237 Y+++ S +K + K + M HR+H+DQ+++LIG AVRP G P+V Sbjct: 366 YRKAPEGSARKIQAQKDFVEAMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLV 425 Query: 238 DDWECLKSMVVVFETRCGSLTQYGMKHMRAFANICNNGISLTAMEEACRTACSSHTILDQ 297 DDW+CLK+MV FET CGSL+QYGMKHMR+ ANICN G++ M EA AC S + Sbjct: 426 DDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANICNAGMTQEQMAEASAQACVS-APSGR 484 Query: 298 WSPTIRGYSA 307 WS RG+SA Sbjct: 485 WSSLHRGFSA 494 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17841 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44799 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25307 (113 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16472 115 3e-28 >Contig16472 Length = 146 Score = 115 bits (287), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 54/81 (66%), Positives = 67/81 (82%), Gaps = 1/81 (1%) Query: 32 SLQQDVLPYLVRSQLRSELSLNGAPHTEENGHDKVVPGINQVMLSQLLAKTSTPSFHELY 91 SL++DVLPYLVR QL SE+S NGAP EENG++K NQ+++S++LA +STPSFHELY Sbjct: 1 SLKRDVLPYLVRRQLNSEVS-NGAPQPEENGNEKASSQSNQLVISRILANSSTPSFHELY 59 Query: 92 AMGPNGSAPVRRTHKCCVYIA 112 A+G NGS P +RTHKCCVYIA Sbjct: 60 ALGCNGSTPAQRTHKCCVYIA 80 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40056 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6059 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38831 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27037 102 6e-24 >Contig27037 Length = 227 Score = 102 bits (254), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 51/104 (49%), Positives = 69/104 (66%), Gaps = 10/104 (9%) Query: 12 RSVSAAATEAENLNDSFECNICFDSARDPVVTLCGHLYCWPCVYKWFHVQSASLASDEHP 71 +SVS + A ++ D FECNICF+ A+DP++T CGHL+CWPC+Y+W H S S Sbjct: 14 QSVSCSGNNANDVGD-FECNICFELAQDPIITRCGHLFCWPCLYRWLHHHSNS------Q 66 Query: 72 QCPVCKAEISHTTLVPLYGRGQTPSETELEGKTHCFGMAIPPRP 115 +CP CKA I LVPLYGRG+T +T+ K++ G+ IP RP Sbjct: 67 ECPFCKALIEEEKLVPLYGRGKT--QTDPRSKSYP-GINIPNRP 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3514 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57270 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8734 176 3e-46 >Contig8734 Length = 260 Score = 176 bits (447), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 82/227 (36%), Positives = 133/227 (58%), Gaps = 3/227 (1%) Query: 24 CEDTFTYSRATYYGSPDCLGTPTGACGFGEYGRSVNGGNVGA-VSRLYRNGTGCGACYQV 82 C+ S+A+++ + L +GACG+G +GG++ A V L++ G GCGAC+Q+ Sbjct: 19 CDRCVKQSKASFFSTSSAL--SSGACGYGSLASGFSGGHLAAGVPSLFKGGAGCGACFQM 76 Query: 83 RCKVPNLCADNGMKVVVTDHGEGDYTDFILSPRGFSMLARPNMAADLFAYGVVGIEYRRV 142 RCK LC G V +TD + + TDF+LS R F+ +A+ + + G++ +EY+RV Sbjct: 77 RCKNTTLCTKQGTIVTLTDLNQSNQTDFVLSSRAFAAMAQKGLDQHILRRGILDVEYKRV 136 Query: 143 PCQYPGSNIFFKVHEHSRFPDYLAIVMLYQAGLSDITAVDIWQEDCQEWKGMRKSYGAVW 202 PC+Y N+ +V E S+ P YLA+ +LYQ G ++I A+D+ Q W + ++ GA+W Sbjct: 137 PCEYKNQNLSLRVEESSQKPHYLAVKILYQGGQTEIVAMDVAQVGSSNWSFLSRNNGAIW 196 Query: 203 DMANPPKGPVGLRFQVSGRGGQKWVQLMNVIPSDWKAGVAYDSAFQL 249 + P G + RF V+ K V NV+P +WK+G+ YD+ Q+ Sbjct: 197 KTSRVPAGALQFRFVVTSGYDGKTVWAPNVLPVNWKSGMIYDTRVQI 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49087 (362 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10738 504 e-145 >Contig10738 Length = 362 Score = 504 bits (1298), Expect = e-145, Method: Compositional matrix adjust. Identities = 244/361 (67%), Positives = 278/361 (77%) Query: 1 MAKSPEEEHPVKAFGWAARDHSGHLSPFNFSRRATGEEDVRFKVLYCGICHSDLHSIKNE 60 MAK+PE+EHPVKAFGWAARD SGHLSPFNFSRR+TG+EDVRFKVLYCGICH+DLH+IKNE Sbjct: 1 MAKAPEQEHPVKAFGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNE 60 Query: 61 WGNAAYPMVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCLVGACHSCESCSDDLENYCSKL 120 WG + YPMVPGHEIVG VTEVGSKV K K GDKVGVGC+VGACH+CESC+ +LENYC K+ Sbjct: 61 WGISLYPMVPGHEIVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKM 120 Query: 121 ILTYNMPYHDGTRTYGGYSDTMVAPERYVVRIPDNMXXXXXXXXXXXXITVYSPLKYFGF 180 ILTY Y D T TYGGYSDTMVA ERY+VR P+N+ ITVYSPLKYFG Sbjct: 121 ILTYGSIYADRTVTYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGL 180 Query: 181 TQPGMXXXXXXXXXXXXXXXXXXXXXXXXXTLISTSPSKKKEAIEHLGADSFLVSRDPEQ 240 +PG T+ISTSPSKK EA++ LGADSF+VSRDP+Q Sbjct: 181 AEPGKHVGIVGLGGLGHVGVKFAKAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQQ 240 Query: 241 MQAAMGTMDGILDTVSATHXXXXXXXXXXXXXXXXXXGVPEKPLELPAFSLIMGRKTVAG 300 MQAA+GT+DGI+DTVSA H GVPEKPL+L F LIMGRK+VAG Sbjct: 241 MQAAIGTLDGIIDTVSAAHPIVPLLGLLKPHGKLILVGVPEKPLDLHVFPLIMGRKSVAG 300 Query: 301 SGIGGMKETQEMLDFAAKHNVTADIEVVPMDYVNTAMERLAKADVRYRFVIDIGNSLSAT 360 SGIGGMKETQEM+DFAAKHN+TAD+EV+ MDYVNTAMERLAK DVRYRFVID+GN+L+A+ Sbjct: 301 SGIGGMKETQEMIDFAAKHNITADVEVISMDYVNTAMERLAKNDVRYRFVIDVGNTLAAS 360 Query: 361 K 361 K Sbjct: 361 K 361 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3108 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56909 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48703 (273 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29655 171 1e-44 >Contig29655 Length = 289 Score = 171 bits (432), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 87/134 (64%), Positives = 100/134 (74%), Gaps = 5/134 (3%) Query: 140 RSLVAVQGVVYCKACKYRGIDTLLGASPLLGATVKLQCNNTKYPLVVLGKTDKNGYFFIQ 199 RS VAVQGVVYCK+C Y G+DTL GA P+LGATVKLQCNNTKYPLVV TDKNGYFFI Sbjct: 161 RSFVAVQGVVYCKSCNYSGVDTLNGAKPVLGATVKLQCNNTKYPLVVKKTTDKNGYFFIT 220 Query: 200 APKKITTFGAHKCKVSLVSSSSPTCNLATDLHFGLKGAILRXXXXXXXXXXXXYVTFSVG 259 APK +TTFGAHKCKVSLVS+ S C+ +DLH GL GA+LR ++ ++VG Sbjct: 221 APKTVTTFGAHKCKVSLVSAPSTACSKPSDLHGGLSGALLR-PVKPFVSQKLPFLLYNVG 279 Query: 260 PFAFEPAKKVECPR 273 PFAFEP +CPR Sbjct: 280 PFAFEP----KCPR 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28997 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226756907 82 5e-18 >226756907 Length = 114 Score = 82.0 bits (201), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 40/116 (34%), Positives = 67/116 (57%), Gaps = 3/116 (2%) Query: 1 MGLWEAFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVT 60 MGL F L K+EM + ++GL AGKT+++ + G IPT+GFN+ V Sbjct: 1 MGL--TFTKLFSRLLAKKEMRILMVGLDAAGKTTILYKLKLGEIVT-TIPTIGFNVETVE 57 Query: 61 KGNVTIKLWDLGGQPRFRTMWERYCRAVSAIVYVVDAADPDNIGISKSELHDLLSK 116 N++ +WD+GGQ + R +W Y + +++VVD+ D D + ++ ELH +L++ Sbjct: 58 YKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNE 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14352 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41345 (44 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31026 (316 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 221 1e-59 >Contig7384 Length = 326 Score = 221 bits (563), Expect = 1e-59, Method: Compositional matrix adjust. Identities = 127/302 (42%), Positives = 181/302 (59%), Gaps = 10/302 (3%) Query: 23 LSSNYYDKTCPDVESTVTNAVRQAVMADKKVAAALLRMHFHDCFIRGCDASVLLNSVNKN 82 L N+Y +CP+VES V AV + AA LR+ HDCF+ GCDAS+++ S N + Sbjct: 26 LVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEGCDASIIIASPNGD 85 Query: 83 TAEKDGPANGSL--HAFFVIDNAKKALEALCPGVVSCXXXXXXXXXXXXXXXGGPTWEVP 140 AEK+ N SL F + AK+A+EA CPGVVSC GGP++ V Sbjct: 86 -AEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAGGPSFPVE 144 Query: 141 KGRKDGRISRASETS-QLPSPTFNISQLKQSFSQRGLSLDDLVALSGGHTLGFSHCSSFQ 199 GR+DG IS+AS + LP PTFN++QL F++ LSL D++ALSG HTLGFSHC+ F Sbjct: 145 LGRRDGLISKASRVAGNLPEPTFNLNQLTTMFAKHNLSLTDVIALSGAHTLGFSHCNRFS 204 Query: 200 SRIRNFNATHDIDPTMHPSLAASLRSVCPKKNNVKNAGATMDP-SPTTFDNTYYKLILQG 258 R+ NF+ + +DP+++P A L + CP + N T+DP +P TFDN YY+ ++ G Sbjct: 205 DRLYNFSPSSTVDPSLNPDYAKQLMATCPIAVD-PNIVMTLDPDTPFTFDNAYYRNLVAG 263 Query: 259 RSLFSSDEALLTFPKTKNLVSKFATSKETFSKAFVNSIIKMSSI---TGGQ-EIRKDCRV 314 + L SSD+ L + +++ V FA + + F+ AFV ++ K+ + TG Q EIR+DC Sbjct: 264 KGLLSSDQVLFSDSASRSTVLNFANNADNFNGAFVTAMRKLGRVGVKTGNQGEIRRDCTT 323 Query: 315 VN 316 N Sbjct: 324 FN 325 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1415 (55 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41190 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19558 (341 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7532 190 2e-50 >Contig7532 Length = 295 Score = 190 bits (483), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 103/269 (38%), Positives = 153/269 (56%), Gaps = 7/269 (2%) Query: 30 SVISFDQGYTHLFGEGNLVRSSDGRSVRLLLDRYTGSGFISANLYNHGFFSANIKLPSEY 89 S +F Q + FG+G + G+ + L LD+ +GSGF S N Y G IKL S Sbjct: 27 SAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGN 86 Query: 90 TAGVVVAFYTSNGDVFEKTHDELDFEFLGNVKGKPWRFQTNVYGNGSTSRGREERYRLWF 149 +AG V A+Y S+ THDE+DFEFLGN G+P+ TNV+ G +R E+++ LWF Sbjct: 87 SAGTVTAYYLSSEG---PTHDEIDFEFLGNSTGEPYTLHTNVFSQGKGNR--EQQFHLWF 141 Query: 150 DPSKEFHRYSILWTAKNIIFYVDEVPIREVIRNEAMGGDYP-SKPMALYATIWDASNWAT 208 DP+K FH YSI+W ++ IIF VD +PIR E+ G +P ++PM +Y+++W+A +WAT Sbjct: 142 DPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPMRIYSSLWNADDWAT 201 Query: 209 SGGKYKVDYNYAPFVSEFSDFVLDGCPADPLQLASAAGCSDKDAELESNDYSAITPLRRI 268 GG K D+ APF + + +F + C A ++ ++ E + + R Sbjct: 202 RGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSLTEQSAWKTQGLDAAGRN 261 Query: 269 SMRKFRQKYMYYSYCYDTLRYATPLP-EC 296 +R +QK+M Y+YC D R+ LP EC Sbjct: 262 RLRWVQQKFMVYNYCSDLKRFPQGLPTEC 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59307 (344 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8371 154 2e-39 >Contig8371 Length = 374 Score = 154 bits (389), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 75/133 (56%), Positives = 96/133 (72%), Gaps = 7/133 (5%) Query: 4 LGVRKGAWTQEEDVLLRKCIEKYGEGKWHLVPLRAGLNRCRKSCRLRWLNYLKPDIKRGE 63 +G+++G WT EED LL I+K GEG+W +P +AGL RC KSCRLRW+NYL+P +KRG+ Sbjct: 42 VGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKQAGLLRCGKSCRLRWMNYLRPSVKRGQ 101 Query: 64 FALDEVDLMIRLHNLLGNRWSLIAGRLPGRTANDVKNYWHGHHLKKKVQFQEEGRKKPQT 123 A DE DL++RLH LLGNRWSLIAGR+PGRT N++KNYW+ HL KK+ Q P+T Sbjct: 102 IAPDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWN-THLSKKLISQG---IDPRT 157 Query: 124 HSKTKAIKPHPHK 136 H K + P H Sbjct: 158 H---KPLNPDHHS 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57632 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56933 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29283 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56715 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28288 301 5e-84 >Contig28288 Length = 344 Score = 301 bits (772), Expect = 5e-84, Method: Compositional matrix adjust. Identities = 145/219 (66%), Positives = 172/219 (78%), Gaps = 9/219 (4%) Query: 1 MDASSTLGSTLVGRLLLRGYTVHAAVQNHAGEIQLLNGLSCDTQKLKIFHSDPFDYQSIM 60 MDAS LGSTLV RLL RGY VHAA+Q H + + +KL++F SDPFDY SI+ Sbjct: 32 MDASGRLGSTLVHRLLHRGYAVHAALQKHH---KCFDDELVKKKKLRVFRSDPFDYHSIV 88 Query: 61 DALKGCSGLFYTFEPPHDQTSYDELMADVEVRAAHNVIEACAQTETIEKVVFTSSVTAVV 120 DALKGCS LFY+FEPP D +YDE MA+ EVRAAHNV+EACAQT+TI KVVFTSSVTAV+ Sbjct: 89 DALKGCSALFYSFEPPSDHPTYDEFMAEAEVRAAHNVLEACAQTDTIHKVVFTSSVTAVI 148 Query: 121 WRDDRKSIPSDL------DETHWTDINFSRKFKLWHAMSKTLAEKSAWALAMDRGVNMVS 174 WRDDR + S DE +W+D+NF RKFKLWHA+SKTLAE++AWALAMDRG+NMVS Sbjct: 149 WRDDRNASSSASSSSRGSDERNWSDVNFCRKFKLWHALSKTLAERTAWALAMDRGLNMVS 208 Query: 175 VNAGLLMAPDLTITHPYLKGAAEMYEDGVFVTVSVDFLV 213 +N GLL+ PDLTIT PYLKG AEMY+DG+ VTV + F+V Sbjct: 209 INGGLLLGPDLTITDPYLKGTAEMYQDGLLVTVDLKFIV 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17952 (330 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19419 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36008 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58213 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14854 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6932 149 3e-38 >Contig6932 Length = 244 Score = 149 bits (376), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 72/185 (38%), Positives = 110/185 (59%), Gaps = 1/185 (0%) Query: 1 CSLIRKPFVKSEDDDIEVPSIPYHKEIPKILFFGLLGITYXXXXXXXXXXXXXXXXXGYI 60 C+ IR+ F+ ++ + S PYH EIP++L FG +G T Y Sbjct: 24 CNYIRR-FILLKEGYNDTLSFPYHTEIPRVLLFGFIGFTCSILVPLILPFLLVYFVLAYF 82 Query: 61 IFRNQFLNVYAPKYETAGKFWPIVHNSMIFSLVLMHAIAIGIFTVKKLSIASTLIFPLPV 120 I+RNQ LNVY +YE+ G+FWP++HN++I SL++M IA+G+F +++ IAS PL + Sbjct: 83 IYRNQILNVYIAEYESGGQFWPMIHNTVIISLLMMQIIALGVFGLRRTPIASGFTIPLLI 142 Query: 121 LTLLFNEYCRKRFLPIFIAYSAESLIKRDRQDQNEPSMDEFFHELVTAYQDPALAPIQYS 180 TLLFNEYCR++F P+F + AE LI D++D+ M+E + +L +AY + P Sbjct: 143 FTLLFNEYCRQQFKPVFKNHVAEILIDMDQKDEQSGRMEEAYQQLHSAYCQAPITPDDSC 202 Query: 181 SNRDS 185 S+ S Sbjct: 203 SSGGS 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59214 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13466 125 5e-31 >Contig13466 Length = 361 Score = 125 bits (315), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 74/179 (41%), Positives = 106/179 (59%), Gaps = 14/179 (7%) Query: 2 RVQIALDAARGIEYIHEHTKTHYVHRDIKTSNILLDGAFRAKISDFGLAKLVGKTGEGEA 61 RV+IA++AARG+EY+HE + +HRDI++SN+LL F+AKI+DF L+ Sbjct: 177 RVRIAVEAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMA-ARL 235 Query: 62 SATRVVGTFGYLAPEYLSDGLATTKSDVYAFGIVLFEIISGKEAVTRTEGMVMKNPERRS 121 +TRV+GTFGY APEY G T KSDVY+FG+VL E+++G++ V T R Sbjct: 236 HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTM-------PRGQ 288 Query: 122 LASIMLAALRNSPNXXXXXXXKDCIDPNLMDLYPHDCLYKMAMLAKQCVDHDPILRPDM 180 + + A R S + K C+DP L D YP + K+A +A CV ++ RP+M Sbjct: 289 QSLVTWATPRLSED-----KVKQCVDPKLKD-YPAKGVAKLAAVAALCVQYESEFRPNM 341 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27259 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25240 (605 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57878 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15372 (282 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26411 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12908 (181 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40104 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4966260 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54718 (350 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59883 (485 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53234 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10998 338 5e-95 >Contig10998 Length = 258 Score = 338 bits (867), Expect = 5e-95, Method: Compositional matrix adjust. Identities = 173/267 (64%), Positives = 184/267 (68%), Gaps = 17/267 (6%) Query: 1 MDGGANYNPRTVEEVFRDFKGRRAGMIKALTTDVDEFYQQCDPEKENLCLYGFPNELWXX 60 MDGGA YNPRTVEEVFRDFKGRRAGMIKALTT+V++F+QQCDPEKENLCLYGFP+E W Sbjct: 1 MDGGAPYNPRTVEEVFRDFKGRRAGMIKALTTEVEDFFQQCDPEKENLCLYGFPSEQWEV 60 Query: 61 XXXXXXXXXXXXXXXXGINFARDGMQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADR 120 GINFARDGMQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADR Sbjct: 61 NLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADR 120 Query: 121 KRLFNMINDLPTIFEVVTGTAKKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180 KRLFNMIN+LPTIFEVVTGTAKKQ Sbjct: 121 KRLFNMINELPTIFEVVTGTAKKQ----------VKEKSSNSNHGSNRSKSNSKRGSEPQ 170 Query: 181 XKYSKTPQKXXX-------XXXXXXXXXXXXXTLCGACGENYASDEFWICCDICEKWFHG 233 ++SK Q TLCGACGENYA+DEFWICCDICEKWFHG Sbjct: 171 PRHSKALQSKDAEEDEEEGVEDEEEDEDEHGETLCGACGENYAADEFWICCDICEKWFHG 230 Query: 234 KCVKITPARAEHIKQYKCPSCSNKRSR 260 KCVKITPARAEHIKQYKCPSCSNKR++ Sbjct: 231 KCVKITPARAEHIKQYKCPSCSNKRAK 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50196 (94 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14166257 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4605 (127 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51506 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26661 91 2e-20 >Contig26661 Length = 146 Score = 90.9 bits (224), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%) Query: 26 LLATFNADESDIGPINGVRDF--YKEFIVESKKLWYLAGPAIFTSLCQYSLGAITQVFAG 83 L+ +A E + I+G + + +E KK+W +AGPAIFT + + ++Q F G Sbjct: 10 LVKETSAGEEETRVIDGEEELSLKRRVWIEIKKMWLVAGPAIFTRVASFGTNVVSQAFIG 69 Query: 84 HVGTLELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDM 130 H+G+LELAA S+ +V+ F G++LGM SALETLCGQ+ GA Q +M Sbjct: 70 HIGSLELAAFSLVFTVLVRFGNGILLGMASALETLCGQSHGAKQYNM 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9366262 (335 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16926 (379 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9034 445 e-127 >Contig9034 Length = 386 Score = 445 bits (1145), Expect = e-127, Method: Compositional matrix adjust. Identities = 235/388 (60%), Positives = 275/388 (70%), Gaps = 11/388 (2%) Query: 1 MCGGAIISDFIPASRCRRVDEDYF-PALKKRTSGNHCSKSLWSXXXXXXXXXXXXXXXLG 59 MCGGAIISDFI R RR+ DY P LKK +SG SK L S Sbjct: 1 MCGGAIISDFIAPVRSRRLTADYLWPDLKKPSSGKRLSKPLKSEIVDLDDDFEADFQEFK 60 Query: 60 FKXXXXXXXXXI--KPSAFSAAKP---HGYTGIKSVEFNGQAEKSAKRKRKNQYRGIRQR 114 + + KPSAFSA P G T +KSVEF+GQAEKSAKRKRKNQYRGIRQR Sbjct: 61 DESDVDEDDEMVDSKPSAFSAGNPSFARGSTAVKSVEFDGQAEKSAKRKRKNQYRGIRQR 120 Query: 115 PWGKWAAEIRDPRKGVRVWLGTFNTXXXXXXXXXXXXXXIRGKKAKVNFPDETPLTAPKR 174 PWGKWAAEIRDPRKGVRVWLGTFNT IRGKKAKVNFP+ETP + KR Sbjct: 121 PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEETPCASAKR 180 Query: 175 TIKANAQKLIPKGSPNSSHSNLNQSFNFMNNSDQEYYSSL--MDEKPSTNQYGYPDSFPA 232 +IK N QKLI K + N + SN NQ+FNF+N+S ++YYS+L +DEKP+ N + Y +FPA Sbjct: 181 SIKENPQKLIAKTNLNGTQSNPNQNFNFVNDSSEDYYSALGFLDEKPTMNNFRYMSTFPA 240 Query: 233 NGEVGLKSLAPSENGRMYFNSDQGSNSFDCSDLGWGEQGAKTPEISSVLSATL-EGDESQ 291 N +V LKS PSEN YF+SDQGSNSFDCSD GWGEQG+KTPEISSV+S+ + E D S Sbjct: 241 NEDVALKSSVPSENAPFYFSSDQGSNSFDCSDFGWGEQGSKTPEISSVISSVMEESDNSP 300 Query: 292 FIEDANPKKKLKSNSQNAVPVEENTPNGLSEDLSAFESQMKYFQIPYLDGNWEASMDALL 351 F+ED+NP KK+K NSQ+ P E+N+ LS++LSAFE MKYFQ PYLD +W+AS+DA L Sbjct: 301 FLEDSNPTKKMKPNSQDLEPPEDNSGKTLSDELSAFE--MKYFQTPYLDESWDASVDAFL 358 Query: 352 SGDAAQDGGNPMDLWSFDDLPTVVGGVF 379 +GDA QDGGNPMDLWSFDDLP +VGGVF Sbjct: 359 NGDATQDGGNPMDLWSFDDLPAIVGGVF 386 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65924 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17361 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45838 (74 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57566 (286 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12583 157 2e-40 >Contig12583 Length = 280 Score = 157 bits (397), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 109/276 (39%), Positives = 153/276 (55%), Gaps = 18/276 (6%) Query: 1 MSNSPEFSDFAGRKSGKLPDR-SNFSQTCNLLSQFLKEKGRFGDLSLGMAGKSETK---G 56 MS+S E ++ +G++ + ++ SNF+QTC++L Q+LKEKG FGDL+L A + + G Sbjct: 1 MSSSSETAEVSGQRGMRTAEKPSNFTQTCSMLCQYLKEKGSFGDLNLDTACNNMQQSNGG 60 Query: 57 RPESF--KSSTMSFELLNKDKSSEASGQNGGGSSNLKSSDFYPQFAGFGSLASI--DEAI 112 PE F K+ M+F E S + KS D +PQ AGFG A +E Sbjct: 61 TPEMFRQKAPPMNFFPF-----VENSRNMPTAVRDFKSMDLFPQQAGFGPSAPTPREEVP 115 Query: 113 NMAD--FRKSATTESETSQMTIFYAGQVLVFNDFPAEKAREVMLLAAKGTPQNTSGFLST 170 AD +KSA E + +QMTIFY GQV+VFNDFPA+KA+EVMLLA+K + Q+ + Sbjct: 116 MTADSSVKKSAPGEPQKAQMTIFYGGQVIVFNDFPADKAKEVMLLASKESSQSHTA--PA 173 Query: 171 SGPEKINTGXXXXXXXXXXXXXXXXXNPQALSSGTFSIPASPAATPNPQAPLGSELPIAR 230 S P K N + + P+P+ P+ +LPIAR Sbjct: 174 SPPAKTNNAFASHLGKSPVNSSSSVPPSSNMFPNFGNQAIQEGVKPSPR-PVVCDLPIAR 232 Query: 231 RNSLHRFLEKRKDRVNSKAPYQVNNPSRPSPKPEED 266 + SLHRFLEKRKDR+N+ APYQ ++P+ KP E+ Sbjct: 233 KASLHRFLEKRKDRLNTLAPYQTSSPASSPAKPTEN 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58784 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41509 (127 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30393 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13185 (413 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19104 (398 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64951 (218 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49738 (103 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49284 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36137 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27440 198 5e-53 >Contig27440 Length = 160 Score = 198 bits (504), Expect = 5e-53, Method: Compositional matrix adjust. Identities = 110/164 (67%), Positives = 129/164 (78%), Gaps = 4/164 (2%) Query: 1 MSESKAVIGLSWEPKLSLLSSAPKNGSDKSENVAENSGASLWKPDSELVDGLFVPPNNPR 60 M+ES AVIGLSWEPKL SSA KNG S + G LWKP ++LVDGLFVPPN+P Sbjct: 1 MAESNAVIGLSWEPKLPAFSSASKNGGG-SGSKPRPEGNPLWKPSTQLVDGLFVPPNDPV 59 Query: 61 KVNKLLRKQVKDTTGTKWFDMPAPTITPELKKDLQLLKLRSAIDPKRHYKKSDSKSKTLP 120 K NKL +KQ+KDT GT WFDMPAPT+TPEL+KDLQLLKLR+ +DPKRHYKK D++ Sbjct: 60 KRNKLAKKQIKDTAGTSWFDMPAPTMTPELQKDLQLLKLRNVMDPKRHYKKGDAQPN--- 116 Query: 121 KYFQVGTVIESASDFFSGRLTKKERKASLADELLSNSSFADYRK 164 KYFQVGT+IES DFFSGRLTKKERK SLA+E+LS+ + +YRK Sbjct: 117 KYFQVGTIIESPLDFFSGRLTKKERKVSLAEEVLSDRNLGNYRK 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12366263 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41528 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3802 164 3e-43 >Contig3802 Length = 163 Score = 164 bits (416), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 80/105 (76%), Positives = 85/105 (80%) Query: 1 MCQXXXXXXXXXXXXESIYGAKFEDENFIKKHTGPGILSMANAGPGTNGSQFFICTDKTE 60 MCQ ESIYGAKF DENF KKHTGPGILSMANAGPGTNGSQFFICT KTE Sbjct: 59 MCQGGDFTAGNGTGGESIYGAKFADENFNKKHTGPGILSMANAGPGTNGSQFFICTAKTE 118 Query: 61 WLDGRHVVFGQVVEGMDVVKAVEKVGSGSGRTAKTVKIEDCGQLS 105 WLDG+HVVFGQVVEG+DVVK +EKVGSG GRT+K V + DCGQLS Sbjct: 119 WLDGKHVVFGQVVEGLDVVKNIEKVGSGQGRTSKPVVVADCGQLS 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15164 (302 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24787 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23931 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13954 229 4e-62 >Contig13954 Length = 239 Score = 229 bits (583), Expect = 4e-62, Method: Compositional matrix adjust. Identities = 105/144 (72%), Positives = 123/144 (85%), Gaps = 3/144 (2%) Query: 3 RSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLR 62 R PCCEK TNKGAW+K+ED +LI YI+ HGEGCWRSLPKAAGL RCGKSCRLRWINYLR Sbjct: 2 RKPCCEKEGTNKGAWSKQEDQKLIDYIKTHGEGCWRSLPKAAGLHRCGKSCRLRWINYLR 61 Query: 63 PDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRGID 122 PD+KRGNF ++E+ELIIKLH+LLGN+WSLIAGRLPGRTDNE+KNYWN+HIR+KL+ GID Sbjct: 62 PDIKRGNFEQDEEELIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGID 121 Query: 123 PSTHR---PINEPSPDVTTISFAA 143 P+ HR I P+P ++S AA Sbjct: 122 PNNHRLNQIIPRPNPQNDSVSPAA 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5051 (107 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64486 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18866260 (386 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22374 92 1e-20 >Contig22374 Length = 352 Score = 92.0 bits (227), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 85/279 (30%), Positives = 127/279 (45%), Gaps = 40/279 (14%) Query: 25 PGTRWIDLLVQQDCRV-----EICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLF 79 PG + DC E+CT+ +S+ D ALI V ++ E G L Sbjct: 67 PGINLLKQFANVDCSYNLSPEELCTK----ISLCD--ALIVRSGTKVTREVFESSGGRL- 119 Query: 80 SALSRAGGRAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLTETTXXXXXXXXXXXXRRIV 139 + RAG VG +NVD+ AA ++G V N P T R + Sbjct: 120 KVVGRAG--------VGIDNVDLAAATEFGCLVVNAPTANTVAAAEHGIALLTAMARNVA 171 Query: 140 EADEFMRAGLYDGWLPHLFVGNLLRGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQ 199 +AD ++AG W + +VG L G+T+ V+G G++GS AR +G M++I +D Y Sbjct: 172 QADASVKAG---KWERNKYVGVSLVGKTLAVMGFGKVGSEVARR-AKGLGMHVISHDPY- 226 Query: 200 ATRLEKFVTAYGQFLKASGEQPVTWKRAASMDEVLREADLISLHPVLDKTTYHLVNKERL 259 A +A G + V++ DE L AD ISLH L T ++N + Sbjct: 227 ---------APADRARAIGVELVSF------DEALATADFISLHMPLTPATNKVLNDDTF 271 Query: 260 SMMKKEAILINCSRGPVIDEVALVAHLKENPMFRVGLDV 298 + MKK ++N +RG VIDE AL+ L + + G+ V Sbjct: 272 AKMKKGVRIVNVARGGVIDEDALLRALDAGIVAQEGVAV 310 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2047 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8734 213 1e-57 >Contig8734 Length = 260 Score = 213 bits (543), Expect = 1e-57, Method: Compositional matrix adjust. Identities = 98/146 (67%), Positives = 115/146 (78%) Query: 1 MANKGMGQQILKLGLVDVEYKRVLCNYNKQNLAIRVEEMSQKPHYLAIKVLYQGGQTEIV 60 MA KG+ Q IL+ G++DVEYKRV C Y QNL++RVEE SQKPHYLA+K+LYQGGQTEIV Sbjct: 114 MAQKGLDQHILRRGILDVEYKRVPCEYKNQNLSLRVEESSQKPHYLAVKILYQGGQTEIV 173 Query: 61 GMDVAQVDSSRWTYMTRNYGAIWDTSNVPSGPLQLRFVVTGGYDGKWVWAKKVLPADWKV 120 MDVAQV SS W++++RN GAIW TS VP+G LQ RFVVT GYDGK VWA VLP +WK Sbjct: 174 AMDVAQVGSSNWSFLSRNNGAIWKTSRVPAGALQFRFVVTSGYDGKTVWAPNVLPVNWKS 233 Query: 121 GETYDAGVQISDIAQEPCYPCDNENW 146 G YD VQI+DIAQE C CD+ +W Sbjct: 234 GMIYDTRVQITDIAQEGCPHCDDGSW 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19544 (354 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29054 518 e-149 >Contig29054 Length = 359 Score = 518 bits (1335), Expect = e-149, Method: Compositional matrix adjust. Identities = 252/316 (79%), Positives = 272/316 (86%), Gaps = 11/316 (3%) Query: 39 VPGAGLPTNPFDFSAMTGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFHGAAVEESIPQ 98 +P AG P NPFDFSAMTGLLNDPSIKELAEQIAKDP+FNQMA+QLQKTF G +V+E +PQ Sbjct: 55 IPEAGFPPNPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMADQLQKTFQGVSVDEGVPQ 114 Query: 99 FDTQQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLENLANPTHKDQLEERMARIK 158 FD+QQYYSTMQQVMQNPQFMTMAERLG+ALMQDPSM++MLE+ ANP++KDQLEERM+RIK Sbjct: 115 FDSQQYYSTMQQVMQNPQFMTMAERLGSALMQDPSMNTMLESFANPSNKDQLEERMSRIK 174 Query: 159 EDPSLKPILDEIETGGPAAMMRYWNDKDVLQKLGEAMXXXXXXXXXXXXXXXXXXXXXXX 218 EDPSLKPIL+EIETGGPAAMMRYWNDKDVLQKLGEAM Sbjct: 175 EDPSLKPILEEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVGDAATSTEAPEEAED---- 230 Query: 219 XXXXXSIAHHHSESIVHDTASVGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKC 278 A + ESIVH TASVGDVEGLK ALASGADKDEEDSEGRTALHFACGYGEVKC Sbjct: 231 -------AGNEDESIVHHTASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKC 283 Query: 279 AQILVEAGATVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKL 338 AQ L+EAGA VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKL Sbjct: 284 AQALLEAGARVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKL 343 Query: 339 NSQHEVLKLLEKDAFL 354 N+Q++VLKLLEKDAFL Sbjct: 344 NNQNDVLKLLEKDAFL 359 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41361 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6115 207 6e-56 >Contig6115 Length = 281 Score = 207 bits (528), Expect = 6e-56, Method: Compositional matrix adjust. Identities = 100/159 (62%), Positives = 121/159 (76%) Query: 3 EFRALASDCISHILSCTSPRDACRSELVSTTVRHAGDSDSVWEKFLPSDYQEILSRLVSP 62 F L DC +HILS TSP DACRS LVS++ R D+DSVW KFLPSD+++ILSR VSP Sbjct: 2 NFDHLPEDCFAHILSFTSPGDACRSSLVSSSFRATADADSVWRKFLPSDHKQILSRFVSP 61 Query: 63 LVFASKKELYSKLCSPLLIDEGRKSFSISKTTGKKGYMLSARNLSITWSSNTLYWSWKPL 122 + ++S K+L+ KLCSP LID G K F + K+TGKK YMLSAR+LSI+W S+ LYW+W+P Sbjct: 62 IAYSSSKDLFMKLCSPNLIDGGDKMFFVEKSTGKKCYMLSARDLSISWGSHPLYWTWRPC 121 Query: 123 LQSRFAETVELRTICWLEIQGKISTSVLSPKTTYRAYLI 161 LQSRFAE ELRTI WLEI G +T +LS KT Y AYLI Sbjct: 122 LQSRFAEVAELRTIWWLEICGTTNTQMLSQKTVYGAYLI 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19697 (335 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35496 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50341 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13466 169 2e-44 >Contig13466 Length = 361 Score = 169 bits (429), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 87/174 (50%), Positives = 121/174 (69%), Gaps = 2/174 (1%) Query: 1 LDCARALEFLHEHAVPSIIHRDFKPSNILLDQNFRAKVSDFGLAKTSSDKINSQIPTRVI 60 ++ AR LE+LHE P+IIHRD + SN+LL ++F+AK++DF L+ + D TRV+ Sbjct: 182 VEAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLHSTRVL 241 Query: 61 GTTGYLAPEYASSGKLTTKSDVYSYGVVLLELLTGRVPLDTKRPPGEDVLVSWALPRLTN 120 GT GY APEYA +G+LT KSDVYS+GVVLLELLTGR P+D P G+ LV+WA PRL+ Sbjct: 242 GTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS- 300 Query: 121 RQKLVEMVDPALQGHYSKKDLXXXXXXXXVCVQHEADYRPLMTDVVQSLIPLVK 174 K+ + VDP L+ Y K + +CVQ+E+++RP M+ VV++L PL+K Sbjct: 301 EDKVKQCVDPKLK-DYPAKGVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLK 353 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46672 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19217 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9908 (174 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6720 (181 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14589 (94 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31134 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12672 157 1e-40 >Contig12672 Length = 318 Score = 157 bits (397), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 93/228 (40%), Positives = 138/228 (60%), Gaps = 14/228 (6%) Query: 1 MEGEKGRVCVTGGTGFIASWLVMKLLQHGYSVNATIRSHPQSKKDVSYLTNLPGASEKLR 60 M EKGR CVTG GF+ASW+V LL ++ T+R K ++L L ASE L+ Sbjct: 1 MAVEKGRYCVTGAGGFLASWVVKLLLSKDSIIHGTLRDPSNDKH--AHLKKLDKASENLK 58 Query: 61 IYNADLSDPSSFEAAIEGCIGVFHVAHPIDFEDT-EPEETVTKRSVEGTLGILKACLNSK 119 ++ ADL D S AI+GC GVFHVA P+ ++ PE + + +V+GTL +LKACL +K Sbjct: 59 LFKADLLDYESLHTAIQGCDGVFHVASPVPYDPVPNPEVELIEPAVKGTLNVLKACLEAK 118 Query: 120 TVKRVVYTSSTSAVEYNDK--GGDIKDESSWSDVDFLKALNYWGLSHMISKTMTERAALD 177 VKRVV+ SS +++ N K G + +E+ WSD ++ ++ W + +SKT E AL+ Sbjct: 119 -VKRVVFVSSAASLVMNPKWSQGQVLNETCWSDKEYCRSTKNW---YCLSKTEAEYEALE 174 Query: 178 FAHEHGLDLVTVIPSFVVGPFICPRFPGSVNAA-LALVLGDQQHYHFL 224 +A +GLDLVTV P+ ++GP + +VNA+ L L+ ++ Y L Sbjct: 175 YARINGLDLVTVCPTLIMGPIL----QSTVNASTLVLIKLLKEGYESL 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21166264 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56209 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10220 100 1e-23 >Contig10220 Length = 356 Score = 100 bits (249), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 46/59 (77%), Positives = 54/59 (91%) Query: 94 ISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLKRARQALLERTGVFIVEG 152 +SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKR+RQALL++ VF+VEG Sbjct: 1 MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQALLKKHEVFVVEG 59 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6137 (314 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2398 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17701 114 1e-27 >Contig17701 Length = 168 Score = 114 bits (285), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 52/87 (59%), Positives = 62/87 (71%) Query: 63 RPAEPGLTNSPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVFAAGLTQRFCQQCSRF 122 R G T P CQ + C ADL+ K Y+RRHKVC+ H+KA ++ G QRFCQQCSRF Sbjct: 70 RSGAGGSTAGPCCQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRFCQQCSRF 129 Query: 123 HLLSEFDNGKRSCRKRLADHNRRRRKS 149 H LSEFD+ KRSCR+RLA HN RRRK+ Sbjct: 130 HSLSEFDDSKRSCRRRLAGHNERRRKT 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27467 (181 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10658 69 5e-14 >Contig10658 Length = 189 Score = 68.9 bits (167), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 35/96 (36%), Positives = 47/96 (48%), Gaps = 3/96 (3%) Query: 24 VGGSSGW--DTGVDYSTWASGETFTVGDYLVFTYGS-THSVDEVSKSSYDSCATSNPTKS 80 VGG GW + YS WA F + D L F Y + SV V+K Y SC T NP + Sbjct: 30 VGGKDGWVVNPSQSYSLWAEKNRFNINDTLHFKYKKGSDSVLVVNKDDYFSCNTQNPIQK 89 Query: 81 YTGGSNTIALTTAGSLYFLCPTTGHCSQGMKLAITV 116 GG + + +G YF+ G+C +G KL + V Sbjct: 90 LDGGDSDFTVDRSGPFYFISGQNGNCQKGQKLLVIV 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1166261 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21116 162 3e-42 >Contig21116 Length = 230 Score = 162 bits (410), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 77/137 (56%), Positives = 94/137 (68%) Query: 1 MEQTFIMIKPDGVQRNLVGEIIGRFEXXXXXXXXXXXXXVERGFAEKHYEDLSSKPFFNG 60 +++T+IM+KPDGVQR LVGEII RFE + AE+HY+DL K FF Sbjct: 82 VDETYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCPQDLAEEHYKDLKGKSFFPK 141 Query: 61 LVEYIISGPVVAMIWEGKNVVTTGRKIIGATNPSDSAPGTIRGDFAVDIGRNVIHGSDSV 120 L+EYI+SGPVV M WEG VV RK+IGATNP + PGTIRGD AV GRNV+HGSDS Sbjct: 142 LIEYIVSGPVVCMAWEGVGVVAAVRKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDSP 201 Query: 121 GSARKEIALWFPEGPVA 137 + ++EIALWF EG + Sbjct: 202 ENGKREIALWFKEGELC 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13800 (57 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14448 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25792 186 3e-49 >Contig25792 Length = 173 Score = 186 bits (472), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 86/144 (59%), Positives = 113/144 (78%), Gaps = 4/144 (2%) Query: 22 SSAGGRKLEIKKHLKRLNKRAVKTIKSRDGDIIDCVRVTHQPAFDHPMLKNHTIQMKPSF 81 S++ +KL++ KHL RLNK AVK+IKS DGDIIDCV ++ QPAFDHP LK+H IQM+P++ Sbjct: 34 SASSRQKLDVHKHLNRLNKPAVKSIKSPDGDIIDCVHISQQPAFDHPYLKDHKIQMRPTY 93 Query: 82 HPEGLFTEMKAPSKSHKRSKPVTQLWQLNGRCPKGTVPIRRTKREDVLRANSISRFGKKK 141 HPEGLF E K + +R TQLW +NGRCP+ T+P+RRTK +D+LRA+S+ +G+KK Sbjct: 94 HPEGLFAENKVAESTKERVN--TQLWHVNGRCPEDTIPVRRTKEDDILRASSMKHYGRKK 151 Query: 142 HRTFPQPRSADPDLISQSGHQHAI 165 RT P+SADPDL ++SGHQHAI Sbjct: 152 QRTI--PKSADPDLANESGHQHAI 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27445 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv146 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28408 (382 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28932 431 e-123 >Contig28932 Length = 323 Score = 431 bits (1109), Expect = e-123, Method: Compositional matrix adjust. Identities = 207/314 (65%), Positives = 247/314 (78%) Query: 65 IAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIADAEQRGAIT 124 I DVT+LIG TP+VYLNN+V G VA IAAKLE MEPC SVKDRI YSMI DAE +G IT Sbjct: 7 IKNDVTELIGNTPLVYLNNVVDGCVARIAAKLESMEPCSSVKDRIAYSMIKDAEDKGLIT 66 Query: 125 PGKSTLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLLKAFGAELVLTDPAKG 184 PGK+ L+E TSGNTGIGLAFIAAS+GYK+ LTMP+SMS+ERR++L AFGAE+ LTDPAKG Sbjct: 67 PGKTVLIEATSGNTGIGLAFIAASRGYKVKLTMPSSMSIERRIVLLAFGAEVYLTDPAKG 126 Query: 185 MKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYQTTGPEIWEDTRGKVDXXXXXXXXXX 244 +KGA KAEE+L TPN Y+L QF+NPANPK+HY+TTGPEIW DT KVD Sbjct: 127 IKGAFDKAEELLSDTPNGYILGQFENPANPKIHYETTGPEIWRDTGAKVDALVSGIGTGG 186 Query: 245 XXXXXXKFLKKQNPNIKAIGVEPLESNILSGGKPGPHKIQGIGAGFVPSNLDQDVVDEVI 304 KFLK+QNP IK GVEP ES +L+GG+ G H IQGIGAG +P+ LD ++DEVI Sbjct: 187 TVAGTGKFLKEQNPEIKVYGVEPAESPVLNGGQAGKHLIQGIGAGIIPAVLDVSLLDEVI 246 Query: 305 EISSDEAVETAKQLALQEGLLVGISSGXXXXXXMKVGKRPENAGKLIAVVFPSFGERYLS 364 +++S+EA++TAKQLAL+EGLLVGISSG +K+ KRPENAGKLI VFPSFGERYLS Sbjct: 247 QVTSEEAIDTAKQLALKEGLLVGISSGAAAAAAIKLAKRPENAGKLIVAVFPSFGERYLS 306 Query: 365 TALFQTIRDECEKM 378 +ALF ++R E E + Sbjct: 307 SALFNSVRHEAENL 320 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17966265 (389 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6029 312 6e-87 >Contig6029 Length = 375 Score = 312 bits (800), Expect = 6e-87, Method: Compositional matrix adjust. Identities = 139/156 (89%), Positives = 151/156 (96%) Query: 234 KTAADKRFKTLPPSESLPRNETVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPG 293 K++ DKRFKTLPP+ESLPRNET+GGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPG Sbjct: 220 KSSVDKRFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPG 279 Query: 294 LPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPMEE 353 LPLFLYNYSTHQLHG+FEAASFGGTN DP+AWEDKKCPGESRFPAQVRV TRK+CEP+EE Sbjct: 280 LPLFLYNYSTHQLHGIFEAASFGGTNFDPSAWEDKKCPGESRFPAQVRVFTRKVCEPLEE 339 Query: 354 DSFRPVLHHYDGPKFRLELNVPEALSLLDIFNEKTP 389 DSFRP+LHHYDGPKFRLEL+VPEALSLLDIF ++ P Sbjct: 340 DSFRPILHHYDGPKFRLELSVPEALSLLDIFADQNP 375 Score = 119 bits (299), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 72/153 (47%), Positives = 91/153 (59%), Gaps = 19/153 (12%) Query: 1 MEGNQQSFWQFSDQLRVQTSNLANLSLNESIWSSPYTKRQDERRNFDIRVGGEINPGSSL 60 ME N QSFWQFSDQLRVQ SN ANL++N+SIWS+ Y+KR DERRNFDI+VGGE++P +L Sbjct: 1 MENNNQSFWQFSDQLRVQGSNFANLNINDSIWSNSYSKRPDERRNFDIKVGGEVSPIVNL 60 Query: 61 KQKGLDFNGGYDMRVGGEINSGSSLKQKVLDFNGGYEMRVGGEINSGSSLKQKGSDFNGG 120 KG DFNG D V +LK K + G + +S K K S+ N G Sbjct: 61 TPKGSDFNGFNDSWV-------DNLKPKA-----AFSDANGSSNDGWNSFKPKASELNSG 108 Query: 121 YEMMVGREMNSVNDLRQKGNDY-NGFNGGWKIG 152 + N N + K +D+ N FN GWK+G Sbjct: 109 F------NDNRWNSFKPKASDFNNSFNDGWKLG 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5766256 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6567 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27615 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10166263 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39122 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22123 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17999 150 2e-38 >Contig17999 Length = 210 Score = 150 bits (379), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 74/124 (59%), Positives = 95/124 (76%) Query: 102 LSLAALHSLNYVKRLDLEGTQVEDEALCPLLRFQQLNELSLKGTRLTDLSLYQLSSLPNL 161 LSL+AL SL ++++L+L+ T+V D AL PL F +L +L+LK LTD SLY SS+P L Sbjct: 16 LSLSALQSLRHLEKLNLKDTKVTDAALDPLKSFHELTDLTLKSASLTDNSLYHTSSIPKL 75 Query: 162 MNLSIGDTVLTNGGLNSFKPPAALKLLDLRGCWLLTEDAILSFHKNDPQIEVRHELVHIT 221 NL + D VLTN GLNS+KPP+ L+++DL GCWLLTEDAI SF K QIE+RHELVHI+ Sbjct: 76 TNLCVHDGVLTNSGLNSYKPPSTLRMMDLSGCWLLTEDAISSFCKAHSQIELRHELVHIS 135 Query: 222 PSEQ 225 PS+Q Sbjct: 136 PSKQ 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65230 (281 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7532 411 e-117 >Contig7532 Length = 295 Score = 411 bits (1056), Expect = e-117, Method: Compositional matrix adjust. Identities = 189/264 (71%), Positives = 217/264 (82%), Gaps = 12/264 (4%) Query: 28 YQDFDLTWGDNRAKIFNGGQLLSLSLDQASGSGFQSKKEYLFGRIDMQLKLVAGNSAGTV 87 +QDFD+T+GD RAKI NGGQLL+L+LD+ASGSGF+SK EYLFGRIDMQ+KLV+GNSAGTV Sbjct: 32 FQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSAGTV 91 Query: 88 TAYYLSSQGSTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFHTYS 147 TAYYLSS+G THDEIDFEFLGN +G+PY LHTNVF+QGKGNREQQF+LWFDPT+ FHTYS Sbjct: 92 TAYYLSSEGPTHDEIDFEFLGNSTGEPYTLHTNVFSQGKGNREQQFHLWFDPTKTFHTYS 151 Query: 148 IIWTARHIIFLVDNVPIRLFKNAESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWS 207 I+W ++ IIFLVDN+PIR+F N ES GVPFPKNQPMRIYSSLWNADDWATRGGLVKTDW+ Sbjct: 152 IVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWT 211 Query: 208 KAPFTAYYRNFRANXXXXXXXXXXXXXXXXE------------LDSYSRRRLRWVQKNFM 255 +APFTA YRNF+AN LD+ R RLRWVQ+ FM Sbjct: 212 QAPFTASYRNFKANACTASSPSSCASTTSTNSLTEQSAWKTQGLDAAGRNRLRWVQQKFM 271 Query: 256 IYNYCTDLKRFPQGVPAECKRSRF 279 +YNYC+DLKRFPQG+P ECKRSRF Sbjct: 272 VYNYCSDLKRFPQGLPTECKRSRF 295 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37201 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21621 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36319 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24025 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10220 174 6e-46 >Contig10220 Length = 356 Score = 174 bits (441), Expect = 6e-46, Method: Compositional matrix adjust. Identities = 84/104 (80%), Positives = 94/104 (90%), Gaps = 3/104 (2%) Query: 51 AQLRIYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGY 110 AQLRIYNLGNTSPVPVG+LV ILEGLL+ KAKKHVIKMPRNGDVPYTHANV+LAY+DFGY Sbjct: 252 AQLRIYNLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGY 311 Query: 111 KPSTDLATGLRRFVKWYVSYYGIQTRVKKET---LKRSDQLEES 151 KP+TDLA+GLR+FVKWYVSYYGI++RVKKE K S Q +ES Sbjct: 312 KPTTDLASGLRKFVKWYVSYYGIESRVKKEMDSGKKGSQQTDES 355 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32139 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35079 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24736 427 e-122 >Contig24736 Length = 340 Score = 427 bits (1099), Expect = e-122, Method: Compositional matrix adjust. Identities = 204/265 (76%), Positives = 228/265 (86%), Gaps = 6/265 (2%) Query: 6 EVELASKFGIIYADGKRDV------RGDPAYVRAACEASLKRLEVDCIDLYYQHRIDTRV 59 +VELA+KFG+ + + K +V +GDPAYVRAA E+SLKRL VD IDLYYQHRIDT V Sbjct: 74 KVELATKFGLRFVENKMEVGKNMEVQGDPAYVRAALESSLKRLGVDSIDLYYQHRIDTSV 133 Query: 60 PIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVP 119 P+EVT+GELKKLVEEGK+KYIGLSEASASTIRRAHAVHPITAVQLEWSLW+RDVE+EI+P Sbjct: 134 PVEVTVGELKKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEQEIIP 193 Query: 120 TCRELGIGIVAYSPLGRGFFSSGTKLVENLSNNDFRKNLPRFQPENLGHNKILYERVSEI 179 TCRELGIGIVAYSPLGRGFF+SG K VENL++ D RKNLPRFQPEN+ HNK L+ERVS++ Sbjct: 194 TCRELGIGIVAYSPLGRGFFASGAKFVENLAHGDSRKNLPRFQPENVEHNKTLFERVSDL 253 Query: 180 ATRKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLKQNIGALSVKLTPEETAELESIASA 239 A RKGCTPSQLALAWVHHQGNDVCPIPGTTKI N QNI ALSVKLTPEE AELES AS Sbjct: 254 AARKGCTPSQLALAWVHHQGNDVCPIPGTTKIANFDQNIAALSVKLTPEELAELESYASV 313 Query: 240 DGVKGDRYESTAFTWKTAHTPPLDS 264 D VKG+RY + TW + TPPL S Sbjct: 314 DAVKGERYPNYYSTWSNSETPPLSS 338 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv91 (337 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23428 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5790 187 9e-50 >Contig5790 Length = 180 Score = 187 bits (475), Expect = 9e-50, Method: Compositional matrix adjust. Identities = 90/117 (76%), Positives = 96/117 (82%), Gaps = 1/117 (0%) Query: 70 EGYVETADEDDLMRTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQK 129 EGYVE AD+DDL RTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQK Sbjct: 64 EGYVEAADDDDLSRTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQK 123 Query: 130 FMDDQQKX-XXXXXXXXXXXXXXXNWKISSPGDHPEEVKARLKFWAQAVACTVRLCS 185 FMD+ QK NWKISSPGDHPE+VK RLK+WAQAVACTV+LC+ Sbjct: 124 FMDEHQKSPENSPAAVDSVSTQIANWKISSPGDHPEDVKERLKYWAQAVACTVKLCN 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28566264 (336 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34229 (233 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52489 (331 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10510 69 1e-13 >Contig10510 Length = 330 Score = 68.9 bits (167), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 34/81 (41%), Positives = 47/81 (58%), Gaps = 4/81 (4%) Query: 126 RKNQQKRVVQ----HVTAEGLSSDVWAWRKYGQKPIKGXXXXXXXXXXXXLKGCLARKQV 181 RK +QKR+V+ + + D ++WRKYGQKPIKG ++GC ARK V Sbjct: 236 RKLRQKRIVRVPAISLKLADIPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHV 295 Query: 182 ERSRTDPEIFIVTYTAEHSHS 202 ER+ D + +VTY EH+HS Sbjct: 296 ERALDDAAMLVVTYEGEHNHS 316 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33766 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9983 131 5e-33 >Contig9983 Length = 126 Score = 131 bits (329), Expect = 5e-33, Method: Compositional matrix adjust. Identities = 67/134 (50%), Positives = 90/134 (67%), Gaps = 8/134 (5%) Query: 1 MKKVVLKLDLHDDKAKQKAMKAVSSLSGVNSIATDMKDKKLTVVGDVDPVDIVSKLRKGW 60 MKKVVLKL+LHD+K K+KAM+AVS L G++SI+ DMKDKKLTV GD+DPVD+V +LRK Sbjct: 1 MKKVVLKLELHDEKGKKKAMRAVSGLEGLDSISMDMKDKKLTVTGDIDPVDLVGRLRKLC 60 Query: 61 HTDILTVGPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIQELVDAYKAYNPHLTRYYH 120 T+I++VGPA ++ EL+ AY+A+ P + YY+ Sbjct: 61 RTEIVSVGPA--------KEEKKKEEPKKEETKKKDPKDEMAELIKAYQAHCPPMPAYYY 112 Query: 121 VQSAEENPNACVIC 134 V+S+EE+PNACVIC Sbjct: 113 VKSSEEDPNACVIC 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21066261 (516 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52807 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36576 (514 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26019 610 e-176 >Contig26019 Length = 320 Score = 610 bits (1573), Expect = e-176, Method: Compositional matrix adjust. Identities = 287/320 (89%), Positives = 302/320 (94%) Query: 195 MGIGFLGIGFQPKWAIKDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSE 254 MGIGFLGIGFQPKW +KDIPIMPKGRY+IMRNYMP VG+LGLDMMFRTCTVQVNLDFSSE Sbjct: 1 MGIGFLGIGFQPKWGLKDIPIMPKGRYDIMRNYMPTVGTLGLDMMFRTCTVQVNLDFSSE 60 Query: 255 TDMIRKFRVGLALQPIATALFANSPFVEGKPSGYLSMRSQIWTDTDNNRTGMLPFVFDGS 314 DMIRKFR GLALQPIATALFANSPF EGKP+G+LSMRSQIWTDTDNNRTGMLPFVFD S Sbjct: 61 ADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSQIWTDTDNNRTGMLPFVFDDS 120 Query: 315 FGFEQYVDYALDVPMYFVYRKKKYIDCTGMSFRDFIAGKLPSLPGELPNFNDWENHLTTI 374 FGFEQYVDYALDVPMYFVYR KKYIDCTGM+FRDF+ GKLP +PGELP NDWENHLTTI Sbjct: 121 FGFEQYVDYALDVPMYFVYRNKKYIDCTGMTFRDFLVGKLPCIPGELPTLNDWENHLTTI 180 Query: 375 FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNALDIIADWTLEERQMLRN 434 FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQN LD+ ADWT EERQMLRN Sbjct: 181 FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNVLDLTADWTPEERQMLRN 240 Query: 435 KVPKTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGFKETGFLNAVAEVVRTGVTPAEKLL 494 KVP TGLKTPFRDGLLKHVA+DV+KLA+DGLERRGFKETGFLN VAEVVRTGVTPAEKLL Sbjct: 241 KVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL 300 Query: 495 EMYHGPWGQCVDPVFEELLY 514 E+Y+G WGQ +DPVFEELLY Sbjct: 301 ELYNGKWGQQIDPVFEELLY 320 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16354 (432 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6548 680 0.0 >Contig6548 Length = 451 Score = 680 bits (1755), Expect = 0.0, Method: Compositional matrix adjust. Identities = 325/411 (79%), Positives = 352/411 (85%), Gaps = 7/411 (1%) Query: 27 NDRNGGTEQLQSSNNSSMAAR-----NEHAVDDPDAVASMVDMSIRNSTERRKLGYFSCG 81 N R G ++ SS NSS+A R NEHAVD+PD +ASMVDMSIRNSTERR LG+FSC Sbjct: 43 NSRFVGPKESISSKNSSIAERFEEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCA 102 Query: 82 TGNPIDDCWRCDHNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPGDDDPVNPKPGTL 141 TGNPIDDCWRCD +WQ +RKRLA+CGIGFGRNA+GGRDG++YVV +PG+DDPVNP+ GTL Sbjct: 103 TGNPIDDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGKYYVVNNPGNDDPVNPRAGTL 162 Query: 142 RHAVIQDAPLWIVFKRDMVITLKQELIMNSFKTIDGRGVNVHIANGACITVQFVTNVIIH 201 RHAVIQD PLWIVFKRDMVITLKQELIMNSFKTID RGVNVHIA GACIT+Q+VTNVIIH Sbjct: 163 RHAVIQDRPLWIVFKRDMVITLKQELIMNSFKTIDARGVNVHIAYGACITIQYVTNVIIH 222 Query: 202 GLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAISIFGSSHIWVDHNSLSSCADGLVDAVM 261 GLHIHDCKPTGNAMVRSSP+H+GWRTMADGDAISIFGSSHIW+DHNS S CADGLVDA+M Sbjct: 223 GLHIHDCKPTGNAMVRSSPNHYGWRTMADGDAISIFGSSHIWIDHNSFSKCADGLVDAIM 282 Query: 262 GSTAITISNNHFAHHNEVMLLGHSDSYERDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHV 321 GSTA+TISNN+F HHNEVMLLGHSDSY RDK MQVTIAYNHFGEGLIQRMPRCRHGYFHV Sbjct: 283 GSTALTISNNYFTHHNEVMLLGHSDSYVRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHV 342 Query: 322 VNNDYTHWEMYAIGGSASPTINSQGNRYLAPVNPFAKEVTKRVDTPSGQWKGWNWRSEGD 381 VNNDYTHWEMYAIGGSA PTINSQGNRYLAP N FAKEVT RV+ WK WNWRSEGD Sbjct: 343 VNNDYTHWEMYAIGGSAEPTINSQGNRYLAPNNGFAKEVTHRVN--PNDWKHWNWRSEGD 400 Query: 382 LLLNGAYFTPXXXXXXXXXXXXXXXXXKSSSMVGSITSNAGALSCRRGSQC 432 LLLNGAYF KSSSMVGSIT++AG L+CRRG QC Sbjct: 401 LLLNGAYFIASGTGSGASYARASSLGAKSSSMVGSITASAGVLNCRRGFQC 451 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12724 (298 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2612 104 2e-24 >Contig2612 Length = 248 Score = 104 bits (260), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 75/224 (33%), Positives = 109/224 (48%), Gaps = 18/224 (8%) Query: 76 AEFVGTFILIFAATAGPIVNQKYSGVETL-----IGNAACAGLAVMIVILSTGHISGAHL 130 AEF+ T + +FA I K + L + A G A+ + + +ISG H+ Sbjct: 23 AEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVAIAHGFALFVAVSIGANISGGHV 82 Query: 131 NPSLTIAFAALRHFPWVQVPAYIAAQVSASICASFALKAVFHPFMSGGVTVPSVSIG--- 187 NP++T A + Y AQ+ +I A+F LK F++GG+T+P S+ Sbjct: 83 NPAVTFGLALGGQITILTGIFYWIAQLVGAIVAAFILK-----FVTGGLTIPIHSLAAGV 137 Query: 188 ---QAFALEFLITFNLLFXXXXXXX--XXXXXGELAGIAVGATVMLNILVAGPSSGGSMN 242 Q E +ITF L++ G +A IA+G V NIL AGP SGGSMN Sbjct: 138 GAIQGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMN 197 Query: 243 PVRTLGPAVAAGNYRAIWIYLVAPTLGAVAGAAIYTAVKLRADE 286 P R+ GPAVA+G++ WIY V P +G IY V + ++ Sbjct: 198 PARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNVFIHSEH 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26150 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44338 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4666256 (369 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3467 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23254 395 e-112 >Contig23254 Length = 289 Score = 395 bits (1014), Expect = e-112, Method: Compositional matrix adjust. Identities = 193/228 (84%), Positives = 209/228 (91%) Query: 1 MATFLFLYITILTVMGVKKSPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT 60 +ATFLFLYITILTVMGV KS + C +VGIQGIAWAFGG IFALVY TAGISGGHINPAVT Sbjct: 62 IATFLFLYITILTVMGVVKSKSKCTTVGIQGIAWAFGGTIFALVYSTAGISGGHINPAVT 121 Query: 61 FGLLLARKLSLTRAIFYIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTKGDG 120 FGL LARKLSLTRA+FYI+MQ LGAI GA VVKGFE S ++E+LGGGAN VN GYTKG G Sbjct: 122 FGLFLARKLSLTRAVFYIVMQTLGAIAGAAVVKGFEKSSTFELLGGGANSVNHGYTKGQG 181 Query: 121 LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA 180 LGAEI+GTFVLVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLVHLATIP+TGTGINPA Sbjct: 182 LGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPA 241 Query: 181 RSLGAAIIFNREHAWDDMWIFWVGPFIGAALAAMYQQIVIRAIPFKSR 228 RSLGAAII+N+ HAWDD WIFWVGPFIGAALAA+Y +VIRAIPFKS+ Sbjct: 242 RSLGAAIIYNKRHAWDDHWIFWVGPFIGAALAALYHVVVIRAIPFKSK 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv273 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31538 69 4e-14 >Contig31538 Length = 359 Score = 68.9 bits (167), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 27/34 (79%), Positives = 29/34 (85%) Query: 34 KTCADCGTTKTPLWRGGPAGPKSLCNACGIRSRK 67 + C+DC TTKTPLWR GP GPKSLCNACGIR RK Sbjct: 209 RVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQRK 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61701 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18203 97 4e-23 >Contig18203 Length = 221 Score = 97.4 bits (241), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 47/91 (51%), Positives = 64/91 (70%), Gaps = 2/91 (2%) Query: 3 HRVDAIDKEKFSFCYTVIDGD-VLTDGVESICHELTVVPAPGGGSIYKNTSKYHTKG-AE 60 HR+D IDK+ F + YT+I+GD +L+D +E + +E +V +P GGSI K+TS YH KG E Sbjct: 130 HRIDGIDKDNFVYSYTLIEGDGLLSDKIEKVAYETKLVASPDGGSIVKSTSHYHAKGDVE 189 Query: 61 VCEEHVKGGKEDALATFKAIEGYVLAHPDGY 91 + EE VK GKE A FK +E Y+LA+PD Y Sbjct: 190 IKEEQVKAGKEQASGLFKLVESYLLANPDAY 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17363 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17305 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5117 (304 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13025 414 e-117 >Contig13025 Length = 290 Score = 414 bits (1063), Expect = e-117, Method: Compositional matrix adjust. Identities = 198/295 (67%), Positives = 238/295 (80%), Gaps = 5/295 (1%) Query: 10 MGLGPDGELRYPSHHRVSKRGKVPGVGEFQCYDKNMLSLLKQHAEATGNPYWGLGGPHDA 69 M LGPDGEL+YPS R+ K K+PGVGEFQCYD+NMLS+LKQHAEA GNP WGLGGPHD Sbjct: 1 MSLGPDGELQYPSQRRLGK-NKIPGVGEFQCYDENMLSVLKQHAEAAGNPLWGLGGPHDV 59 Query: 70 PQYDGMPNSNNFFREHGGSWETPYGDFFLSWYSNQLISHGSSLLSLASTVFCNSPVAISG 129 P YD PN+NNFF++ GGSWE+PYGDFFLSWYSNQLISHG LL L S+ F ++ V I G Sbjct: 60 PSYDQSPNANNFFKDDGGSWESPYGDFFLSWYSNQLISHGDRLLDLVSSTFSDTEVEICG 119 Query: 130 KVPVVHSWYKTRSHPSELTAGFYNTVDKDGYERIAEIFAKNSCKMILPGMDLSDDHXXXX 189 KVP++HSWYKTRSHPSELT+GFYNT +DGY+ +A++FA+NSCK+ILPGMDLSD+H Sbjct: 120 KVPLMHSWYKTRSHPSELTSGFYNTSSRDGYQAVAQMFARNSCKIILPGMDLSDEHQPQD 179 Query: 190 XXXXXXXXXAQIKSACRKRGVQISGQNSSVSGAPGGFEQVKKNLLGEDGVVDLFTYQRMG 249 +QIK+ACRK GV+ISGQNSSVSGA GF+Q+KKNLLGE+ ++LFTYQRMG Sbjct: 180 SLSSPELLLSQIKTACRKHGVEISGQNSSVSGAREGFQQIKKNLLGENA-INLFTYQRMG 238 Query: 250 AYFFSPEHFPSFTELVRSLSQPEMLWDDMPNEEEEVGESLPVGSSSDKNLQMQVA 304 A FFSP+HFPSF+E VRSL+QP++ DD+P EEE V ES+P S S ++MQ A Sbjct: 239 ADFFSPDHFPSFSEFVRSLNQPQLQSDDLPIEEEAV-ESVPTNSES--VVRMQTA 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10510 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27931 125 3e-31 >Contig27931 Length = 137 Score = 125 bits (314), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 71/123 (57%), Positives = 83/123 (67%), Gaps = 5/123 (4%) Query: 17 SFKKNQVP---ISSLKSVSMPIKGKSFQSLRLRTGPSRLRVSCAAKPETVNKVCDIVRKQ 73 SFK P S LKSVS + GK F SL R P RL++SCAAKP+T+ KVC IV+KQ Sbjct: 14 SFKPALAPGSRSSGLKSVSFSVTGKHFPSLSSR--PGRLQISCAAKPDTITKVCSIVKKQ 71 Query: 74 LALPADSEVTGESKFATLGADSLDTVEIVMGLXXXXXXXXXXXSAQGIATVQDAADLIEQ 133 LAL D +V+ SKF+ LGADSLDTVEIVMGL +AQ IATVQDAADLIE Sbjct: 72 LALAEDVDVSAGSKFSELGADSLDTVEIVMGLEEAFGITVEEENAQTIATVQDAADLIED 131 Query: 134 LIS 136 L++ Sbjct: 132 LVA 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31695 (388 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14550 (68 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14766260 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8447 430 e-122 >Contig8447 Length = 236 Score = 430 bits (1106), Expect = e-122, Method: Compositional matrix adjust. Identities = 207/236 (87%), Positives = 222/236 (94%) Query: 1 MLGVFSSSIMSPPDELVAAGCRTPSPKITAEALMNRFIQGNPSAVSVHVGDHVQLAYTHH 60 MLGVFSS+I+SPP+ELVAAG RTPSPKITA +L+NRF+Q N +AVSV VGD QLAY+H Sbjct: 1 MLGVFSSAIVSPPEELVAAGSRTPSPKITATSLVNRFVQTNDAAVSVQVGDDAQLAYSHS 60 Query: 61 NESPLLPRSFAVKDEIFSLFEGALDNLGSLRQQYGLAKSANEVVLVIEAYKALRDRAPYP 120 NES L PRSFAVKDEIF LFEGALDNLGSLRQQYGLAKSANEV+LVIEAYKALRDRAPYP Sbjct: 61 NESALQPRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP 120 Query: 121 PNHVVGHLSGSFAFIVFDKSTSTLFVASDQFGKVPLSWGITADGYVAFADDAELLKGACG 180 PNHVVGHLSG+FAFIVFDKSTST+FVASDQFGK+PLSWGITADGYVAFADDAELLKGACG Sbjct: 121 PNHVVGHLSGNFAFIVFDKSTSTVFVASDQFGKIPLSWGITADGYVAFADDAELLKGACG 180 Query: 181 KSLASFPQGCFFSTAVGELRSFENPKNKITAVPAPDEEIWGATFKVEGPAVFAATK 236 KSLASFPQGCF+ST+VG LRS+ENPKNKITAVPA DEEIWGATFKVEGPAV AATK Sbjct: 181 KSLASFPQGCFYSTSVGGLRSYENPKNKITAVPATDEEIWGATFKVEGPAVLAATK 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2098 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29128 149 1e-38 >Contig29128 Length = 122 Score = 149 bits (377), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 79/120 (65%), Positives = 92/120 (76%), Gaps = 4/120 (3%) Query: 1 MEVAME-IEDDLFFQDLSKQISLLIMDDDEDPVARCPSVSLQAFSRVIHPSTQYPILHDQ 59 MEVAME +EDDLFF DL+KQISLLIMDD+EDP+A CPSVSLQAFS IHP +L++Q Sbjct: 1 MEVAMEKLEDDLFFADLTKQISLLIMDDEEDPIATCPSVSLQAFSCAIHPPAHPALLYEQ 60 Query: 60 NCRRESKGTGVFIPRSSQPRRKNRQGRFNSSNTKSQR--QPD-NTRGVSHLSYKNSFNPK 116 +CRRE+KGTGVFIP+S +PRRK+RQGRF S TKS R Q D N VS S +F PK Sbjct: 61 SCRRETKGTGVFIPQSIRPRRKHRQGRFASYKTKSHRSSQADHNKTMVSQASSDCAFRPK 120 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45298 (272 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13235 (522 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9935 811 0.0 >Contig9935 Length = 521 Score = 811 bits (2095), Expect = 0.0, Method: Compositional matrix adjust. Identities = 404/526 (76%), Positives = 446/526 (84%), Gaps = 10/526 (1%) Query: 1 MGSIPDPGDISGELNPPSFDDFQKQTSLMTSCTLLWKELSDHFTSLEQNLQKKSEALKNK 60 MGSIPDPG+++ EL PPSFD+FQ+QTSLMTSCTLLWKELSDHF+SLEQNL KKSEA+K K Sbjct: 1 MGSIPDPGELT-ELTPPSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSEAIKLK 59 Query: 61 FQTLDHHTKESLGVLKKREVTIDGSVEIALGKVEESREAALIALLKGAQD---GEVDDSE 117 QTL+ TK SL L++REVTI S EIALGKVE+S+EAAL L +G D GEVDD E Sbjct: 60 IQTLEQDTKASLDELEQREVTIRDSFEIALGKVEKSKEAALKVLKRGRSDDEYGEVDDGE 119 Query: 118 GLLLKLKSFCLKMDSKEFWRFITARKKELDVLRAQTPEALAECVDPAKFVLEAISEVFPV 177 GLL+ LKS CLKMDS FWRF+TARKKEL+ LR+Q P AL +CVDP KFVLEAISEVFPV Sbjct: 120 GLLMNLKSLCLKMDSGGFWRFVTARKKELEGLRSQMPVALGDCVDPGKFVLEAISEVFPV 179 Query: 178 DKRVEKSERSNDLGWACVLVLESLIPVVVDPVLGKSRLLVTPSVKERAKDIAETWKASLD 237 DKR+E+S+R NDLGWACVL+LESLIPVVVDP +G+ RLLVT SVK+RA ++AETWKASL+ Sbjct: 180 DKRLERSDRGNDLGWACVLLLESLIPVVVDPKIGRKRLLVTRSVKQRATEMAETWKASLE 239 Query: 238 QRGGIENVKTPDVHTFLQHLVTFGIVKEEDVDLYRKLVVGSAWRKQMPKLAVSLGLGDKM 297 +RGGIENVKTPDVHTFLQHLVTFGIVKEEDVDLYRKLVV SAWRKQMPKLAVSLGL +M Sbjct: 240 ERGGIENVKTPDVHTFLQHLVTFGIVKEEDVDLYRKLVVSSAWRKQMPKLAVSLGLAKQM 299 Query: 298 ADMIEELVNRGQQVDAVHFTYEVGLVDKFPPVPLLKAFLRDSKKAATSILEDPNNSGRAV 357 DMIEEL++RGQQ+DAVHFTYEVGLV KFPPVPLLKAFL+D+KKAA SILEDPNN+GRA Sbjct: 300 PDMIEELISRGQQLDAVHFTYEVGLVHKFPPVPLLKAFLKDAKKAAASILEDPNNAGRAA 359 Query: 358 NLAGRKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKAKTDKKRPAAVPANKRTRA 417 NLAGRKE SALRAV+KCIE+Y LE EFPPENLKKRLEQLEK K +KKRP VPANKRTRA Sbjct: 360 NLAGRKELSALRAVVKCIEDYNLETEFPPENLKKRLEQLEKVKPEKKRPVVVPANKRTRA 419 Query: 418 SNGGPMPPAKAGRLTNAYVSSFPAA-PTFIRSPSHTQXXXXXXXXXXXXXXXXXXXGSRS 476 +NGGPMPPAKAGRLTNAYVSSFP PTF+ SPSH Q GSRS Sbjct: 420 NNGGPMPPAKAGRLTNAYVSSFPTTPPTFVMSPSHGQ----YPAGFSPYHSPPTMYGSRS 475 Query: 477 PPANPYAYSPEAAPPLAGSYPGAPINYPAYGGYGNGMAPAYQQAYY 522 PP PYAYSPEAAPP AGSYPGAP+NYPAY YGNGM PAYQQAYY Sbjct: 476 PP-TPYAYSPEAAPPPAGSYPGAPMNYPAYAAYGNGMVPAYQQAYY 520 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14277 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40892 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20836 202 2e-54 >Contig20836 Length = 131 Score = 202 bits (514), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 97/131 (74%), Positives = 111/131 (84%) Query: 1 MKDFPGTPGTWTGLILRISQCMFAAGSIASMATTSSFFSVTAFCYLIASMGLQVIWSFGL 60 M+DFPGTPGT TGL+LRISQC+FAAGSIASMATT+SFF+ TAFCYLIASMGLQ+IWS L Sbjct: 1 MRDFPGTPGTLTGLLLRISQCVFAAGSIASMATTASFFNFTAFCYLIASMGLQLIWSLVL 60 Query: 61 AFLDAYALVKKKVLHNPVLVSLFVVGDWVTXXXXXXXXXXXXGITVLYYSDFGDCDFGKE 120 A LDAY+LVKKKVLHNPVLVSLFVVGDWVT G+TVLY+SD DC++G+E Sbjct: 61 ALLDAYSLVKKKVLHNPVLVSLFVVGDWVTATLSLAAASASAGVTVLYFSDLNDCNYGRE 120 Query: 121 CQKYQISVALA 131 CQKYQ++V LA Sbjct: 121 CQKYQMAVGLA 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21866262 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31766264 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31166264 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31266263 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61660 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17266259 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52645 (464 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12395 351 1e-98 >Contig12395 Length = 323 Score = 351 bits (901), Expect = 1e-98, Method: Compositional matrix adjust. Identities = 158/191 (82%), Positives = 175/191 (91%) Query: 107 MLADQLINRVEYMHSRGFLHRDIKPDNFLMGLGRKANQVYIIDYGLAKKYRDFQTHKHIP 166 MLADQ+I R+E+ HS+GFLHRDIKPDNFLMGLGRKANQVYIID+GLAK+YRD T++HIP Sbjct: 1 MLADQMITRIEFAHSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDATTNRHIP 60 Query: 167 YRENKNLTGTARYASVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYD 226 YRENKNLTGTARYAS NTHLG+EQSRRDDLESLGYVL+YFLRGSLPWQGLKA TKKQKYD Sbjct: 61 YRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKADTKKQKYD 120 Query: 227 KISEKKMLTPIEVLCKSYPSEFTSYFHYCRSLRFDDKPDYSYLKRLFRDLFIREGYQFDY 286 KI EKK+ TPIEVLCKS+P EF SYFHYC SL FD +PDY +LKRLFRDLF REGY+FDY Sbjct: 121 KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLFSREGYEFDY 180 Query: 287 VFDWTVLKYPQ 297 VFDWT++KY Q Sbjct: 181 VFDWTIIKYQQ 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38923 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57457 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3484 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11600 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28888 136 3e-34 >Contig28888 Length = 401 Score = 136 bits (342), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 79/197 (40%), Positives = 106/197 (53%), Gaps = 23/197 (11%) Query: 2 ILMVGDLSYANQYRTTGGKGVPCFSCAFPDAPIRETYQPRWDGWGRFMEPLTSRVPMMVI 61 +L VGDLSYA+ Y F D RWD WGRF+E + P + Sbjct: 198 LLFVGDLSYADDY-------------PFHD-------NNRWDTWGRFVERNVAYQPWIWT 237 Query: 62 ESNHDIE--PQVAGIT-FKSYLTRFAVPSKESGSKSNFYYSFDAGGVHFIMLGAYVDYNR 118 NH+I+ P++ T FK Y R+ VP + SGS S +YS + I+L +Y Y + Sbjct: 238 AGNHEIDFVPELGESTPFKPYTNRYFVPYEASGSTSPLWYSIKRASAYIIVLSSYSAYGK 297 Query: 119 TGAQYAWLKKDLHQVDRSVTPWLVAAWHPPWYNSYSSHYQEFECMRQEMEALLYQYGVDI 178 QY WL+K+L +V+R+ TPWL+ H P Y+SY HY E E R E +Y VD+ Sbjct: 298 YTPQYKWLEKELPKVNRTETPWLIVLMHSPLYSSYVHHYMEGESFRVMYEEWFVEYEVDV 357 Query: 179 VFSGHVHAYERMNRVYN 195 VF+GHVHAYER R+ N Sbjct: 358 VFAGHVHAYERSERISN 374 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8908 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18590 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29575 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30088 (140 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14765 72 5e-15 >Contig14765 Length = 173 Score = 71.6 bits (174), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 45/121 (37%), Positives = 61/121 (50%), Gaps = 18/121 (14%) Query: 2 ITAGADFMLIPSRFEPCGLIQLHAMRYGTVPICAATGGLVDTV----------KEGFTGF 51 ITAG D +L+PSRFEPCGL QL+AMRYGTVP+ +TGGL DTV K TG+ Sbjct: 50 ITAGCDILLMPSRFEPCGLNQLYAMRYGTVPVVHSTGGLRDTVVNFNPYAQGGKGDGTGW 109 Query: 52 HMGPFNVECDRIDPADVDAVAITVKRALATYGTAALGEMIQNCMALDLSWKGPSKNWEEL 111 P E + A R Y + G +++ M D +W+ + +E + Sbjct: 110 TFSPLTKE-------SMLAALKLACRTFREYKPSWEG-LMKRGMERDFTWESAAIKYERV 161 Query: 112 L 112 Sbjct: 162 F 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14266263 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21228 67 1e-13 >Contig21228 Length = 247 Score = 67.4 bits (163), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 5/97 (5%) Query: 51 CLRCCATDDESSSTRIFIKGLPQSTCEGSLKKAFSQFGEVSKVRIKRNKISSQPLGFAFA 110 +RC ++ S+++FI G+ T + SL++AF ++GEV RI ++ S + GF F Sbjct: 33 AIRCMSS---MGSSKLFIGGVSYQTDDQSLREAFQKYGEVVDARIIMDRESGRSRGFGFV 89 Query: 111 WFTTEESAQLAVKMMDGKFFHGRFVFVKIA--KPGPS 145 FT+ E A A++ +DG+ HGR V V A +P PS Sbjct: 90 TFTSNEEAASALEALDGQELHGRRVRVNYATERPRPS 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61491 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30966264 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47574 (207 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17769 209 2e-56 >Contig17769 Length = 297 Score = 209 bits (533), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 107/214 (50%), Positives = 139/214 (64%), Gaps = 40/214 (18%) Query: 4 LFKNYGSTLAGLRALGYNIDADDYHSFVHGRLPYELIKPDSQLRSLLRSIALRKIILTNS 63 L+KNYG+T+AGLRA+GY+ D D+YHSFVHGRLPYE IKPD LRSLL ++ RKII TN+ Sbjct: 63 LYKNYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFTNA 122 Query: 64 DRNHAIKVLDRLGLQDCFDQIICFETMNPNLPKST------------------------- 98 D+ HA K L RLGL+D F+ IICFET+NP + K+T Sbjct: 123 DKIHAAKALSRLGLEDIFEGIICFETLNP-IHKNTVSDDEDDIEFVGLSSTTTTTSSSQI 181 Query: 99 --------------RLDEFPVILNPSLDAMKIALDAANVNPPRTLFLDDNVRNIAAGKAL 144 +L + P++ PS DA++ AL AN+NP RTLF +D+VRNI AGK + Sbjct: 182 FDIIGHFATPNPTSKLPKTPIVCKPSEDAIERALKIANINPQRTLFFEDSVRNIQAGKRV 241 Query: 145 GLRTVLVGKTMKTKEADYVLETVHNLAQVIPEIW 178 GL+TVLVG + + K ADY LE++HNL + IPE+W Sbjct: 242 GLQTVLVGTSQRVKGADYALESIHNLREAIPELW 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27366263 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11258 (222 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7295 388 e-110 >Contig7295 Length = 679 Score = 388 bits (997), Expect = e-110, Method: Compositional matrix adjust. Identities = 183/226 (80%), Positives = 197/226 (87%), Gaps = 4/226 (1%) Query: 1 MIRDLLVSFRKATGQKPLRIIFYRDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTF 60 MI++LL+SFR+ATGQKP RIIFYRDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTF Sbjct: 454 MIKELLISFRRATGQKPQRIIFYRDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTF 513 Query: 61 IVVQKRHHTRLFANNHRDRNSTDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRP 120 +VVQKRHHTRLFANNH DRN+ DRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRP Sbjct: 514 VVVQKRHHTRLFANNHSDRNAVDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRP 573 Query: 121 AHYHVLWDENNFTADGIQSLTNNLCYWYARCTRSVSVVPPAYYAHLAAFRARFYMEPDMQ 180 AHYHVLWDEN FTAD +QSLTNNLCY YARCTRSVS+VPPAYYAHLAAFRARFY+EP+ Sbjct: 574 AHYHVLWDENKFTADELQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYLEPETS 633 Query: 181 EXXXXXXXXXXHAA---KATRASG-ETGVRPLPALKENVKRIMFYC 222 + ++TRA G VRPLPALKENVKR+MFYC Sbjct: 634 DSGSMTSGAPGRGGMGPRSTRAPGPNAAVRPLPALKENVKRVMFYC 679 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57770 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9746 136 2e-34 >Contig9746 Length = 169 Score = 136 bits (342), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 68/142 (47%), Positives = 100/142 (70%) Query: 5 LSEEQIVEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMIREVDADGNGSI 64 L++++ E KEAF LFD DG G I +EL +R+L TEE++ MI +VD DG+G+I Sbjct: 21 LTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAI 80 Query: 65 EFAEFLNLMAKKVKETDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDEEVEQ 124 +F EF ++M K+ E D +EEL +AF++ D D+NG ISA +++ + +LGE TD E+++ Sbjct: 81 DFDEFAHMMTAKIGERDTKEELMKAFQLIDLDRNGKISAADIKSIAKDLGENFTDSEIQE 140 Query: 125 MIREADLDGDGQVNYDEFVKMM 146 MI EAD D DG+VN DEF++MM Sbjct: 141 MIEEADRDRDGEVNADEFIRMM 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8254 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13666262 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21866260 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22666258 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31266265 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33910 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3802 103 1e-24 >Contig3802 Length = 163 Score = 103 bits (258), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 64/141 (45%), Positives = 79/141 (56%), Gaps = 12/141 (8%) Query: 10 GDIKCEISCDEVSKTAENFLALCA-------SG---YYDGTIFHRNIKGFMIQXXX-XXX 58 G I E+ D +TAENF ALC SG +Y G+ FHR I GFM Q Sbjct: 9 GRIVMELDADTTPRTAENFRALCTGEKGVGRSGKPPHYKGSAFHRVIPGFMCQGGDFTAG 68 Query: 59 XXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFITYAKQPHLNGLYTVF 118 SI+G KF DE + KH GILSMAN+GP TNGSQFFI AK L+G + VF Sbjct: 69 NGTGGESIYGAKFADE-NFNKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLDGKHVVF 127 Query: 119 GRVIHGFEVLDIMEKTQTGAG 139 G+V+ G +V+ +EK +G G Sbjct: 128 GQVVEGLDVVKNIEKVGSGQG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55468 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49783 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4544 162 2e-42 >Contig4544 Length = 232 Score = 162 bits (411), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 79/147 (53%), Positives = 100/147 (68%), Gaps = 7/147 (4%) Query: 1 MDMNAFFGGFAAALTSDPVWVMNVVPPR-KPSTLGVIYDRGLIGVYHDWCEPFSTYPRTY 59 MDMNA+ GGFAAAL+ PVWVM+ VP TLGVIY+RG IG Y DWCE FSTYPRTY Sbjct: 84 MDMNAYLGGFAAALSKYPVWVMSTVPANSNQDTLGVIYERGFIGTYQDWCEAFSTYPRTY 143 Query: 60 DLIHVTSIESLIKILGSGKNRCNLVDLMVEMDRILRPEGTVVIRDSPEVIDKIGRIAQAV 119 DLIH + S+ + +RC++ +++EMDRILRPEGTVV RD+ E++ KI I + Sbjct: 144 DLIHAGGVFSIYQ------DRCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAITDGM 197 Query: 120 RWTATIHEKEPESHGREKILVATKNFW 146 RW + I + E EKIL+A K +W Sbjct: 198 RWKSQIMDHESGPFNPEKILLAVKTYW 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59326 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18031 276 3e-76 >Contig18031 Length = 274 Score = 276 bits (705), Expect = 3e-76, Method: Compositional matrix adjust. Identities = 140/187 (74%), Positives = 165/187 (88%), Gaps = 2/187 (1%) Query: 1 MLPNRASANRLGAPIKSSAGYRDSLEEKSKANLVRIKGRFSVTSENVDLVKDIPLCAVAR 60 MLPNRASAN L APIKSS G+RDS+++KSK+NLV+IKGRFSVTSEN+DLVKDIP +V Sbjct: 88 MLPNRASANSLSAPIKSSGGFRDSMDDKSKSNLVQIKGRFSVTSENLDLVKDIPSSSVPH 147 Query: 61 RSSQGSPLRKSASVGDWMFDSK--PMLTTPKDFSNSNVPASLLMPHLQNLFQQTSLQQDL 118 SSQGSPL+KSASVGDW+F+S+ P +PK+F+NSNVPASLL+PHLQNLFQQTS+QQD+ Sbjct: 148 HSSQGSPLKKSASVGDWVFESRQTPATVSPKEFNNSNVPASLLLPHLQNLFQQTSVQQDI 207 Query: 119 ITNLLNSLQSSEIVDASQNGKLPPLPRGSENNGNVDPGASERERLLLLKVSELHARMINL 178 I NLL+SLQ +E V+A+QNGKLPPLPR SENNGNV+ SERERLLL+KVSEL ARM NL Sbjct: 208 IMNLLSSLQPAEAVEATQNGKLPPLPRSSENNGNVETAVSERERLLLVKVSELQARMNNL 267 Query: 179 TDELTAE 185 +DELTAE Sbjct: 268 SDELTAE 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58826 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21748 181 8e-48 >Contig21748 Length = 172 Score = 181 bits (460), Expect = 8e-48, Method: Compositional matrix adjust. Identities = 92/174 (52%), Positives = 119/174 (68%), Gaps = 4/174 (2%) Query: 22 LPYVSKVRQIEGTTLYGSRALFFLTPDGTLKPLAIELTRPPIEGKP--QWKQVFTPTSES 79 +PY+ ++ T Y SR L FL DGTLKPLAIEL+ P +G V+TP+S+ Sbjct: 1 MPYLRRINATSTKT-YASRTLLFLQDDGTLKPLAIELSLPHPDGDQFGCTSNVYTPSSQG 59 Query: 80 TGRWLWRLAKVHFLAHDSGYHQLVSHWLRTHCVTEPYIIATNRQLSVMHPIYRLLHPHFR 139 +W+LAK + DSGYHQL+SHWL TH EP+IIATNRQLSV+HPI++LLHPHFR Sbjct: 60 VESSIWQLAKAYVAVVDSGYHQLISHWLTTHAAMEPFIIATNRQLSVLHPIHKLLHPHFR 119 Query: 140 YTMHINAHARESLINAEGIIESSFSPGKYSVELSSVAYDQQWRFDREALPADLI 193 M++NA AR+ LINA GI+E++ P K+S+E SS Y + W F +ALP DLI Sbjct: 120 DNMNVNALARQVLINAGGILEATLFPAKFSMEWSSAMY-KNWVFPEQALPVDLI 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29881 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25941 (117 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14651 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22262 385 e-109 >Contig22262 Length = 299 Score = 385 bits (990), Expect = e-109, Method: Compositional matrix adjust. Identities = 185/227 (81%), Positives = 201/227 (88%) Query: 1 MPQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE 60 + QI SASIAGD+VLA+AY+HELPHYGLEVGLTNYAAAYCTGLLLARRVLK LEMD EYE Sbjct: 61 VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE 120 Query: 61 GNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFXXXXXXXXXXXXIPHSDKRFA 120 GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVF IPHS+KRFA Sbjct: 121 GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFA 180 Query: 121 GFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYK 180 GFSKDSKQLDAEVHRKYIYGGHV+AYM TL EDEPEKYQ+HFSEYIKKG+E D+IEE+YK Sbjct: 181 GFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYK 240 Query: 181 KVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNAL 227 KVHAAIRA+P KK EKQPPKEHKRYNLKKLT++ERK KL+ERL A Sbjct: 241 KVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20866257 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10885 (306 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21879 (355 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7270 141 2e-35 >Contig7270 Length = 365 Score = 141 bits (355), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 96/356 (26%), Positives = 169/356 (47%), Gaps = 21/356 (5%) Query: 5 VAPRVESLSS-SGIQSIPKEYIRPQEELTSIG-NVFEEEKKDEGPQVPTIDLKDIXXXXX 62 +AP +L+S + +++ ++++R ++E + N F E +P I L I Sbjct: 1 MAPATTTLTSIAHEKTLQQKFVRDEDERPKVAYNDFSNE-------IPIISLAGIDEVEG 53 Query: 63 XXXXXXXXXLKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQASG 122 + A +WG+ +V+HG+ +LI+ + FF LP EEK ++ D + G Sbjct: 54 RRGEICKKIVA-ACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLRF--DMSGG 110 Query: 123 KIAGYGSKLANNASGQLEWEDYFFHLIFPEDKRDMTIWPKTPSDYVPATCEYSVKLRSLA 182 K G+ +W + + +P RD + WP P + T +YS +L LA Sbjct: 111 KKGGFIVSSHLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLA 170 Query: 183 TKIXXXXXXXXXXXXXXXXXXXXXMEELLLQKKINYYPKCPQPELALGVEAHTDVSALTF 242 K+ M++ ++ +N+YPKCPQP+L LG++ HTD +T Sbjct: 171 CKLLGVLSEAMGLDTEALTKACVDMDQKVV---VNFYPKCPQPDLTLGLKRHTDPGTITL 227 Query: 243 ILHNMVPGLQLFY-EGK-WVTAKCVPNSIIMHIGDTIEILSNGKYKSILHRGLVNKEKVR 300 +L + V GLQ +GK W+T + V + ++++GD +LSNG++K+ H+ +VN R Sbjct: 228 LLQDQVGGLQATRDDGKTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSR 287 Query: 301 ISWAVFCXXXXXXXXXXXXXXTVSETEPPLF-PPRTFSQHIQHKLFRKTQEALLSK 355 +S A F +V E E P+ P T+++ + K+ + + A L K Sbjct: 288 LSIATF---QNPAQEAIVYPLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKK 340 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48314 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34770 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45203 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29966 (256 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51062 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18416 (340 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24121 217 2e-58 >Contig24121 Length = 439 Score = 217 bits (552), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 117/289 (40%), Positives = 171/289 (59%), Gaps = 24/289 (8%) Query: 4 RYDALKELGSGNFGVARLVRDKKTKELVAVKYIERGK----KIDENVQREIINHRSLRHP 59 +Y+ + +G G F + R+ +T E VA+K +++ K K+ E ++REI + ++HP Sbjct: 12 KYEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKLIKHP 71 Query: 60 NIVRFKEVLLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSME 119 N+V+ EV+ + T + IVME+ GGELF++I N GR EDEAR +FQQLI+ V YCHS Sbjct: 72 NVVQLYEVMGSKTKIFIVMEFVTGGELFDKIVNNGRMKEDEARRYFQQLINAVDYCHSRG 131 Query: 120 ICHRDLKLENTLLDGSPMPRLKICDFGYS-------KSALLHSQPKSAVGTPAYIAPEVL 172 + HRDLK EN LLD LK+ DFG S LLH + GTP Y+APEVL Sbjct: 132 VYHRDLKPENLLLDA--YGNLKVSDFGLSALSQQVRDDGLLH----TTCGTPNYVAPEVL 185 Query: 173 SRKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEDPRNFRKTIGRIMSVQYSIPDYVHVSA 232 + + YDG AD+WSCGV L+V+L G PF+D N +I + +++ P ++ A Sbjct: 186 NDRGYDGATADLWSCGVILFVLLAGYLPFDDS----NLMNLYKKISAAEFTCPPWLSFGA 241 Query: 233 ECRQLLSRIFVANPAKRITIPEIKQHPWFLKNFPKELI-EGEKTNYGEL 280 +L++RI NP R+TI EI + WF K++ + E E TN ++ Sbjct: 242 --MKLIARILDPNPMTRVTIAEILEDEWFKKDYKAPVFEEKENTNLDDV 288 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59103 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24317 (608 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10347 (316 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21036 96 6e-22 >Contig21036 Length = 153 Score = 96.3 bits (238), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 39/55 (70%), Positives = 50/55 (90%), Gaps = 1/55 (1%) Query: 43 PQKDQAVNCPRCSSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGG 97 P+++Q + CPRC S+NTKFCYYNNY+L+QPR+FCK C+RYWT+GG LRN+PVGGG Sbjct: 15 PEQEQ-LKCPRCESSNTKFCYYNNYNLSQPRHFCKNCKRYWTKGGALRNIPVGGG 68 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24788 (318 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66003 (440 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11566258 (537 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91046348 99 1e-22 >91046348 Length = 220 Score = 99.4 bits (246), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 41/70 (58%), Positives = 56/70 (80%) Query: 136 QTRKPYTITKQRERWTEEEHNRFLEALKLYGRAWQRIEEHIGTKTAVQIRSHAQKFFSKL 195 + RKPYTITK RE WT+EEH++FLEAL+L+ R W++IE+ +G+KT +QIRSHAQK+F K+ Sbjct: 27 KVRKPYTITKSRESWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKV 86 Query: 196 EKEALVKGVP 205 +K VP Sbjct: 87 QKSGTTAHVP 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28035 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6753 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11853 67 1e-13 >Contig11853 Length = 226 Score = 67.4 bits (163), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 4/75 (5%) Query: 1 RVLSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRL----RERSLQRKQ 56 +VLS T S+S CERNWSTF IHTK+RN+L H L LVY YN +L +E + Sbjct: 15 KVLSQTASSSACERNWSTFALIHTKQRNKLAHSSLEKLVYCYYNMKLQIRDKEAEIDHVD 74 Query: 57 NVDPILVEEIDSDDE 71 DP+ V +I +D+ Sbjct: 75 RGDPLDVFDIVVEDD 89 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv318 (316 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21204 260 2e-71 >Contig21204 Length = 291 Score = 260 bits (665), Expect = 2e-71, Method: Compositional matrix adjust. Identities = 125/211 (59%), Positives = 158/211 (74%), Gaps = 1/211 (0%) Query: 54 VTQLSWRPRAFLYKGFLSEEECDHLITLAKDKLEKSMVADNESGKSIMSEVRTSSGMFLL 113 V +SW PRAF+Y FL++EECD+LI LAK + KS V D+E+GKS S VRTSSG FL Sbjct: 80 VEVISWEPRAFVYHNFLTKEECDYLIDLAKPTMHKSTVVDSETGKSKDSRVRTSSGTFLA 139 Query: 114 KAQDEIVADIEARIAAWTFLPVENGESIQILHYENGEKCEPHFDYFHDKVNQLLGGHRIA 173 + +D+I+ +IE +IA +TFLPVE+GE +Q+LHYE G+K EPH+DYF D N GG RI Sbjct: 140 RGRDKIIRNIEKKIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDDFNTKNGGQRIG 199 Query: 174 TVLMYLATVDEGGETVFPNSEGRFSQ-PKDDSWSDCAKKGYAVNPKKGDALLFFSLHPDA 232 TVLMYL+ V+EGGETVFP ++G S P + S+C KKG +V PK GDALLF+S+ PDA Sbjct: 200 TVLMYLSDVEEGGETVFPAAKGNISSVPWWNELSECGKKGLSVKPKMGDALLFWSMRPDA 259 Query: 233 TTDPSSLHGSCPVIVGEKWSATKWIHVRSFD 263 + DPSSLHG CPVI G KWS+TKWI V ++ Sbjct: 260 SLDPSSLHGGCPVIKGNKWSSTKWIRVNEYN 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30007 (8 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17326 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24312 91 8e-21 >Contig24312 Length = 482 Score = 90.5 bits (223), Expect = 8e-21, Method: Compositional matrix adjust. Identities = 50/112 (44%), Positives = 62/112 (55%), Gaps = 13/112 (11%) Query: 3 LLPLIAYLLEQNIRILLYSGDQDAKVPFTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVG 62 +L + L+ +RI ++SGD DA +P T TR + L KL + WYD QVG Sbjct: 367 VLDVYKELIHSGLRIWMFSGDNDAVIPITSTRYSIDAL----KLPTVKPWRAWYDDGQVG 422 Query: 63 GWSQSFGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPP 114 GW+Q + L TF +VRGA HEVP P QALTL KSFLSGS P Sbjct: 423 GWTQEYAGL---------TFVSVRGAGHEVPLHKPKQALTLIKSFLSGSSMP 465 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3309 (273 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23118 415 e-118 >Contig23118 Length = 290 Score = 415 bits (1067), Expect = e-118, Method: Compositional matrix adjust. Identities = 214/274 (78%), Positives = 221/274 (80%), Gaps = 2/274 (0%) Query: 1 MLGNPL-NFSGXXXXXXXXXXXXXFKTVALFSXXXXXXXXXXXXXVSPADEELAKWYGPD 59 +LGN L NFS FKTVALFS ADEELAKWYGPD Sbjct: 18 VLGNSLGNFSRTARSAPSATTPATFKTVALFSKKKAAPPPKAKAVAP-ADEELAKWYGPD 76 Query: 60 RRIFLPEGLLDRSEIPAYLTGEVPGDYGYDPFGLSKKPEDFAKYQAYELIHARWAMLGAA 119 RRIFLP GLLDRSEIP YLTGEVPGDYGYDPFGL KKPEDF+KYQAYELIHARWAMLGAA Sbjct: 77 RRIFLPSGLLDRSEIPEYLTGEVPGDYGYDPFGLGKKPEDFSKYQAYELIHARWAMLGAA 136 Query: 120 GFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIFXXXXXXXXXXXXX 179 GFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIF Sbjct: 137 GFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIFAVVAEVVLLGGAE 196 Query: 180 YYRIINGLDLEDKLHPGGPFDPLGLANDPDQAALLKVKEIKNGRLAMFAMLGFFIQAYVT 239 YYRI NGL+LEDKLHPGGPFDPLGLA DPDQAALLKVKEIKNGRLAMF+MLGFF+QAYVT Sbjct: 197 YYRITNGLELEDKLHPGGPFDPLGLAKDPDQAALLKVKEIKNGRLAMFSMLGFFLQAYVT 256 Query: 240 GEGPVENLAAHLSDPFGNNLLTVIAGTAERAPTL 273 GEGPVENL+ HLSDPFGNNLLTVI G+ ERAPTL Sbjct: 257 GEGPVENLSKHLSDPFGNNLLTVIGGSIERAPTL 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54730 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54691 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59349 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25141 178 7e-47 >Contig25141 Length = 352 Score = 178 bits (451), Expect = 7e-47, Method: Compositional matrix adjust. Identities = 101/208 (48%), Positives = 127/208 (61%), Gaps = 9/208 (4%) Query: 3 LILVLYKGLQLTSTSSPLQFISLHQPLNSQQMKWVIGGLLLVAEDLLVSIWYIVQAQVME 62 L++VLYKG + ST S + L + WVIGGLL + LL S WYI+Q VM+ Sbjct: 152 LVVVLYKGPTILSTPSDPNPSPM---LGTPPTNWVIGGLLCALQFLLNSTWYILQTHVMK 208 Query: 63 VYPEELVVVFLSNLCLTIISAPVCLIAEKNLSVWRVELDIALAAIVFSAFWGSAFGMVVP 122 YP E+V+VFL NLC TIISAPVC IAE NLS WR+ DIAL AI++S GS+FG +V Sbjct: 209 AYPAEIVLVFLYNLCGTIISAPVCFIAETNLSAWRLRPDIALVAIIYSGCLGSSFGSLVH 268 Query: 123 TWVVRLKGPVYVAMFNPLSIVIATAMGVMFLGDTLYLXXXXXXXXXXXXXXXVTWGKAKE 182 TW + LKGPVY+++F PLSI IA A+ V+FLGD L L V WGK+KE Sbjct: 269 TWALHLKGPVYISIFKPLSIAIAAALSVIFLGDALSLGSVVGAIILSLGFYAVIWGKSKE 328 Query: 183 ETIEDFGVGSLESLSNPKIPLLLSCQSE 210 E ++ +G K PLL S + E Sbjct: 329 EQMKPLPIGM------GKAPLLESYKVE 350 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4621 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36823 (337 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41756 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19566262 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14466256 (321 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48995 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6580 209 3e-56 >Contig6580 Length = 269 Score = 209 bits (533), Expect = 3e-56, Method: Compositional matrix adjust. Identities = 105/172 (61%), Positives = 124/172 (72%), Gaps = 11/172 (6%) Query: 13 RLPPGFRFHPTDEELVVQYLKRKAYSCPLPASIIPEVDVCKADPWDLPGDL---EQERYF 69 +LPPGFRFHPTDEELVV YLK+KA S PLP +II EVD+ K DPW+LP EQE YF Sbjct: 14 QLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYF 73 Query: 70 FSTREAKYPNGNRSNRATVSGYWKATGIDKQIVASKGNQVVGMKKTLVFYRGKPPHGSRT 129 FS R+ KYPNG R NRA SGYWKATG DK +++S GN VG+KK LVFY GKPP G++T Sbjct: 74 FSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPPKGTKT 133 Query: 130 DWIMHEYRLV-GAETTPQRKSSTTQSSMA-------QAENWVLCRIFLKKRG 173 +WIMHEYRLV TT SSTT+ S A + ++WVLCRI+ K +G Sbjct: 134 NWIMHEYRLVNNTTTTINMSSSTTKPSDAANKKPSLRLDDWVLCRIYKKNKG 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54266 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226793997 68 1e-13 >226793997 Length = 135 Score = 67.8 bits (164), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 35/83 (42%), Positives = 50/83 (60%) Query: 91 LPIGKAKIEREGRDVTITAFSKMVGFALKAADILAKDGISAEIINLRSIRPLDTPTINAS 150 LP+ +A++ REG D+T+ + + +A KDGIS E+I+LR++ P D T+ AS Sbjct: 2 LPLSEAEVIREGTDITLVGWGAQLSVMEQACKEAEKDGISCELIDLRTLLPWDKDTVEAS 61 Query: 151 VRKTNRLVTVEEGFPQHGVGAEI 173 VRKT RL+ E G GAEI Sbjct: 62 VRKTGRLLISHEAPVTGGFGAEI 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62107 (104 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28799 110 4e-27 >Contig28799 Length = 93 Score = 110 bits (276), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 54/102 (52%), Positives = 69/102 (67%), Gaps = 9/102 (8%) Query: 3 LNTGLRSASQLFKSCQQLVSKSVNRGFHSTGVKRMGEXXXXXXXXXXXXDEPFYLHAKHM 62 +N G+R+ ++L ++ + +SKS RGFHSTGVKRMG DEP Y+HAKHM Sbjct: 1 MNGGMRTCAKLLRASEAALSKSGTRGFHSTGVKRMG---------GHGHDEPAYMHAKHM 51 Query: 63 YNLDRMKYQKVQVPLAVLGVVCTGVGVPIFAVVYQQSKTTSA 104 YNLD+MK QK+QV L VL GVGVPI+AV +QQ KT+S Sbjct: 52 YNLDQMKNQKLQVSLGVLAAFSIGVGVPIWAVNFQQKKTSSG 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22814 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11397 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16567 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33921 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13102 74 1e-15 >Contig13102 Length = 291 Score = 73.6 bits (179), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 32/45 (71%), Positives = 40/45 (88%) Query: 1 MKLLQSLVPGCDKIIGKTLVLDEIINYVKSLQNQVEFLVGKLASI 45 MK+LQ LVPGC+K+IGK LVLDEIINY++SLQ+QVEFL KL ++ Sbjct: 188 MKILQDLVPGCNKVIGKALVLDEIINYIQSLQHQVEFLSMKLEAV 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40396 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv511 (309 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22665 253 3e-69 >Contig22665 Length = 161 Score = 253 bits (646), Expect = 3e-69, Method: Compositional matrix adjust. Identities = 118/148 (79%), Positives = 131/148 (88%) Query: 17 YGKPPWIFKGRALYQLHLVKAETARAFIPKEFRLVEAFGYTLGGFFLASYEDSPAGVFDE 76 YGKPPWIF+G ALYQLHLVKA T RA IPKEFRLVEAFGYTLGGFFLA+Y+DSP G+FDE Sbjct: 10 YGKPPWIFRGSALYQLHLVKAATVRACIPKEFRLVEAFGYTLGGFFLANYDDSPVGIFDE 69 Query: 77 LVVIAGIVWNPPTSCAWAARVLVNSDEACVHGRKAVGLPSQVARFSKRITAIPRQQRSKT 136 LVVIAG+VW+PPTSCAWAA+VLVNSDEAC HGRK VGLPSQVARFSKRITA+ RQ +SK Sbjct: 70 LVVIAGLVWSPPTSCAWAAKVLVNSDEACDHGRKEVGLPSQVARFSKRITAVSRQPKSKN 129 Query: 137 NGFLNMIGIGNTFNSPKDCMDVQVTEIE 164 GFL++IG F PKDCM+VQVTEI+ Sbjct: 130 IGFLSVIGSSAAFCDPKDCMEVQVTEIK 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32044 (601 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24483 526 e-151 >Contig24483 Length = 615 Score = 526 bits (1354), Expect = e-151, Method: Compositional matrix adjust. Identities = 245/340 (72%), Positives = 285/340 (83%), Gaps = 4/340 (1%) Query: 266 WGIKLFDDDRTDVVLLKFLRARDFKPKEALTMLKNTVLWRKSFGIETLLGDDLGTHLESV 325 WGI L D+R+DVVLLKFLRARDFK KEA +M+KNTV WRK +GIE LL +DLG+H + V Sbjct: 275 WGIPLLGDERSDVVLLKFLRARDFKVKEAFSMIKNTVRWRKEWGIEGLLEEDLGSHWDKV 334 Query: 326 VFMEGSGKEGHPVCYNAYGKFLNKELYQNTFSDEEKRQNFLRWRIQFLEKSIRKLDFSPN 385 VF G KEGHPVCYN +G+F NKELYQNTF+DEEKR F++WRIQFLEKSIRK DF+P Sbjct: 335 VFTHGVDKEGHPVCYNVFGEFQNKELYQNTFTDEEKRSKFIKWRIQFLEKSIRKFDFNPT 394 Query: 386 GINTIIQVNDLKNSPGPFKRELRQSTNQALHLLQDNYPEFVAKQIFINVPWWYLAFNRMI 445 GI+TI+QVNDLKN PG F RE Q TNQAL LLQDNYPEFVAKQ+FINVPWWYLAFNRMI Sbjct: 395 GISTIVQVNDLKNFPGFFNREHNQVTNQALQLLQDNYPEFVAKQVFINVPWWYLAFNRMI 454 Query: 446 SPFLTQRTKSKFVFAGPSKSAETLFKYIAPEQVPVQYGGLKR---DGDTEFSICDPVTLV 502 SPFLTQRTKSKFVFAGPSKSAETLFKYI PE VPV+YGGL + +G+ EF+ DPVT V Sbjct: 455 SPFLTQRTKSKFVFAGPSKSAETLFKYIGPEHVPVKYGGLSKEGVEGEHEFTTSDPVTEV 514 Query: 503 TIKPGCKHVIEFPYSEPCQ-LIWELRVIGWDVTYGAEFVPTVEGGYTVIVQKARKIAPTD 561 T+KP KH +E P SE + L+WE+RV+GW+V+YGAEFVP+ E YT+I+QK RK+ D Sbjct: 515 TVKPASKHTVEIPVSECGEVLVWEVRVVGWEVSYGAEFVPSAEDSYTIILQKTRKVGAAD 574 Query: 562 EPVISNSFKIGEPGKVILTIDNQTSKKKKLLYRSKTQPCD 601 EPVISN++KIGE GKV+LTIDNQ+SKKKKLLYRSKT+P + Sbjct: 575 EPVISNTYKIGEAGKVVLTIDNQSSKKKKLLYRSKTKPSE 614 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32531 (174 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12766262 (668 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24662 62 2e-11 >Contig24662 Length = 208 Score = 62.4 bits (150), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 43/156 (27%), Positives = 77/156 (49%), Gaps = 13/156 (8%) Query: 191 AVHAAARGGNLEILKELLHDCTDVLVYRDMQGSTILHTASGRGQVEIVKGLLE-SYDIIN 249 +H A GG+++++KELL C ++ D G++ LH AS +G EI LL ++ Sbjct: 46 CIHVAVSGGHIDVVKELLRVCPELARVVDENGNSPLHYASCKGHREITGMLLRIDPNLAQ 105 Query: 250 STDNQGNTALNVAAYRGYLTVLEVLILASPSSIFLTNNYGDTLLHMAVAGFRSPGFRRLD 309 +N G+T L++A ++VL+V + + S + G+T+ H+AV R Sbjct: 106 EYNNNGHTPLHLAVINYKVSVLQVFVSTAKPSFQMVTKSGETVFHLAV---------RYG 156 Query: 310 RQIELMKQLLRGKIVNMEDIINAKNNDGRTALHMAV 345 + LM + + + + ++ G T LH+AV Sbjct: 157 QHDALM---YLTHVCDDTEFFDCQDLHGNTILHLAV 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20757 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34244 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55636 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12663 (314 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50868 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44349 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26462 171 2e-44 >Contig26462 Length = 338 Score = 171 bits (432), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 94/217 (43%), Positives = 131/217 (60%), Gaps = 7/217 (3%) Query: 8 EWELRPGGMLVQKREXXXXXXXXXXXXXXXXXAMINIKVCHGSNHHQLHVPIQSTFGDLK 67 EWELRPGGMLVQKR I ++V +GS +H++ + QS+FGDLK Sbjct: 31 EWELRPGGMLVQKRNPDSDRNSAPP-------PTIRVRVKYGSIYHEMSISAQSSFGDLK 83 Query: 68 KRLVQETGLEPKDQRLLFRGKEIDDQECLQQVGVKDRSKLLLLEEMASKERKLEEARRSD 127 K LV TGL +DQ+L+F+ KE D + L GVKDRSK++L+E+ S+E++ E RR+ Sbjct: 84 KMLVGPTGLHHEDQKLIFKDKERDSKAFLDMSGVKDRSKMVLVEDPISQEKRYLEMRRNA 143 Query: 128 EISXXXXXXXXXXXXXXXLLEKVVALEATVNGGTTVENKEFVVLTELLMRQLLKLDGIEA 187 ++ L +V ALE+ + G V ++ +VL E LM QLLKLDGI Sbjct: 144 KMEKASKSISEISLEVDRLAGQVSALESIITKGKKVAEQDVLVLIEQLMNQLLKLDGIMG 203 Query: 188 EGEAKVQRRAEVRRVQSLVEMLDTLKARNSNPFSTKS 224 +G+ K+QR+ +V+RVQ VE LD LKA+NS+P S S Sbjct: 204 DGDVKLQRKMQVKRVQKYVETLDVLKAKNSSPSSNGS 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56723 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5751 (94 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14009 127 5e-32 >Contig14009 Length = 203 Score = 127 bits (318), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 57/94 (60%), Positives = 75/94 (79%) Query: 1 MTISDGNFAVTDVNGSVIIKVKGTLLSLRDHRVLLDAAGKPIVSLQSKMLSMHRRWKVFR 60 MTI +G F V+DVNG+++ +KG+L SL D RVL+D AG PIVS + K+++ HRRW+V+R Sbjct: 43 MTIKEGAFTVSDVNGNLMFNIKGSLFSLHDRRVLVDNAGNPIVSFRQKIMTAHRRWQVYR 102 Query: 61 GESSDPKDLLFSTKLSSIIQLKTALNVFLAANTK 94 GESSD KDLLFS K +S++Q KT L+VFLA NTK Sbjct: 103 GESSDSKDLLFSAKKASLLQFKTELDVFLAGNTK 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17283 (403 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26959 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23746 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12568 409 e-116 >Contig12568 Length = 272 Score = 409 bits (1051), Expect = e-116, Method: Compositional matrix adjust. Identities = 216/274 (78%), Positives = 228/274 (83%), Gaps = 17/274 (6%) Query: 1 MATNENLPPNVIKQLAKELKNLDETPPEGIKVVVNDDDFSTIFADVEGPAGTPYENGVFR 60 MATNENLPPNVIKQLAKELK+LDE+PPEGIKV VNDDDFS I+AD+EGPAGTPYENGVFR Sbjct: 1 MATNENLPPNVIKQLAKELKSLDESPPEGIKVGVNDDDFSIIYADIEGPAGTPYENGVFR 60 Query: 61 MKLLLSHDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI 120 MKLLLS DFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI Sbjct: 61 MKLLLSWDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI 120 Query: 121 EPFPESALNEQAGKMLLENYEEYARHARIYTGIHALKPKPKFKTGAISESTTALNVDQTN 180 EPFPESALNEQAGKMLLENYEEYARHAR+YTGIHA KPKPKFKTGAISESTTALNV+QTN Sbjct: 121 EPFPESALNEQAGKMLLENYEEYARHARLYTGIHA-KPKPKFKTGAISESTTALNVEQTN 179 Query: 181 SSVLNVEQKNTA-------LQLPPSSLA--TCMTAXXXXXXXXXQAPTTETGVSGSAAAT 231 +S LN +QKNTA + PS LA T T AP ETGVSGSAAA Sbjct: 180 TSTLNADQKNTAPGAALPVISASPSPLAPITVTTRGNGQDQPAVVAP-METGVSGSAAAA 238 Query: 232 PH------KKESGLAKVQADKKKMDARKKSLKRL 259 +K+ GL K QADKKK+DARKKSLKRL Sbjct: 239 SAAATTTVRKDGGLTKAQADKKKIDARKKSLKRL 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46022 (288 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9875 325 4e-91 >Contig9875 Length = 275 Score = 325 bits (834), Expect = 4e-91, Method: Compositional matrix adjust. Identities = 169/239 (70%), Positives = 199/239 (83%), Gaps = 13/239 (5%) Query: 50 SSRGFLTLSSRFVRNVAVSSDYEQDEDVLSDEGEPSFSPDLKLFVGNLPFNVDSAGLAGL 109 S +GF ++SSRFVRNVAVSS++EQDE+VLSD+GE S P+ KLFVGNLPF+VDSA LAG+ Sbjct: 50 SGKGFQSVSSRFVRNVAVSSEFEQDEEVLSDDGEAS--PEPKLFVGNLPFSVDSAQLAGI 107 Query: 110 FEQAGNVEMVEVIYDKITGRSRGFGFVTMSTVEEVEAAAQQFNGYELEGRQLRVNSGPPP 169 FE AGNVEMVEVIYDK TGRSRGFGFVTMS V+E E+AA+Q NGYEL+GR LRVN GPPP Sbjct: 108 FESAGNVEMVEVIYDKTTGRSRGFGFVTMSNVQEAESAARQLNGYELDGRALRVNYGPPP 167 Query: 170 ARRENSNFRGENTNFRGENTNFRGPRGGANLNSTNRIYVGNLSWGVDDLALETLFSEQGK 229 R E+S+FRG RGG +S NR+YVGNL+WGVD+LALE LFSEQGK Sbjct: 168 PRTEDSSFRGARGP-----------RGGGGYDSNNRLYVGNLAWGVDNLALENLFSEQGK 216 Query: 230 VTEARVIYDRETGRSRGFGFVTYNSAEEVNRAIESLDGVDLNGRSIRVTMAEARPRRQF 288 V EA+V++DR++GRSRGFGFVTY++A+E+N AIESLDGVDLNGRSIRV+ AE RPRRQF Sbjct: 217 VLEAKVVFDRDSGRSRGFGFVTYDTADEMNSAIESLDGVDLNGRSIRVSAAEPRPRRQF 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16682 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5689 (447 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 873 0.0 >Contig27182 Length = 447 Score = 873 bits (2255), Expect = 0.0, Method: Compositional matrix adjust. Identities = 419/436 (96%), Positives = 430/436 (98%) Query: 1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+RYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIHEPKRPSDKPLRLPLQD 240 VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EPKRPSDKPLRLPLQD Sbjct: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHESLVEGLPGDNVGFNV 300 VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHE+L E LPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRGFVASNSKDDPAKEAANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 AEITTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 AEI TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKSVEKKDPSG 436 VAVGVIKSVEKK+P+G Sbjct: 421 VAVGVIKSVEKKEPTG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17848 (307 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12866 69 1e-13 >Contig12866 Length = 268 Score = 68.6 bits (166), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 5/72 (6%) Query: 13 LYVGRLSSRTCTRDLESLFSRYGRVRDVDMKH-----DFAFVEFSDPRDADDARYNLNGR 67 +YVG L R++E LF +YG + D+D+K +AFVE+ DPRDADDA Y +G Sbjct: 9 IYVGNLPGDIRMREVEDLFLKYGPIVDIDLKIPPRPPGYAFVEYEDPRDADDAIYGRDGY 68 Query: 68 DFDGSRIIVEFA 79 DFDG R+ VE A Sbjct: 69 DFDGFRLRVELA 80 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61068 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56585 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18148 278 1e-76 >Contig18148 Length = 365 Score = 278 bits (710), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 126/237 (53%), Positives = 169/237 (71%), Gaps = 1/237 (0%) Query: 47 LVDLTLVRHAKDKGAVCLDGSAPGYHFRSGFGSGSNNWVLHIEGGGWCNTVASCLIRKTT 106 +V LTL+ A KGAVCLDG+ P YH G+GSG+N+W++ +EGGGWC+T+ +C+ RK T Sbjct: 1 MVGLTLINGAAAKGAVCLDGTLPAYHIHRGYGSGANSWLVQLEGGGWCDTIRNCVYRKKT 60 Query: 107 ALGSSNYMERQVRFSGILSHDSSQNPDFFDWNKVKLRYCDGASFAGNSQKNETQLFFRGQ 166 G S YME+Q+ FSGILS+ + +NPDF++WN+VK+RYCDGASF+G+SQ +L FRGQ Sbjct: 61 RRGCSVYMEKQIPFSGILSNKAGENPDFYNWNRVKVRYCDGASFSGDSQNEAARLHFRGQ 120 Query: 167 RIWEAVMDELLSIGLSNAKQVLLSGCSAGGLATLIHCDDFRGILPKDATVKCLADAGFFL 226 RIW+A M++L+S G+ A Q LLSGCSAGG+AT++HCD FRG+ P VKCL+D G FL Sbjct: 121 RIWKAAMEDLMSKGMRYANQALLSGCSAGGVATVLHCDGFRGMFPSTTKVKCLSDGGLFL 180 Query: 227 DEKDVTGNRRIRSFYSDVVHLQGVANSLDKDCVGRMEPSQAVFLSSRIYQEHKNPSF 283 D DV+G R +RS ++ VV LQGV +L C R+ P+ F + K P F Sbjct: 181 DAIDVSGTRTLRSMFTRVVSLQGVQKNLPWSCTNRLNPT-LCFFPQHLIASVKTPLF 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61022 (296 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65006 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25533 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31507 139 2e-35 >Contig31507 Length = 157 Score = 139 bits (351), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 84/164 (51%), Positives = 108/164 (65%), Gaps = 12/164 (7%) Query: 1 MEGKKRAGXXXXXXFATDLFGXXXXXXXXXXXTGIFASIFSTSSK--VLGRESLRPDLTK 58 MEG+K+ G F ++LFG +GIF +IF+ SSK V GRESLR ++T Sbjct: 1 MEGRKKTGSSSSS-FTSELFGSKESSAS----SGIFGAIFAPSSKDLVFGRESLRSEVTG 55 Query: 59 KKQDSGNEVWNAKP-GTTENALQQSEGESQSISNRDT-GSFYQEQRVQ-PCHLSSSIYYG 115 KK ++ + KP + A ++ EGES+SI+N D S Y++QRVQ PCH SSSIYYG Sbjct: 56 KKLT--DDPLHFKPRDQPDGASKEIEGESKSITNMDIISSIYRDQRVQQPCHFSSSIYYG 113 Query: 116 GQDIYFHPQNSQSSGMPSMLKKDSGEDDTGSASRGNWWQGSLYY 159 GQDIY HPQ++Q+ + KKD EDD+GSASRGNWWQGSLYY Sbjct: 114 GQDIYAHPQSTQNPEYNTPYKKDGTEDDSGSASRGNWWQGSLYY 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35266258 (339 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29208 400 e-113 >Contig29208 Length = 288 Score = 400 bits (1029), Expect = e-113, Method: Compositional matrix adjust. Identities = 196/287 (68%), Positives = 231/287 (80%), Gaps = 1/287 (0%) Query: 53 DSVHGHWKHHDVKVKDSKTLLFGEKSVTVFGVRNPEEIPWAETGADYVVESTGVFTXXXX 112 DS HG + + V D+ TL K + V R+P EIPW + G +YVVES+G+FT Sbjct: 1 DSTHGIFDG-SISVVDNSTLEINGKEIKVVSKRDPAEIPWGDYGVEYVVESSGIFTTLEK 59 Query: 113 XXXXXXXXXXXVIISAPSKDAPMFVMGVNEKEYKPDIDIVSNASCTTNCLAPLAKVINDR 172 V+ISAPS DAPMFV+GVNE YKP++DIVSNASCTTNCLAPLAKVI++ Sbjct: 60 AALHKKGGAKKVVISAPSADAPMFVVGVNENTYKPNMDIVSNASCTTNCLAPLAKVIHEE 119 Query: 173 FGIVEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGK 232 FGI+EGLMTTVHA TATQKTVDGPS KDWRGGR A NIIPSSTGAAKAVGKVLP LNGK Sbjct: 120 FGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGK 179 Query: 233 LTGMSFRVPTVDVSVVDLTVRLEKSATYDEVKAAIKEESEGKLKGILGYTEDDVVSTDFI 292 LTGM+FRVPT +VSVVDLT RLEKS++Y++VKA I+ ++G L+GILGYTE+DVVS DF+ Sbjct: 180 LTGMAFRVPTPNVSVVDLTCRLEKSSSYEDVKATIRYAADGPLRGILGYTEEDVVSNDFV 239 Query: 293 GDSRSSIFDAKAGIALNANFLKLVSWYDNEWGYSSRVIDLIRHMASV 339 GDSRSSIFDAKAG+AL+++F+KLVSWYDNEWGYS+RV+DLI HMA V Sbjct: 240 GDSRSSIFDAKAGLALSSSFVKLVSWYDNEWGYSTRVLDLIEHMALV 286 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34696 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1033 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20220 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10590 141 4e-36 >Contig10590 Length = 126 Score = 141 bits (355), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 77/133 (57%), Positives = 88/133 (66%), Gaps = 12/133 (9%) Query: 1 MVSLAPLQTLFPGNSLKQSSLPGFYARPTPVGSAVS----WKKKKRSLTVVAAVGEVSTD 56 M S++ T+ LKQS+ VG + S +KK+SLTVVAA+G+VS D Sbjct: 1 MGSMSSPLTMISAQPLKQSA--------AAVGRSPSLFRMHSEKKKSLTVVAAIGDVSAD 52 Query: 57 GTIYLIXXXXXXXXXXXXFPIFFSRKDLCPECDGAGFVRQSGVALRANAARKDQAQIVCA 116 GT YLI FPI FSRKDLCPECDGAGFVR+ G LRANAARKD+AQIVCA Sbjct: 53 GTPYLIAGAAAVALLGTAFPILFSRKDLCPECDGAGFVRKGGATLRANAARKDEAQIVCA 112 Query: 117 RCNGLGKLNQVDK 129 RCNGLGKLNQVDK Sbjct: 113 RCNGLGKLNQVDK 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31684 (312 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32143 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43458 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14225 238 4e-65 >Contig14225 Length = 170 Score = 238 bits (607), Expect = 4e-65, Method: Compositional matrix adjust. Identities = 120/167 (71%), Positives = 137/167 (82%) Query: 2 ASTTQACLLLQKQLRDLCKRPVDGFSAGLVDESNVFEWSVSIIGPPDTLYDGGFFNAIMS 61 A ++QA LLLQKQL+DLCK PVDGFSAGLV+E N+FEW+V+IIGPPDTLY+GGFFNAIMS Sbjct: 4 APSSQASLLLQKQLKDLCKHPVDGFSAGLVNEDNIFEWNVTIIGPPDTLYEGGFFNAIMS 63 Query: 62 FXXXXXXXXXXVRFTSDMWHPNVYPDGRVCISILHPPGEDPNGYELASERWTPVHTVEXX 121 F VRFTS+MWHPNVY DG+VC+SILHPPG+DPNGYELA+ERW PVHTVE Sbjct: 64 FPEDYPCNPPIVRFTSEMWHPNVYADGKVCVSILHPPGDDPNGYELATERWNPVHTVESI 123 Query: 122 XXXXXXXXXXPNDESPANIEAAKEWREKRDEFKKKVSRCVRKSQEML 168 PNDESPAN++AAK+WRE RDEF+KKV RCVRKSQEML Sbjct: 124 LLSIISMLSSPNDESPANVDAAKQWRESRDEFRKKVGRCVRKSQEML 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28772 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6978 (282 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19272 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21511 155 7e-40 >Contig21511 Length = 225 Score = 155 bits (391), Expect = 7e-40, Method: Compositional matrix adjust. Identities = 80/207 (38%), Positives = 121/207 (58%), Gaps = 15/207 (7%) Query: 3 SCEMEKRELKHLGFVRIAAIQALVCVSNLYYYAKQNSGPLRSTVGAVEDAVTAVISPVYD 62 + ++ ++LK+L FV++AAI +VC S+LY YAK+NSGPL+ V VE V VI PVY+ Sbjct: 12 TVRVDAKKLKYLEFVQVAAIYVVVCFSSLYEYAKENSGPLKPGVQTVEGTVRTVIGPVYE 71 Query: 63 KFKGVPDHLLVFMDKKVDEVSAKFDKHAPPVAKEVVGQAQCLVLKASKTAQTLVSEAKAG 122 K G+P L F+D+KVDE ++ D+H P LV +AS A ++ E + G Sbjct: 72 KLHGLPFQFLKFVDRKVDESLSEVDRHVP-----------VLVKQASSQALSVAREVEQG 120 Query: 123 GPSAALQHAATA----YKLFMLTQLVKLWFILNKVPLFHTVADMAVPTAAHWSDKYNHVV 178 G + ++ + Y+ V W LN++PLF VA + VPT ++WS KYN V Sbjct: 121 GLVSTAKNITVSVYYKYEPVAEQYAVSAWRALNRLPLFPLVAQIIVPTVSYWSGKYNRAV 180 Query: 179 TDMSVKGYTIFGYFPLVPIDKIAKTFK 205 + +GY++ Y PL+P ++IAK F+ Sbjct: 181 GYTANRGYSVAAYLPLIPTERIAKVFE 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49699 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28507 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12502 (228 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31420 127 1e-31 >Contig31420 Length = 330 Score = 127 bits (320), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 65/101 (64%), Positives = 77/101 (76%) Query: 64 FQTLHEEENGDEDFEGCFHRPEKKRRLTAGQVQFLERNFEVENKLEPERKNQLAKELGLQ 123 FQ++ E + D E EKKRRL QV+ LE+NFEVENKLEPERK +LA+ELGLQ Sbjct: 36 FQSMLEGLDEDGCVEEAGRVSEKKRRLNVEQVKALEKNFEVENKLEPERKVKLAQELGLQ 95 Query: 124 PRQVAIWFQNRRARFKTKQLEKDYDSLKASYDSLKADYDCI 164 PRQV++WFQNRRAR+KTKQLE+DY LKA YDSLK YD + Sbjct: 96 PRQVSVWFQNRRARWKTKQLERDYGVLKADYDSLKCSYDIL 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16856 (370 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21187 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16315 (306 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25085 121 2e-29 >Contig25085 Length = 138 Score = 121 bits (303), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 60/124 (48%), Positives = 82/124 (66%), Gaps = 5/124 (4%) Query: 7 LDRQIEHLMECK-----PLSESEVKTLCDQARTILVEEYNVQPVKCPVTVCGDIHGQFYD 61 LD I L+E K LSE+E++ LC AR I + + N+ V+ PV +CGDIHGQ+ D Sbjct: 15 LDDIIRRLLEGKGGKQVQLSEAEIRQLCVNARQIFLSQPNLLEVRAPVRICGDIHGQYQD 74 Query: 62 LIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQIT 121 L+ +F GG P NYLF+GDYVDRG S+ET+ LL+A K+RY +I +LRGN E + Sbjct: 75 LLRVFEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPNKIFLLRGNPEKAKNN 134 Query: 122 QVYG 125 ++YG Sbjct: 135 RIYG 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59233 (448 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12777 152 8e-39 >Contig12777 Length = 236 Score = 152 bits (385), Expect = 8e-39, Method: Compositional matrix adjust. Identities = 90/212 (42%), Positives = 132/212 (62%), Gaps = 6/212 (2%) Query: 171 FCGGIYNLREEQKYDRKQSDINSXXXXXXXXXXXXXXMFRYAANPSGAALIADSTLSLSR 230 F GGI + ++ Q +++ + +NS + + + S LSLSR Sbjct: 26 FTGGIIHYQKIQVFNKSAALVNSGLLLMAVMGLMFPAVLHFTRSEIH---FGKSELSLSR 82 Query: 231 AGSIVMLVAYLAYLVFQLWTHRKLFEAPED---GDDDTVSSDEEPVIGFWSSVVWLILMT 287 S VMLVAY +YL FQL +HR L+ E+ D+D +E P I W ++ WL ++T Sbjct: 83 FSSCVMLVAYASYLFFQLRSHRNLYNPIEEEGIRDEDESDEEEAPEITHWEAIGWLAVLT 142 Query: 288 AIIALLSEFVVGTIEVASESWGISVSFISIILLPIVGNAAEHAGAVIFAFKNKLDISLGV 347 +++LS ++V I+ AS+S+ + V+FIS+ILLPIVGNAAEHA A++FA K+KLDI+LGV Sbjct: 143 VWVSVLSGYLVDAIQGASDSFNMPVAFISVILLPIVGNAAEHASAIMFAMKDKLDITLGV 202 Query: 348 ALGSATQIAMFVVPLCVLVAWIMGIRMDLDFS 379 A+GS+TQI+MFV+P CV+V G L+FS Sbjct: 203 AIGSSTQISMFVIPFCVVVGVDHGTANGLEFS 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53882 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66069 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30334 (435 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24488 227 3e-61 >Contig24488 Length = 308 Score = 227 bits (578), Expect = 3e-61, Method: Compositional matrix adjust. Identities = 131/308 (42%), Positives = 188/308 (61%), Gaps = 28/308 (9%) Query: 13 STSAAGKDKASDKQKEKARVSRTSLILWHAHQNDAAAVRKLLEEDQSLVHARDYDSRTPL 72 S+ A +D + + RV +++ A++ D A+R+L++ + V+ D D RT L Sbjct: 23 SSLAPDRDDSVTPEPVDPRVR----LMYMANEGDLDAIRELIDSGTN-VNFTDIDGRTAL 77 Query: 73 HVASLHGWIDVAKCLIEFGADVNAQDRWKNTPLADAEGAKKHSMIELLKSYGGLS----- 127 HVA+ G DV + L++ GA+V+ +D W +TPLADA K +I+LL+ YG Sbjct: 78 HVAACQGQTDVVQLLLQRGAEVDPRDCWGSTPLADAIYYKNDDVIKLLEDYGAKPPMAPM 137 Query: 128 YGQNGSHFEXXXXXXXXXNKCDWEIDPSELDFSNSSIIGKGSFGEILKACWRGTPVAVKR 187 + QN ++EI+P+ELDFSNS I KG++ A WRG VAVK Sbjct: 138 HVQNSREVP------------EYEINPNELDFSNSVEITKGTYR---IASWRGIQVAVKT 182 Query: 188 ILPSLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDKKPLMLITEYLRGGDLHQYLK 247 + + D + FR E++LL K+RHPN+VQFLGAVT P+M++ EYL GD YLK Sbjct: 183 LGEKVFADEDKVNAFRDELSLLQKIRHPNVVQFLGAVTQSSPMMIVIEYLSKGDFRAYLK 242 Query: 248 EKGSLSPSTAITFAMDIARGMAYLH-NEPNVIIHRDLKPRNVLLVNTGADHLKVGDFGLS 306 KG+L P +A+ F++DIARGM YLH ++P IIHRDL+P N+L ++G HLKV DFG+S Sbjct: 243 RKGALKPPSALKFSLDIARGMNYLHEHKPEAIIHRDLEPSNILRDDSG--HLKVADFGVS 300 Query: 307 KLIKVQNS 314 KL+KV N+ Sbjct: 301 KLLKVANT 308 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16895 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35116 (336 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3034 355 e-100 >Contig3034 Length = 220 Score = 355 bits (910), Expect = e-100, Method: Compositional matrix adjust. Identities = 167/218 (76%), Positives = 184/218 (84%), Gaps = 2/218 (0%) Query: 3 PGVPADVFTAGGKVSTLNAGYSKGAYVTFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAM 62 P VPADV A +T GYSK A+VTFLAG+ DYVKGVVGLAKGLRKVKS Y LVVA+ Sbjct: 4 PEVPADVLQATSNSTT--TGYSKRAFVTFLAGDADYVKGVVGLAKGLRKVKSEYSLVVAI 61 Query: 63 LPDVPEEHREILKSQGCXXXXXXXXXXXXNQIQFAMAYYVINYSKLRIWNFEEYSKMVYL 122 LPDVPEEHREIL+SQGC NQI+FAMAYYVINYSKLRIWNFEEYSKM+YL Sbjct: 62 LPDVPEEHREILRSQGCIVQEIEPIYPPENQIKFAMAYYVINYSKLRIWNFEEYSKMIYL 121 Query: 123 DADIQVYDNIDHLMDAPDGYFYAVMDCFCEKTWSHTPQYSVGYCQQCPDKVTWPAEMGSP 182 DADIQVY+NIDHL P+GYFYAVMDCFCEKTWSH+PQ+ +GYCQQCPDKV+WPA+MGSP Sbjct: 122 DADIQVYENIDHLFATPNGYFYAVMDCFCEKTWSHSPQHKIGYCQQCPDKVSWPADMGSP 181 Query: 183 PPLYFNAGMFVFEPSRLTYESLLHTLRITPPTAFAEQD 220 PPLYFNAGMFVFEPSRLTY SLL TL++ PPT FAEQ+ Sbjct: 182 PPLYFNAGMFVFEPSRLTYNSLLQTLQVVPPTPFAEQE 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17966258 (411 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65606 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35611 (383 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59005 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5666259 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3769 239 3e-65 >Contig3769 Length = 178 Score = 239 bits (611), Expect = 3e-65, Method: Compositional matrix adjust. Identities = 117/161 (72%), Positives = 129/161 (80%), Gaps = 7/161 (4%) Query: 1 MSRSCSQCGNNGHNSRTCTESGGAGA----AANDIMLFGVRITEG-AFRKSASMTNLSQY 55 MSR+CSQCGNNGHNSRTC++ G G A N IMLFGVR+TEG AFRKS SM NLSQY Sbjct: 1 MSRTCSQCGNNGHNSRTCSDVSGGGCGGPIAENGIMLFGVRVTEGNAFRKSVSMNNLSQY 60 Query: 56 EQPQ--DSNADAGYASDDVVHASARSRERKRGVPWTEEEHRLFLLGLQKVGKGDWRGISR 113 E+PQ D+NA+AGYASD+VVHAS RER+RGV WTEEEH+LFL+GLQ VG+GDWRGISR Sbjct: 61 ERPQQADTNAEAGYASDEVVHASGHRRERRRGVAWTEEEHKLFLVGLQMVGRGDWRGISR 120 Query: 114 NFVKTRTPTQVASHAQKYFLXXXXXXXXXXXSSLFDITADT 154 NFVKTRTPTQVASHAQKYFL SSLFDIT DT Sbjct: 121 NFVKTRTPTQVASHAQKYFLRRNNHNRRRRRSSLFDITTDT 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11099 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 51912285 244 4e-67 >51912285 Length = 154 Score = 244 bits (624), Expect = 4e-67, Method: Compositional matrix adjust. Identities = 118/154 (76%), Positives = 134/154 (87%) Query: 11 MDFSSSSKLALQWAIDNLADKGDLLYIIHIKSSSGDESRDVLWTTHGSPLIPLTEFRQPE 70 MDFS SSK AL+WAI NLADKGD LYIIHIK +S ESR LW GSPLIPLTEFR+P+ Sbjct: 1 MDFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLTEFREPQ 60 Query: 71 IMKKYGVKTDIEVLDTLDTASRQKEVKIVTKLYWGDARDKLCEAVEDLKLDSLVMGSRGL 130 IMK YGV+TD+EVLDTLDT SRQKEV +VTKLYWGDAR+KL +AVEDLKLDSLVMGSRGL Sbjct: 61 IMKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGL 120 Query: 131 STIRRILLGSVTNYVMTNATCPVTIVKDPSSHKQ 164 STI+RI+LGSV+N+V+TNA+ PVTIVKDPS + Sbjct: 121 STIKRIVLGSVSNFVLTNASIPVTIVKDPSMQQH 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57523 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4475 281 4e-78 >Contig4475 Length = 443 Score = 281 bits (720), Expect = 4e-78, Method: Compositional matrix adjust. Identities = 142/185 (76%), Positives = 161/185 (87%), Gaps = 3/185 (1%) Query: 28 QPKCLIDFHSR--DVFNARVSSSRLSVRND-VVRGSLIVRCSQLEGNGSQIKRTTLHDLY 84 QP+CLI + FN+++SSS+LSVR+ +RGSL+VRCSQ +GNGS +KRT LHDLY Sbjct: 27 QPRCLIRLLTTPGSTFNSKLSSSKLSVRSKPSLRGSLVVRCSQSDGNGSPVKRTYLHDLY 86 Query: 85 EQGGQSPWYDNLCRPVTDLLPLIASGARGVTSNPAIFQKAISSSNAYNEQFRELVLAGKD 144 E+ GQSPWYDNLCRPVTDLLPLIASG RGVTSNPAIFQKAIS+SNAYN+QFRELV +GKD Sbjct: 87 EKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIFQKAISTSNAYNDQFRELVHSGKD 146 Query: 145 IESAYWELVVKDIQDACRLFEPIYDETDGGDGYVSVEISPXLADDTVGTVKTAKWLYKVV 204 IESAYWELVVKDIQDAC+LFE IYD+TD GDGYVSVE+SP LADDT GTV AKWL+KVV Sbjct: 147 IESAYWELVVKDIQDACKLFESIYDQTDAGDGYVSVEVSPRLADDTQGTVDAAKWLHKVV 206 Query: 205 DRPNV 209 RPNV Sbjct: 207 ARPNV 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34185 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27776 124 4e-31 >Contig27776 Length = 419 Score = 124 bits (312), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 59/80 (73%), Positives = 68/80 (85%) Query: 51 NPGNNLYVTGLSTRVNASDLEKYFNSEGKVVECHLVTDPRTRESRGFGFVTMETVEDADR 110 NPGNNLYVTGLS RV +LEK+F +EGKV + HLV DP TRESRGFGFVTME V++A+R Sbjct: 57 NPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAER 116 Query: 111 CIKYLNRSVLEGRLITVEKV 130 CIKYL+ SVLEGR+ITVEK Sbjct: 117 CIKYLDGSVLEGRVITVEKA 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48014 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26028 (531 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23825 (355 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25548 240 2e-65 >Contig25548 Length = 443 Score = 240 bits (613), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 153/277 (55%), Positives = 183/277 (66%), Gaps = 24/277 (8%) Query: 3 YNRNEDVSDEFDEYDPTPYGGGYDITVTYGRPLEPSEETCYPISSKSGDIDYDRPSYTSC 62 Y D + +FDEYDPTPYGGGYDI +T+GRPL+PS+ETCYP SS S D DY+RP ++S Sbjct: 4 YTHAGDEATDFDEYDPTPYGGGYDIYLTFGRPLDPSDETCYPNSSPSDDFDYERPQFSSY 63 Query: 63 SEPSAYGDEALENEYKSYARP--KPRPVLXXXXXXXXXXXXXXXXXXXXXXXQPKPPXXX 120 SEPSAY DEALE+EY YARP +P P + QP Sbjct: 64 SEPSAYADEALEDEYTHYARPAHRPGPAVGFNPGGGHPEGEYEGRPQPAYGFQP------ 117 Query: 121 XXXXXXXXXXXRKPDYEEPSSEYGSGYGRKPECEQPSSEYGSGYGRKPEYEQPSSEYGSG 180 +P++ E SGYGRKPE Q SEYGSGY R+PE ++PSSEY +G Sbjct: 118 --------GGEERPEFGSERPE--SGYGRKPEYGQSGSEYGSGYQRRPEADEPSSEY-TG 166 Query: 181 YGRKPEYEQPSTEYGSGYGRKPEYEQPSSEYGSGYGRKPEFEQPSSEYGSGYGRRPEYEA 240 YGRKPE+E+P +EYGSG+GRKPEY+ P EYGSGYGRKPE+E P SEYGSGYGR+PE+EA Sbjct: 167 YGRKPEHEEPESEYGSGHGRKPEYKAPEPEYGSGYGRKPEYEAPESEYGSGYGRKPEFEA 226 Query: 241 PSSEYGSGYGRKPSFGEEQSXXXXXXXERSPRKPQYG 277 P +E+GSGYGRKPS+GEE E PRKP YG Sbjct: 227 PPAEFGSGYGRKPSYGEESG-----YGEEPPRKPSYG 258 Score = 106 bits (264), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 79/136 (58%), Positives = 89/136 (65%), Gaps = 11/136 (8%) Query: 132 RKPDYEEPSSEYGSGYGRKPECEQPSSEYGSGYGRKPEYEQPSSEYGSGYGRKPEYEQPS 191 RKP++EEP SEYGSG+GRKPE + P EYGSGYGRKPEYE P SEYGSGYGRKPE+E P Sbjct: 169 RKPEHEEPESEYGSGHGRKPEYKAPEPEYGSGYGRKPEYEAPESEYGSGYGRKPEFEAPP 228 Query: 192 TEYGSGYGRKPEYEQPSSEYGSGYGRKPEFEQPSSEYGSGYGRRPEYEAPSSE------- 244 E+GSGYGRKP Y + S YG RKP + + S YG RRP Y PS E Sbjct: 229 AEFGSGYGRKPSYGE-ESGYGEEPPRKPSYGEEGS-YGEEPPRRPSYGRPSYETPESEER 286 Query: 245 --YGSGYGRKPSFGEE 258 YGS +P GEE Sbjct: 287 PSYGSSEFERPGHGEE 302 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8261 (113 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51672 (301 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3110 (348 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50427 (141 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11451 189 1e-50 >Contig11451 Length = 146 Score = 189 bits (481), Expect = 1e-50, Method: Compositional matrix adjust. Identities = 91/146 (62%), Positives = 112/146 (76%), Gaps = 5/146 (3%) Query: 1 MGRLWTLATHLHSLAGPVTMLLYPLYASVMAIESTTKVDDEQWLAYWILYSFLTLMEMLL 60 MG+ WT T LH++AGPV MLLYPLYASV+AIEST+K+DD+QWLAYWI+YSFLTLMEM+L Sbjct: 1 MGKAWTFLTQLHTVAGPVLMLLYPLYASVVAIESTSKLDDQQWLAYWIIYSFLTLMEMVL 60 Query: 61 QPILKWIPIWYDVKLVFVAWLVLPQFRGAAFIYEKFVREQIWKHGRAG-----RAENRAS 115 QP L+W+PIWY+VKLVFVAWLVLPQF+GAAF+YE++VR+Q+ K+ + Sbjct: 61 QPALEWLPIWYNVKLVFVAWLVLPQFKGAAFLYERYVRDQVRKYAGFNNHPQYNHPQSSK 120 Query: 116 TSHHHGKGDNKSVQFVGLKKGPHEAY 141 TS GK NK VQF+ K EAY Sbjct: 121 TSSPTGKAKNKFVQFMNPKNEEQEAY 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49875 (448 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21241 93 1e-20 >Contig21241 Length = 531 Score = 92.8 bits (229), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 44/90 (48%), Positives = 64/90 (71%), Gaps = 2/90 (2%) Query: 322 RSCTKVHKQGIALGRSVDLTKFNNYDELIAELDQLFEFGGELMAPKK-NWLIVYTDDEGD 380 R+ TKV+K+G A+GRS+D+T+++NYDEL +L + F G+L + W +VY D E D Sbjct: 418 RTYTKVYKRG-AVGRSIDMTRYSNYDELKQDLARRFGIEGQLEDRGRVGWKLVYVDHEND 476 Query: 381 MMLVGDDPWQEFCGMVRKIYIYTREEVQRM 410 ++LVGDDPW+EF VR I I + +EVQ+M Sbjct: 477 VLLVGDDPWEEFVNCVRCIKILSPQEVQQM 506 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65601 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10366265 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27828 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30991 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12415 426 e-121 >Contig12415 Length = 250 Score = 426 bits (1094), Expect = e-121, Method: Compositional matrix adjust. Identities = 199/223 (89%), Positives = 215/223 (96%) Query: 22 SATTISLYNKCSHPVWPGIQPGAGKPILARGGFKLPPNKAYSLHIPAAWSGRIWGRHGCS 81 SATT++++NKC+HPVWPGIQP AG+P+LARGGF LPPNKAY+LH+P WSGR WGRHGC+ Sbjct: 27 SATTLTMHNKCNHPVWPGIQPSAGQPLLARGGFTLPPNKAYTLHLPRLWSGRFWGRHGCA 86 Query: 82 FDAHGRGRCATGDCGGSLFCNGMGGTPPATLAEITLGSEQDFYDVSLVDGYNLAISITPF 141 FDA GRGRCATGDCGG+LFC+G+GGTPPATLAEITLG++QDFYDVSLVDGYNLAISITPF Sbjct: 87 FDASGRGRCATGDCGGNLFCSGLGGTPPATLAEITLGNDQDFYDVSLVDGYNLAISITPF 146 Query: 142 KGSGKCSYAGCVSDLNTMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTGSFGSPQSC 201 KGSGKCSYAGCVSDLN MCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTGSFGSPQSC Sbjct: 147 KGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTGSFGSPQSC 206 Query: 202 KPTAYSKIFKAACPRAYSYAYDDPTSIATCTGGNYLVTFCPHH 244 KPTAYSKIFKAACP+AYSYAYDDPTSIATCT GNYLVTFCPHH Sbjct: 207 KPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPHH 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13648 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 201 2e-53 >Contig27182 Length = 447 Score = 201 bits (510), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 98/222 (44%), Positives = 143/222 (64%), Gaps = 3/222 (1%) Query: 77 GYKKRHLNVVFIGHVDAGKSTTGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMD 136 G +K H+N+V IGHVD+GKSTT G +++ G +D R I+++EKEA + ++ S+ A+++D Sbjct: 2 GKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLD 61 Query: 137 TNEEERVKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKG 196 + ER +G T+++ FET T++DAPGH+ ++ NMI+G SQAD VL+I + G Sbjct: 62 KLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTG 121 Query: 197 EFETGYERGGQTREHVQLAKTLGVSKLLVVVNKMDDPTVNWSKERYDEIESKMIPFLRSS 256 FE G + GQTREH LA TLGV +++ NKMD T +SK RYDEI ++ +L+ Sbjct: 122 GFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKV 181 Query: 257 GYNVKKDVHFLPLSGLVGLNMXTRVDXSLCSWWNGPCLFEPL 298 GYN K + F+P+SG G NM R + W+ GP L E L Sbjct: 182 GYNPDK-IAFVPISGFEGDNMIER--STNLDWYKGPTLLEAL 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37289 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5564 (54 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44816 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40410 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25362 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47251 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30601 73 5e-15 >Contig30601 Length = 274 Score = 73.2 bits (178), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 56/222 (25%), Positives = 96/222 (43%), Gaps = 7/222 (3%) Query: 32 LLQSMLRLGLQPSLQTYTLLLSCCTEARSSFDMGFCGELMAVTGHPAHMFLLSMPAAGPD 91 + Q M L ++P++ T++ +L+ C+ S D E + + + + + D Sbjct: 29 IFQKMHELDIKPNVVTFSAILNACSRCNSFDDASMLLEELRLFDNQVYGVAHGLLMGYRD 88 Query: 92 GQNVRDHVSKFLDLMHSEDRESKRGLVDAVVDFLHKSGLKEEAGSVWEVAAQKNVYPDAV 151 NV D + D + +A+ D L G K+ A V ++NV+ Sbjct: 89 --NVWVKAQSLFDEVKQMDSSTASAFYNALTDMLWHFGQKQGAQLVVLEGKRRNVWESVW 146 Query: 152 REKSSCYWLINLHFMSDGTAVTALSRTLAWFHREMLVSGTVPSRIDIVTGWGRRSRVTGA 211 + SC ++LH MS G A + L + +P+ + I+TGWG+ S+V G Sbjct: 147 SD--SC---LDLHLMSPGAARAMVHAWLLNIRTIVFKGQQLPNLLSILTGWGKHSKVVGD 201 Query: 212 SLVRQAVQELLHIFSFPFFTENGNSGCFVGRGEPLGRWLLQS 253 S +R+A++ LL PF N G F+ G WL +S Sbjct: 202 STLRRAIEALLTSMGAPFHIAKCNLGRFISTGSVAAAWLKES 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61192 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1888 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45736 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42552 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7180 233 1e-63 >Contig7180 Length = 199 Score = 233 bits (594), Expect = 1e-63, Method: Compositional matrix adjust. Identities = 109/179 (60%), Positives = 139/179 (77%), Gaps = 2/179 (1%) Query: 3 TFAGTTQKCKACEKTVYLVDELTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCKPH 62 +F GT QKCKACEKTVY V+EL+AD YHK+CF+C HCKGTLKLSNYSS EGVLYCKPH Sbjct: 2 SFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH 61 Query: 63 FDQLFKMTGSLDKSFEGAPKTVRSV--DQGQTNSKVSSMFAGTQEKCVACKKTVYPIEKV 120 F+QLFK TG+ +K+F+ K+ + + ++ SK +SMF+GTQ+KC C KT YP+EKV Sbjct: 62 FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV 121 Query: 121 GVDGTSYHKACFRCTHGGCTISPSNYIAHEHRLYCRHHHSQLFKEKGNFSQLDKQEQVK 179 V+ +YHK+CF+C+HGGC I+PSNY A E LYC+HH SQLFKEKG+++ L K +K Sbjct: 122 TVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58338 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24186 152 3e-39 >Contig24186 Length = 249 Score = 152 bits (385), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 100/212 (47%), Positives = 119/212 (56%), Gaps = 22/212 (10%) Query: 13 IKFLYSYGGKILPRRIDGKLRYVGGHTRVLAVDRSISYAELMVKLGELCGSSVTLRCQLP 72 +K L SYGGKILPR DG LRYVGGH RVL+VD SI+Y ELMVKL ELCG SV LRC LP Sbjct: 10 LKLLCSYGGKILPRHSDGTLRYVGGHNRVLSVDSSITYTELMVKLAELCGYSVELRCPLP 69 Query: 73 KEDLDVLVTVTSDEELANVIDEYHRASSSCS--KIRAVLSPPKSLKTISPXXXXXXXXXX 130 DL+ L++V SDE+LAN+I+EY RASS KIRA+LSPPKSLK ISP Sbjct: 70 NGDLETLISVKSDEDLANIIEEYGRASSPPHSLKIRAILSPPKSLKQISPPMSTATSGGD 129 Query: 131 XXFRSITAVCAHRS-ASPPMLAHRYPGP------RSVSPTTTAHRWSTRISPPIENPLYV 183 A SPP R+ P R VSP + + SPP P Sbjct: 130 SSPSKSLFSSADSPRVSPP---QRFVSPQVSPPRRYVSPQVSPPKRYA--SPPARYPAGH 184 Query: 184 RWDTAKLCY-------NSNRN-PCDVGGSHRY 207 + + ++CY S R+ PCD+ H Y Sbjct: 185 QRGSGRVCYYPCHLQPQSQRSGPCDMSYVHHY 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666265 (378 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1866265 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv966258 (356 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55845 (484 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14832 85 3e-18 >Contig14832 Length = 359 Score = 84.7 bits (208), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 45/94 (47%), Positives = 54/94 (57%), Gaps = 13/94 (13%) Query: 175 FPERPGQTECKYYLRTGGCKFGKACRYNHTKAKPSAVPVLELNFLGLPIRMGEKECPYYM 234 E+ GQT+ KY G CK +PS P LELNFLGLPIR G+ +C +YM Sbjct: 248 LAEKQGQTKNKYC--PGQCK-----------GEPSVAPALELNFLGLPIRPGKADCLHYM 294 Query: 235 RTGSCKYGANCRFNHPDPTAAGGYEPPSGYGNGG 268 +TG+CKY NC FNHPDPT P S Y + G Sbjct: 295 QTGTCKYENNCLFNHPDPTPLEESRPQSTYESHG 328 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39691 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25573 474 e-135 >Contig25573 Length = 308 Score = 474 bits (1219), Expect = e-135, Method: Compositional matrix adjust. Identities = 227/291 (78%), Positives = 254/291 (87%) Query: 1 MGTVIDSHFLALTAIVTVGYQFLFFIITALLKFDKVTDFAGSTNFVILAVLTLVLKGTWH 60 MG V+DS+FLALTAIVTVGYQ LFFI+TALLKFDKVTDFAGSTNFVILA+LTLV+KG+WH Sbjct: 1 MGRVLDSNFLALTAIVTVGYQLLFFIVTALLKFDKVTDFAGSTNFVILAILTLVVKGSWH 60 Query: 61 FRQVVLTLLVVIWGLRLGIFLLMRILQWGEDRRFDEMRSNLGKLAVFWTFQAVWVWTVSL 120 FRQVVL+LLV+IWGLRLG FLLMRILQWGEDRRFDE+R NLGKLAVFW FQA+WVWTVSL Sbjct: 61 FRQVVLSLLVIIWGLRLGFFLLMRILQWGEDRRFDEIRGNLGKLAVFWIFQAMWVWTVSL 120 Query: 121 PVTIVNASGRDPSLQAADIIGWIMWSVGITIEASADQQKLSFKNSPENRGKWCNVGVWKY 180 PVT+ NAS R P +QAADIIGWIMW VG ++EA+ADQQKL+FK+SP+NRGKWCNVG+WKY Sbjct: 121 PVTVANASNRMPLIQAADIIGWIMWFVGFSVEAAADQQKLTFKSSPQNRGKWCNVGLWKY 180 Query: 181 TRHPNYFGEILLWWGIFVASTPVLEGAEWXXXXXXXXXXXXXXXXSGIPLLEESADKKFG 240 TRHPNYFGEI LWWG+FVASTPVLEGAEW SGIPLLE+SADKKFG Sbjct: 181 TRHPNYFGEIFLWWGVFVASTPVLEGAEWLVILGPIFLTLLLLFISGIPLLEKSADKKFG 240 Query: 241 NVAGYRLYKSTTSPLVPLPPMVYGNLPSWFKTTFLLEFPFYSRNLPQEGQN 291 N+ YRLYK +TSPL+PLPP++Y NLP WFKTTFL EFP YSRNLP+E N Sbjct: 241 NIDEYRLYKRSTSPLIPLPPVIYKNLPLWFKTTFLFEFPLYSRNLPREKPN 291 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37887 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13954 244 9e-67 >Contig13954 Length = 239 Score = 244 bits (622), Expect = 9e-67, Method: Compositional matrix adjust. Identities = 124/199 (62%), Positives = 148/199 (74%), Gaps = 29/199 (14%) Query: 1 MRKPCCEKKDTNKGAWSKEEDQKLIDYIQKHGEGSWRSLPQAAGLLRCGKSCRLRWLNYL 60 MRKPCCEK+ TNKGAWSK+EDQKLIDYI+ HGEG WRSLP+AAGL RCGKSCRLRW+NYL Sbjct: 1 MRKPCCEKEGTNKGAWSKQEDQKLIDYIKTHGEGCWRSLPKAAGLHRCGKSCRLRWINYL 60 Query: 61 RPDLKRGNFAEDEEDLIVKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLKRKLIRMGI 120 RPD+KRGNF +DEE+LI+KLHALLGNRWSLIAGRLPGRTDNEVKNYWNSH+++KLI+MGI Sbjct: 61 RPDIKRGNFEQDEEELIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGI 120 Query: 121 NPDKHHVRQSISRQHP----VTPHGKK-------------------DQL----SNDATFL 153 +P+ H + Q I R +P V+P DQ+ S A+ L Sbjct: 121 DPNNHRLNQIIPRPNPQNDSVSPAATSSGSMSNINACTKTPLKSSDDQIDHRASEAASVL 180 Query: 154 VKKTSGLP--DLNLNLTLS 170 +TSG DLNL+LT++ Sbjct: 181 EDETSGPSSRDLNLDLTIA 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2500 (455 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63497 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 52024425 282 3e-78 >52024425 Length = 183 Score = 282 bits (721), Expect = 3e-78, Method: Compositional matrix adjust. Identities = 133/182 (73%), Positives = 157/182 (86%), Gaps = 3/182 (1%) Query: 1 MASSMLSSATVATI--NRXTPDQANMVAPSTGLKSLSTFPGTRKANTDITSVASNGGRVR 58 MASSM+SSATV+T+ +R P QA+MVAP TGLKS S FP TRK+N DITS+ASNGGRV+ Sbjct: 1 MASSMISSATVSTVYTDRAAPAQASMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQ 59 Query: 59 CMKVWPTEGVMKFETLSYLPPLNDEQLCKEVDYLLRMNWVPCLEFTKLYPYPHREHNRSP 118 CM+VWP G+ KFETLSYLPPL+ E L KEVDYLLR NWVPCLEF + + +RE+++SP Sbjct: 60 CMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSP 119 Query: 119 GYYDGRYWTMWKLPMFGCTDSAQVIKEVQEARTAYPNAHIRIIGFDNTRQVQCIAFIAYK 178 GYYDGRYWTMWKLPMFGCTDS+QV+KE++EA+ AYPNA IRIIGFDN RQVQCI+FIAYK Sbjct: 120 GYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYK 179 Query: 179 PS 180 P+ Sbjct: 180 PA 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63497 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 52024425 282 3e-78 >52024425 Length = 183 Score = 282 bits (721), Expect = 3e-78, Method: Compositional matrix adjust. Identities = 133/182 (73%), Positives = 157/182 (86%), Gaps = 3/182 (1%) Query: 1 MASSMLSSATVATI--NRXTPDQANMVAPSTGLKSLSTFPGTRKANTDITSVASNGGRVR 58 MASSM+SSATV+T+ +R P QA+MVAP TGLKS S FP TRK+N DITS+ASNGGRV+ Sbjct: 1 MASSMISSATVSTVYTDRAAPAQASMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQ 59 Query: 59 CMKVWPTEGVMKFETLSYLPPLNDEQLCKEVDYLLRMNWVPCLEFTKLYPYPHREHNRSP 118 CM+VWP G+ KFETLSYLPPL+ E L KEVDYLLR NWVPCLEF + + +RE+++SP Sbjct: 60 CMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSP 119 Query: 119 GYYDGRYWTMWKLPMFGCTDSAQVIKEVQEARTAYPNAHIRIIGFDNTRQVQCIAFIAYK 178 GYYDGRYWTMWKLPMFGCTDS+QV+KE++EA+ AYPNA IRIIGFDN RQVQCI+FIAYK Sbjct: 120 GYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYK 179 Query: 179 PS 180 P+ Sbjct: 180 PA 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49941 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19391 118 1e-28 >Contig19391 Length = 148 Score = 118 bits (295), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 59/134 (44%), Positives = 79/134 (58%), Gaps = 1/134 (0%) Query: 84 LHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRC-GWGISPRGAGYTFGQDI 142 +HGGLSP L+ LD I+ + R ++P+ G +CDLLWSDPD R GW S RG TFG D Sbjct: 1 MHGGLSPELENLDQIKEISRPTDIPYNGLLCDLLWSDPDARVEGWAESDRGVSCTFGADR 60 Query: 143 ASQFNHTNGLTLISRAHQLVMEGYNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGENMDQ 202 S F N L LI R HQ+V +GY + ++ +VT+FSAPNY N A+L + E + Sbjct: 61 VSDFLDKNELDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLSVDEALVC 120 Query: 203 NFLQFDPAPRQIEP 216 +F P + P Sbjct: 121 SFEILKPVDHKASP 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6838 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43779 (588 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9568 807 0.0 >Contig9568 Length = 610 Score = 807 bits (2085), Expect = 0.0, Method: Compositional matrix adjust. Identities = 380/581 (65%), Positives = 473/581 (81%), Gaps = 16/581 (2%) Query: 1 MENNEKVVATDEPKTKHRGIKAMPFVIGNETFEKLGTIGTSTNLLVYLTTVFNMKSITAT 60 ME NE+ +TDE +RG K MPFVIGNETFEKLGT GT NLLVYLT+VFNMK TA Sbjct: 33 MEKNERG-STDEEPVIYRGWKVMPFVIGNETFEKLGTTGTLANLLVYLTSVFNMKRNTAA 91 Query: 61 TFVNVFNGSTNFATLIGAFLCDTYFGRYNTLGFASISSFLLKGMLVITLTAAVQKMHPPH 120 T V FNG+TNFATL+GAF DTYFGRY TLGF++I+SF+ G+L+I TA + +HPPH Sbjct: 92 TLVTTFNGTTNFATLLGAFASDTYFGRYKTLGFSTIASFM--GLLLIDFTAVFKNLHPPH 149 Query: 121 CGTTDTGTCIGPTAGQMAFLLSGFGLLVIGAAGIRPCNLAFGADQFNPETESGKRGISSF 180 C + GTC G TAGQMAFLL+GFG+L++GAAGIRPCNL FGADQFN +TESGKRG++SF Sbjct: 150 CKPEEKGTCKGATAGQMAFLLTGFGMLIVGAAGIRPCNLVFGADQFNQKTESGKRGVNSF 209 Query: 181 FNWYYFTYTFAMMVSLTVIVYVQSDVSWSLGLAIPTLLMLLSCALYFMGTRIYVKVKPEG 240 FNWY FT+TFA M++LT+IVY+QS+VSWSLG IP +LML+SC L+F+G+++YVKVK G Sbjct: 210 FNWYMFTFTFAQMIALTLIVYIQSNVSWSLGFGIPAILMLISCVLFFIGSKLYVKVKASG 269 Query: 241 SPLKNVAHVIVAAVKKRRLEL--PGQPWLSLFNHIPANSINSKLPHTDQFRFLSKGAILT 298 SP+ +VA V+V ++ KR L+L P +PWLS+F ++P +SINS LP+T+QFR L K AILT Sbjct: 270 SPMNSVAQVVVVSIAKRHLKLKEPERPWLSMFVYMPPDSINSNLPYTNQFRCLDKAAILT 329 Query: 299 PEVQINSDGSAANPWRLSSMQKVEEVKCVIRVIPIWAAGIIYYVALVQQSTYVVFQALQS 358 PE +IN DGSAA+PWRL SMQ+VEEVKC++RV+PIWAA +IY++A+VQQ TYVVFQALQS Sbjct: 330 PEDKINPDGSAADPWRLCSMQQVEEVKCLLRVLPIWAAALIYHIAIVQQQTYVVFQALQS 389 Query: 359 DRRLGSTGFKIPAASYTVFTMLSLTIWIPIYDQIIVPLLRRLTGKEVGITLLQKMGIGMV 418 +RRLG T F+IPAASYT+F ML +TIWIPIYD+++VP L+RLTGKE GITLLQ++GIG+ Sbjct: 390 NRRLGKTSFQIPAASYTIFLMLGMTIWIPIYDRLLVPFLQRLTGKEGGITLLQRIGIGIF 449 Query: 419 LAVITMILSALVEERRRTLALTKATVGIEARRGAISSLSGMWLVPQLTLIGISEGLTIIG 478 L+VITM++SA VE+ RRT+ALTK I +SG WLVPQLTL G++E +G Sbjct: 450 LSVITMLVSAFVEQHRRTIALTK----------PIPGMSGFWLVPQLTLAGLAEAFAAVG 499 Query: 479 QVEFFYKQFPENMRSFAGAFLFCGIAFSNYLSSFLVSIVHQSTGGTATGNWLPEDLNKGR 538 Q+EF+YKQFPENMRS G+ FCG+A S+YLSS L++IVH++T G ATGNWLPEDLNKGR Sbjct: 500 QIEFYYKQFPENMRSIGGSLFFCGMAGSSYLSSALIAIVHRTTEGAATGNWLPEDLNKGR 559 Query: 539 LDYFYYLVAALGMVNLLYFLACAKWYKYK-DSEESPLEVSL 578 LDYFYYL+AALG+VNL YFL C+KWY YK + + LEV + Sbjct: 560 LDYFYYLIAALGVVNLGYFLMCSKWYNYKGGGDNNALEVEV 600 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24280 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9168 (319 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3293 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7018 117 2e-28 >Contig7018 Length = 194 Score = 117 bits (292), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 53/97 (54%), Positives = 67/97 (69%), Gaps = 6/97 (6%) Query: 1 MGNCQAIDAATLVIQYPCGKADKLYWPVSASELMKMNPGHYVALLI------XXXXXXXX 54 MGNCQAIDAA LVIQ+P GK +++YWP+SASE+M++NPGHYV+L+I Sbjct: 1 MGNCQAIDAAALVIQHPSGKLERMYWPISASEVMRLNPGHYVSLIIPLPVSEQDHEQVAE 60 Query: 55 XXXXXGPSSVRITRVKLLRPTDTLVLGQVYRLITAEE 91 +VR TRVKLLRP +TL LG YRL+TA+E Sbjct: 61 NHEEEHGKAVRFTRVKLLRPNETLALGHAYRLVTAQE 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4726 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30474 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45661 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20666261 (190 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41328 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66022 (324 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49361 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7976 331 7e-93 >Contig7976 Length = 241 Score = 331 bits (849), Expect = 7e-93, Method: Compositional matrix adjust. Identities = 164/247 (66%), Positives = 190/247 (76%), Gaps = 10/247 (4%) Query: 1 MTLVGLFLVGFLSMVSSVHGQ--GWINAHATFYXXXXXXXXXXXXXXYGNLYSEGYGTNT 58 M +G+ ++GFLS+VSSV+G GW NAHATFY YGNLYS+GYGTNT Sbjct: 1 MASLGILVIGFLSLVSSVNGYYGGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT 60 Query: 59 AALSTALFNNGLSCGSCYEIKCVNDGKWCLPGSIVITATNFCXXXXXXXXXXGGWCNPPL 118 AALSTALFNNGL+CG+CY+I+CVND +WCLPGSI++TATNFC GGWC+PP Sbjct: 61 AALSTALFNNGLTCGACYQIRCVNDPQWCLPGSIIVTATNFCPP--------GGWCDPPQ 112 Query: 119 HHFDLSQPVFQHIAQYRAGIVPVSYXXXXXXXXXXXXFTINGHSYFNLVLITNVGGAGDV 178 HFDLSQPVF IAQY+AG+VPVSY FT+NGHSYFNLVL+TNVGGAGDV Sbjct: 113 QHFDLSQPVFLRIAQYKAGVVPVSYRRVRCRRRGGIRFTVNGHSYFNLVLVTNVGGAGDV 172 Query: 179 HAVAIKGSRTGWQSMSRNWGQNWQSNTYLNGQSLSFKVTTSDGHTIVSYNCVPAHWSFGQ 238 +VAIKGSRT WQ+MSRNWGQNWQSN+YLNGQSLSF VTTSDG +VSYN P +WSFGQ Sbjct: 173 QSVAIKGSRTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSYNVAPPNWSFGQ 232 Query: 239 TFSGAQF 245 T++G QF Sbjct: 233 TYTGRQF 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40999 (448 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44944 (311 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18644 (332 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13466261 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4687 (358 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23541 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64843 (312 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43225 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6662 83 5e-18 >Contig6662 Length = 368 Score = 82.8 bits (203), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 74/245 (30%), Positives = 116/245 (47%), Gaps = 45/245 (18%) Query: 29 DASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGITCKGS--RVTEIELSG------LR 80 D +AL+ + + L + S L ++S G C +W G++C + RV +I L G L+ Sbjct: 29 DLAALQSIRTGL-TDSSLGIFNSWVGTDCCVNWYGVSCDPTTGRVVDINLRGESEDPILK 87 Query: 81 LTGSMGY-------QLTSLTSVVNLDISN-NNLGNQIPYQLP--PNLQRLNLAGNGFNGG 130 +G G+ ++ SL + L +++ + +IP L NL+ L+L GN +G Sbjct: 88 KSGQSGFMSGSISPKICSLDRLTTLVLADWKGVTGEIPQCLTTLSNLRVLDLVGNKISGK 147 Query: 131 IPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFSSLSSIT 190 IP I + L+ LN++ NQ+ G++ LS L +D S N +TG+LP F L ++ Sbjct: 148 IPADIGNLKMLRVLNLADNQISGKIPASLVGLSGLMHMDLSNNQITGELPADFGKLKMLS 207 Query: 191 TMFLQNNQFTGSI-------NVLASLP-------------------LETLNVANNHFTGW 224 L NQ TGSI N LA L L TLN+ N F+G Sbjct: 208 RALLNRNQLTGSIPDSIGNMNRLADLDLSRNQMWGSVPDCLGKMQVLSTLNLDGNKFSGQ 267 Query: 225 IPESL 229 +P S+ Sbjct: 268 LPASV 272 Score = 64.3 bits (155), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 43/128 (33%), Positives = 67/128 (52%), Gaps = 2/128 (1%) Query: 80 RLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPN--LQRLNLAGNGFNGGIPYSISL 137 +LTGS+ + ++ + +LD+S N + +P L L LNL GN F+G +P S+ Sbjct: 215 QLTGSIPDSIGNMNRLADLDLSRNQMWGSVPDCLGKMQVLSTLNLDGNKFSGQLPASVLS 274 Query: 138 MISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFSSLSSITTMFLQNN 197 + LN+S N +G + D+F S LD S N+L G +P S S+ I + L +N Sbjct: 275 NRGMGILNLSRNGFEGNIPDVFHGNSYFMALDLSYNNLKGPIPGSLSAAKYIGHLDLSHN 334 Query: 198 QFTGSINV 205 G+I V Sbjct: 335 HLCGAIPV 342 Score = 60.5 bits (145), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 47/160 (29%), Positives = 80/160 (50%), Gaps = 4/160 (2%) Query: 74 IELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPP--NLQRLNLAGNGFNGGI 131 + L+ +++G + L L+ ++++D+SNN + ++P L R L N G I Sbjct: 161 LNLADNQISGKIPASLVGLSGLMHMDLSNNQITGELPADFGKLKMLSRALLNRNQLTGSI 220 Query: 132 PYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFSSLSSITT 191 P SI M L L++S NQ+ G + D ++ L+TL+ N +G LP S S + Sbjct: 221 PDSIGNMNRLADLDLSRNQMWGSVPDCLGKMQVLSTLNLDGNKFSGQLPASVLSNRGMGI 280 Query: 192 MFLQNNQFTGSINVL--ASLPLETLNVANNHFTGWIPESL 229 + L N F G+I + + L+++ N+ G IP SL Sbjct: 281 LNLSRNGFEGNIPDVFHGNSYFMALDLSYNNLKGPIPGSL 320 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62388 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 158 6e-41 >Contig31581 Length = 128 Score = 158 bits (399), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 85/115 (73%), Positives = 87/115 (75%), Gaps = 6/115 (5%) Query: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 137 IQKESTLHLVLRLRGG------MQIFVKTLTGKTITLEAEAHLCREAVGGWSDSC 185 IQKESTLHLVLRLRGG M + K K I + A L AV C Sbjct: 61 IQKESTLHLVLRLRGGIIEPSLMALARKYNQEKMICRKCYARLHPRAVNCRKKKC 115 Score = 156 bits (394), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGM 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9909 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60148 (613 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7379 1032 0.0 >Contig7379 Length = 589 Score = 1032 bits (2669), Expect = 0.0, Method: Compositional matrix adjust. Identities = 488/597 (81%), Positives = 534/597 (89%), Gaps = 9/597 (1%) Query: 1 MHSGTNPFEVIDQAVKAVEKHMQTFLHREKKKLPSFLDWFGWCTWDAFYTDVTAEGIEEG 60 MH+GTNPFEVI QAVKAVEKHM+TF+HREKKKLPSFLDWFGWCTWDAFYTDVTAEG+ +G Sbjct: 1 MHAGTNPFEVITQAVKAVEKHMKTFVHREKKKLPSFLDWFGWCTWDAFYTDVTAEGVVQG 60 Query: 61 LQSLSKGGAPPKFLIIDDGWQQIGNENKDNNCVVQEGAQFANRLTGIKENEKFQKNGRNN 120 L+SLS+GG PP+FLI+DDGWQQI N++KD+ VVQEGAQFA+RLTGIKENEKFQKN NN Sbjct: 61 LKSLSEGGTPPRFLIVDDGWQQIENKDKDSGVVVQEGAQFASRLTGIKENEKFQKNDHNN 120 Query: 121 EQVPGLKHVVEDAKQRHNVKFVYVWHALAGYWGGVKPAAAGMEHYECALAYPVQSPGVMG 180 EQV GLKHVV++AKQ HNVKFVYVWHALAGYWGGVKPAA GMEHY+ ALAYPV SPGV G Sbjct: 121 EQVSGLKHVVDEAKQHHNVKFVYVWHALAGYWGGVKPAATGMEHYDTALAYPVSSPGVEG 180 Query: 181 NQPDIVMDSLSVHGLGLVPPRTVFNFYNELHAYLASCGVDGVKVDVQNIIETLGAGHGGR 240 NQPDIVMDSL+VHGLGLV P+ VFNFYNELH+YLASCGVDGVKVDVQNIIETLG+GHGGR Sbjct: 181 NQPDIVMDSLTVHGLGLVHPKKVFNFYNELHSYLASCGVDGVKVDVQNIIETLGSGHGGR 240 Query: 241 VALTRSYQQALEASIARNFTDNGCISCMCHNTDGLYSTKQTAVVRASDDFYPRDPASHTI 300 V+LTRSY QALEAS+ARNF DNGCISCMCHNTDGLYS KQTAVVRASDDFYPRDPASHTI Sbjct: 241 VSLTRSYHQALEASVARNFADNGCISCMCHNTDGLYSAKQTAVVRASDDFYPRDPASHTI 300 Query: 301 HISSVAYNTLFLGEFMQPDWDMFHSLHPAAEYHGAARAVGGCAIYVSDKPGHHNFELLRK 360 HISSVAYNTLFLGEFMQPDWDMFHSLHPAAEYHGAARA+GGCAIYVSDKPGHHNF+LLRK Sbjct: 301 HISSVAYNTLFLGEFMQPDWDMFHSLHPAAEYHGAARALGGCAIYVSDKPGHHNFDLLRK 360 Query: 361 LVLPDGSVLRAQLPGRPTRDCLFADPARDGTSLLKIWNVNKCSGVVGVFNCQGAGWCKIE 420 LVLPDGSVLRA+LPGRPTRDCLFADPARD TSLLKIWNVN SGVVGVFNCQGAGWCKIE Sbjct: 361 LVLPDGSVLRAKLPGRPTRDCLFADPARDRTSLLKIWNVNNLSGVVGVFNCQGAGWCKIE 420 Query: 421 KKTRVHDTSPDTLTGSVCAADVDQIAHVAGTNWKGDVVVYAYKSGEVVRLPEGASLPVTL 480 KKTR+HD SP TL+GSV AADVD IA VAG +W G+ VYA+KSGEV+RLP+GAS+PVTL Sbjct: 421 KKTRIHDYSPGTLSGSVRAADVDAIAQVAGADWNGETAVYAHKSGEVLRLPKGASVPVTL 480 Query: 481 KVLEFEVFHFCPLKEIATNISFAPIGLLDMLNSGGAVEQFEVHMACE-KPELFDGEIPFE 539 KVL++EVFHFCPLKEI +++SFAPIGLLDM NS AVE+ E+H+A + KPEL +GE+ Sbjct: 481 KVLDYEVFHFCPLKEITSDVSFAPIGLLDMFNSSAAVEEVEIHLASDKKPELSNGEV--- 537 Query: 540 LSTSLSENRSPTATIALTARGCGRFGAYSSQRPLKCQVGDAEVEFSYDPNNGLLTFT 596 SENRSPTATI L RGCGRFGAY S+RPLKC +AE YD GL T T Sbjct: 538 -----SENRSPTATIGLKTRGCGRFGAYCSRRPLKCTDDNAETNLEYDSGCGLTTIT 589 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17974 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8552 (68 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6843 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27166260 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3566262 (359 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27584 518 e-149 >Contig27584 Length = 348 Score = 518 bits (1334), Expect = e-149, Method: Compositional matrix adjust. Identities = 260/350 (74%), Positives = 294/350 (84%), Gaps = 7/350 (2%) Query: 1 MGAEPLLPKKTHTHTQPNSPLILGLQPSALIDHVAKIDSSLLAQIPGERGGSIAVAIEDL 60 MGAE L T T +PL+LGLQ SAL+DHVA++D SLL Q+PGERGGSI VAIE+L Sbjct: 1 MGAEAL--TATGNSTAREAPLVLGLQASALVDHVARVDWSLLDQLPGERGGSIPVAIEEL 58 Query: 61 EHILNEVKTHILSSPPDPSPMRTMAGGSVANTIRGLSAGFGVNCGILGACGDDEQGGLFV 120 EHIL+EVK H++S P D PM+T+AGGSVANTIRGLSAGFGV+CGI+GACGDDEQG LFV Sbjct: 59 EHILSEVKPHVISYPDDSLPMKTIAGGSVANTIRGLSAGFGVSCGIIGACGDDEQGQLFV 118 Query: 121 SNMGSSGVNLSALRIKKGPTAQCVCLVDALGNRTMRPCLSSAVKI--QAEELTKEDFKGV 178 SNM S VNLS LR+KKGPTAQCVCLVDALGNRTMRPCLSSAVK+ QA++LT+ DFKG Sbjct: 119 SNMSSHAVNLSRLRMKKGPTAQCVCLVDALGNRTMRPCLSSAVKLQSQADDLTRADFKGS 178 Query: 179 KWLVMRYGIYNLEVIHAAIRMAKQEGVFVSLDLASFEMVRNFRGPLLELLQSGDIDLCFA 238 KWL++RYGI NLEVI AAI +AKQEG+FVSLDLASFEMVRNFR PLL+LL+SGDIDLCFA Sbjct: 179 KWLLLRYGIINLEVIQAAISIAKQEGLFVSLDLASFEMVRNFRSPLLQLLESGDIDLCFA 238 Query: 239 NXXXXXXX---XXXXXNASPEAALEFLAKHCQWAVVTLGSNGCLAKCGREMVRVAAIGEA 295 N A P+ ALEFLAKHC+WAVVTLGSNGC+AK G+E+VRV AIG+A Sbjct: 239 NEDEATELLRGSEGEQKADPDVALEFLAKHCRWAVVTLGSNGCIAKHGKEIVRVPAIGKA 298 Query: 296 KATDATGAGDLFAGGFLYGLVKGLSLEECCRVGTCNGGSVIRSLGGEVTP 345 A DATGAGDLFA GFLYGLVKGLSLEECC+VG+C+GGSVIRSLGGEVTP Sbjct: 299 NAVDATGAGDLFASGFLYGLVKGLSLEECCKVGSCSGGSVIRSLGGEVTP 348 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64198 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17666257 (357 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26451 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10638 (428 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28330 (238 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5682 257 1e-70 >Contig5682 Length = 246 Score = 257 bits (657), Expect = 1e-70, Method: Compositional matrix adjust. Identities = 141/216 (65%), Positives = 156/216 (72%), Gaps = 31/216 (14%) Query: 43 KRGFSET-----------VDLKLNLLS----------KDSVADQAEKMKEKSALPP--SN 79 KRGFSET VDLKLNL + KD A++++ KEK+ ++ Sbjct: 31 KRGFSETESDISTDASTCVDLKLNLSNNSKETNSTGGKDGSAEKSKTNKEKNNNLDFRAS 90 Query: 80 DPAKPPA-KAQVVGWPPVRSFRKNILT-VQKNX------XXXXXXXXXXXFVKVSMDGAP 131 DPAKPPA KAQVVGWPPVRSFRKN+ T VQK+ VKVSMDGAP Sbjct: 91 DPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAP 150 Query: 132 YLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYE 191 YLRKVDLKMYKSY ELSDAL KMFSSFTIGNCGSQGMKDFMNE KL+D+LNGSDY+PTY+ Sbjct: 151 YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYQ 210 Query: 192 DKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLA 227 DKDGDWMLVGDVPWEMFVESCKRLRIMK EA+GL Sbjct: 211 DKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLG 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58440 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47769 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4978 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28932 225 3e-61 >Contig28932 Length = 323 Score = 225 bits (574), Expect = 3e-61, Method: Compositional matrix adjust. Identities = 113/167 (67%), Positives = 129/167 (77%) Query: 1 ANPRIHYETTGPEIWEGSGGKVDALVXXXXXXXXXXXXXKFLKEKSPEIKVYGVEPVESA 60 ANP+IHYETTGPEIW +G KVDALV KFLKE++PEIKVYGVEP ES Sbjct: 154 ANPKIHYETTGPEIWRDTGAKVDALVSGIGTGGTVAGTGKFLKEQNPEIKVYGVEPAESP 213 Query: 61 VLSGGEHAPHKIQGIGAGFIPAVLNVSILDEVIQISSDEAIDTARALALKEGLLVGISSG 120 VL+GG+ H IQGIGAG IPAVL+VS+LDEVIQ++S+EAIDTA+ LALKEGLLVGISSG Sbjct: 214 VLNGGQAGKHLIQGIGAGIIPAVLDVSLLDEVIQVTSEEAIDTAKQLALKEGLLVGISSG 273 Query: 121 XXXXXXXXXXXXXENAGKLIVVVFPSFGERYLSTALFDSLRHEAENM 167 ENAGKLIV VFPSFGERYLS+ALF+S+RHEAEN+ Sbjct: 274 AAAAAAIKLAKRPENAGKLIVAVFPSFGERYLSSALFNSVRHEAENL 320 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33375 (346 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58092 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8371 159 5e-41 >Contig8371 Length = 374 Score = 159 bits (401), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 73/116 (62%), Positives = 87/116 (75%), Gaps = 3/116 (2%) Query: 7 YKKGLWTKEEDRILLDYIQVHGRGRWNRISKITGLKRCGKSCRLRWMNYLSPSVKHGEFT 66 K+G WT EED +L +YI+ G GRW + K GL RCGKSCRLRWMNYL PSVK G+ Sbjct: 44 LKRGPWTPEEDELLANYIKKEGEGRWRTLPKQAGLLRCGKSCRLRWMNYLRPSVKRGQIA 103 Query: 67 EQEEDLIIRLHNLLGNRWSLIAGRVPGRTDNQVKNHWNSHLCKRL---GIKKKNRK 119 EEDLI+RLH LLGNRWSLIAGR+PGRTDN++KN+WN+HL K+L GI + K Sbjct: 104 PDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLSKKLISQGIDPRTHK 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27451 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53631 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38009 (327 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42304 (364 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27972 176 5e-46 >Contig27972 Length = 434 Score = 176 bits (446), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 105/307 (34%), Positives = 167/307 (54%), Gaps = 16/307 (5%) Query: 62 DPSLKRISMGELLAATRNFASDGIIGDGSFGMVYKACLSNGVTVAVKKLSPDAFQGFR-- 119 +P + + +M E+ AT+NF+ IG G FG VYK L +G VA+K+ + Sbjct: 115 EPGILKFTMQEINKATKNFSPSFKIGQGGFGTVYKGRLGDGTLVAIKRAKKSVYDKHLGV 174 Query: 120 EFRAETETLAKLQHRNIVQILGYCVSGSDRVLIYEFIEKGSLDQWLHDTSEDQQLSTPRL 179 EF++E + LA+++H N+V+ GY +++++ E++ G+L Q L + L L Sbjct: 175 EFQSEIQMLAQVEHLNLVKFYGYLEHEDEKIVVVEYVPNGTLRQHL------ECLYGQIL 228 Query: 180 PLSWETRLKIIRGVADGLSYLHNL-DTPIIHRDIKASNVLLDSEFEPHIADFGLARRIEW 238 L+ RL + VA ++YLH D PIIHRDIK+SN+LL F +ADFG AR Sbjct: 229 DLA--ARLDVAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENFRAKVADFGFARLAAD 286 Query: 239 SHS---HVSTQVAGTMGYMPPEYREGVTVATVKADVYSFGILMIEIATGRRPNLPTRLDG 295 S S HVSTQV GT GY+ PEY + T K+DV+SFG+L++E+ TGRRP P R Sbjct: 287 SDSGETHVSTQVKGTAGYLDPEYLRTYQL-TEKSDVFSFGVLLVELVTGRRPIEPKREIK 345 Query: 296 TDVGIVQWARKMVAQERHMEMVDSNVSREGLRENEVRELFRIAHLCTSEISRDRPPISLV 355 + +WA K + ++D + + + ++ +A C + ++RP + Sbjct: 346 ERI-TAKWAMKKFTDGDALSILDPRLEQTAANNVAIEKILELALQCLAPRRQNRPSMRRC 404 Query: 356 VDLLYQL 362 ++L+ + Sbjct: 405 AEILWSI 411 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65345 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35660 (272 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21658 68 2e-13 >Contig21658 Length = 352 Score = 67.8 bits (164), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 64/222 (28%), Positives = 101/222 (45%), Gaps = 28/222 (12%) Query: 25 HLFKPPSIPGTHDLLHGSEVIQVTGA--FGPESIAFDPKGEGPYTGVADGRVLKWEGDGR 82 HL P +P + L +VI++ PE + D +G YT DG + + +G Sbjct: 36 HLPPPSHLPQNNIL---QKVIKLGDGVLLEPEDVDVDKEGT-LYTATRDGWIKRLHKNGS 91 Query: 83 GWTDFAVTTSERKECVRPFAPEMEHICGRPLGLRFDKKTGDLYIADAYFGLQVVEPNGGL 142 W ++ ++ LG+ F K GDL D GL + G Sbjct: 92 -WENWKKVNTDTV-----------------LGITF-TKDGDLVACDTDQGLLKITEAG-- 130 Query: 143 ATPLVTEVEGRRLLFTNDMDIDEVEDVIYFTDTSTDFHRRQFMAALLSGDNTGRLMKYDK 202 T L + V G ++ F +D+ I+ + +YF+ ST F +L G+L+KYD Sbjct: 131 VTVLTSHVNGSKIRFADDV-IEGPDGSLYFSVASTKFGPHDGYLDMLEAKPHGQLLKYDP 189 Query: 203 SSKEVTVLLRGLAFANGVAMSKDRSFVLRYQGIQTTSEGIQK 244 SS E ++LL L FANGVA+SKD+ +++ + + EG K Sbjct: 190 SSGETSILLDHLGFANGVAVSKDQDYLVVCETWKYWLEGKNK 231 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20516 (94 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40618 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11014 62 1e-11 >Contig11014 Length = 227 Score = 61.6 bits (148), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 38/145 (26%), Positives = 60/145 (41%), Gaps = 1/145 (0%) Query: 56 IFTGHTGELYTVACSPMDARLVATGGGDDKGFIWKIFDGDWAFELGGHKDSVCSLDFSAD 115 +F GH+G +Y+ +P+ + + D +W GH V + FS Sbjct: 15 LFQGHSGPVYSATFNPL-GDFILSSSADSTVRLWSTKLNANLVCYKGHNYPVWDVQFSPV 73 Query: 116 GQLLASGSFDGLGKIWDASSGDLKGTLEGPGGGIEWVRWHPRGHLVLAGSEDCTVWMWNA 175 G AS S D +IW + G ++ V+WH + + GS D TV +W+ Sbjct: 74 GHYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDV 133 Query: 176 DRSAYLNMFSGHASSVTCGNFTPDG 200 + +F GH S V +PDG Sbjct: 134 QTGECVRIFIGHRSMVLSLAMSPDG 158 Score = 60.8 bits (146), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 40/128 (31%), Positives = 60/128 (46%), Gaps = 1/128 (0%) Query: 54 MHIFTGHTGELYTVACSPMDARLVATGGGDDKGFIWKIFDGDWAFELGGHKDSVCSLDFS 113 + I GH ++ V + +ATG D +W + G+ GH+ V SL S Sbjct: 97 LRIMAGHLSDVDCVQWHA-NCNYIATGSSDKTVRLWDVQTGECVRIFIGHRSMVLSLAMS 155 Query: 114 ADGQLLASGSFDGLGKIWDASSGDLKGTLEGPGGGIEWVRWHPRGHLVLAGSEDCTVWMW 173 DG+ +ASG DG +WD S+G L G + + + G L+ +GS DCTV +W Sbjct: 156 PDGRYMASGDEDGAIMMWDLSTGRCVTPLMGHTSCVWTLDFSGEGSLLASGSADCTVKLW 215 Query: 174 NADRSAYL 181 + S L Sbjct: 216 DVTASTKL 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22866265 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46547 (389 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6285 698 0.0 >Contig6285 Length = 393 Score = 698 bits (1802), Expect = 0.0, Method: Compositional matrix adjust. Identities = 334/387 (86%), Positives = 357/387 (92%) Query: 1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCSKTNMVMVFGEITTK 60 M+TFLFTSESVNEGHPDKLCDQ+SDA+LDACL QDP+SKVACETC+KTNMVMVFGEITTK Sbjct: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLTQDPDSKVACETCTKTNMVMVFGEITTK 60 Query: 61 AKVDYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGA 120 A VDYEKIVRDTCR IGFVS DVGLDADNCKVLVNIEQQSPDIAQGVHGH SK+PEEIGA Sbjct: 61 ANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFSKRPEEIGA 120 Query: 121 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNEG 180 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKN TC WLRPDGKTQVT+EY N+ Sbjct: 121 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTIEYFNDK 180 Query: 181 GAMVPIRVHTVLISTQHDETVTNDQIAKELREHVIKPVIPSKFMDDKTIFHLNPSGRFVI 240 GAMVPIRVHTVLISTQHDETVTND+IA +L+EHVIKPVIP K++D+KTIFHLNPSGRFVI Sbjct: 181 GAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 Query: 241 GGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPTKVDRSGAYIVRQAAKSVVASGLAR 300 GGPHGDAGLTGRKIIIDTY KDPTKVDRSGAYIVRQAAKS+VA+GLAR Sbjct: 241 GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 Query: 301 RCLVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILELIKENFDFRPGMIAINLDLKRGGNF 360 RC+VQVSYAIGVPEPLSVFVD+Y TGKIPDK+IL+++KE FDFRPGMI+INLDLKRGGN Sbjct: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKETFDFRPGMISINLDLKRGGNG 360 Query: 361 RFQKTAAYGHFGRDDPDFTWETVKLLK 387 RF KTAAYGHFGRDDPDFTWE VK LK Sbjct: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLK 387 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41556 (339 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31412 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1188 223 2e-60 >Contig1188 Length = 241 Score = 223 bits (567), Expect = 2e-60, Method: Compositional matrix adjust. Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 1/120 (0%) Query: 56 KFQRFQESDYLDPKQKGLCLGALFDIAATNGLDMGRRLCIFGFCRSIEMLSDVVEDTVLE 115 +FQRF+ESDY+D +Q GLCLGALFDIAATNGLD GRRLCIFGFCRSIEMLSDVVEDTVLE Sbjct: 123 RFQRFKESDYMDTEQ-GLCLGALFDIAATNGLDTGRRLCIFGFCRSIEMLSDVVEDTVLE 181 Query: 116 HGGEVVAAEKASKGGLHEKLTMTVAVPLLWGVPPASETLHLAVRSGGGIVEKIYWQWDFL 175 HGGEVVAAEKA KGGL EKL MTVAVPLLWGVPPA+ETLHLAV+SGGGIV+K+YWQWDFL Sbjct: 182 HGGEVVAAEKAMKGGLQEKLRMTVAVPLLWGVPPAAETLHLAVKSGGGIVDKVYWQWDFL 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12750 (81 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23855 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29054 60 3e-11 >Contig29054 Length = 359 Score = 59.7 bits (143), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 45/119 (37%), Positives = 62/119 (52%), Gaps = 8/119 (6%) Query: 33 AQLGDVDALRLALDTLNGSIDEPVEDGDTALHLTCLYGFLPCVQLLLERGASLEAKDEDG 92 A +GDV+ L+ AL + DE +G TALH C YG + C Q LLE GA ++A D++ Sbjct: 243 ASVGDVEGLKAALAS-GADKDEEDSEGRTALHFACGYGEVKCAQALLEAGARVDALDKNK 301 Query: 93 AIPLHDACAGGFTEIVELLMNSTNNTECVKRMLESVDVEGDTPLHHAARGEHVGVIRLL 151 LH A G E V LL+ N V L+++D G TP+ A V++LL Sbjct: 302 NTALHYAAGYGRKECVALLL---ENGAAV--TLQNMD--GKTPIDVAKLNNQNDVLKLL 353 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64516 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25232 124 1e-30 >Contig25232 Length = 273 Score = 124 bits (311), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 67/198 (33%), Positives = 108/198 (54%), Gaps = 10/198 (5%) Query: 17 KLLLIGDSGVGKSCLLLRXXXXXXXXXXXXXXXXXXKIRTIELDGKRIKLQIWDTAGQER 76 KL+L+GD G GKS L+LR +T+ ++ +K +IWDTAGQER Sbjct: 85 KLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQER 144 Query: 77 FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESK 136 + ++ YYRGA ++VYD+T+++SF + W+ ++ + N+ L GNKAD+ E++ Sbjct: 145 YHSLAPMYYRGAAAAIIVYDLTNQASFERAKKWVLELKSQGNPNMVMALAGNKADLVEAR 204 Query: 137 RAVPTSQGQALADEYGIKFFETSAKTNFNVEQVFFSIARDIKQRIAESDSKAEPLTIKIS 196 + V Q+ A E G+ F ETSAKT NV +F+ IA+ + R+ + A + + Sbjct: 205 K-VAAEDAQSYAQENGLFFLETSAKTADNVNDIFYEIAKRLP-RVQPVQNPAG--MVLVD 260 Query: 197 KPDPAIGSATAQEKSACC 214 +P + S S+CC Sbjct: 261 RPSERVAS------SSCC 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566259 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41417 (595 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55034 (302 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8189 135 9e-34 >Contig8189 Length = 136 Score = 135 bits (340), Expect = 9e-34, Method: Compositional matrix adjust. Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 11/146 (7%) Query: 138 LNVMEAFRKALTTWARWVDANVNPAKSLVFFRGYSSSHFSGGQWNSGGQ-CDGETEPIRN 196 ++ + A+ K L+TWARWVD+NV+ +++ VFF+G S +H+ G +WNS + C GE P+ Sbjct: 1 MDRLTAYYKGLSTWARWVDSNVDTSRTKVFFQGISPTHYQGKEWNSPKKTCSGELGPLSG 60 Query: 197 ETYIPDYPPKMIVLEKILRGMKTQVTYLNITRITDYRKDGHPSIYRKQNLSDEERRSPLR 256 TY PP + V+ K+L +K V L+IT ++ RKD HPS Y + + Sbjct: 61 STYPAGAPPSVAVVYKVLSTIKNPVYLLDITTLSQLRKDAHPSTYSGDHSGN-------- 112 Query: 257 FQDCSHWCLPGVPDAWNELLYAEILI 282 DCSHWCLPG+PD WN+LLYA +++ Sbjct: 113 --DCSHWCLPGLPDTWNQLLYAALIM 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7415 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22024 (73 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17016 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32536 (63 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48636 (60 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31428 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19111 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33600 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11466261 (66 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14329 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27821 (418 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15114 144 4e-36 >Contig15114 Length = 306 Score = 144 bits (362), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 78/165 (47%), Positives = 114/165 (69%), Gaps = 15/165 (9%) Query: 27 FLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGL 86 + GGN +S L +K RL+WT +LHERF++AV QLGG D+ATPK V+++MG+ GL Sbjct: 3 LVSGGNSLNNSNLA----SKQRLRWTHELHERFVDAVAQLGGPDRATPKGVLRVMGVQGL 58 Query: 87 TLYHLKSHLQKYRLSKNLHGQANSATSKTVVGERMPEANGALMSSPNIGNQTNKSLHLSE 146 T+YH+KSHLQKYRL+K L +S++ ++ P G ++S+ + + + ++E Sbjct: 59 TIYHVKSHLQKYRLAKYL---PDSSSDGKKADKKEP---GDVLSNLD----GSPGMQITE 108 Query: 147 TLQM-IEAQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLG 190 L++ +E Q+RLHEQLEVQR LQLRIEAQGKYL+ ++E+ Q G Sbjct: 109 ALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSG 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47598 (293 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 91040385 178 1e-46 >91040385 Length = 174 Score = 178 bits (451), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 81/109 (74%), Positives = 93/109 (85%) Query: 183 LTSAMLSHFKFKRRGGAAIQGLKGCSYCSHPPLSSPFEILSPAEAMKTESPGWFSFDSES 242 +T+A+LSHFKFKRRGGAAIQGLKGC Y +HPP SSPFEI+SP EAMK ++PGWFSF SE Sbjct: 1 MTNAILSHFKFKRRGGAAIQGLKGCGYTAHPPPSSPFEIMSPGEAMKADTPGWFSFGSEP 60 Query: 243 EKKRGSWTVQDDPYIILKNKLSRVYTTPPTERLKEFYDTPPSKYETIDQ 291 ++K GSW+ QD PY ILKNKLSRVY PP ERLK Y+TPPSKYET+DQ Sbjct: 61 QEKPGSWSRQDVPYTILKNKLSRVYAAPPQERLKPVYNTPPSKYETLDQ 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24808 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21329 80 2e-17 >Contig21329 Length = 398 Score = 80.1 bits (196), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 39/100 (39%), Positives = 63/100 (63%), Gaps = 1/100 (1%) Query: 1 MRNEFMAAWDGLRSKDNQRIIILGATNRPFDLDEAVIRRLPRRIYVDLPDAENRMKILRI 60 ++ E + DGL +K ++ + +L ATN P++LD A++RRL +RI V LP+ E R + Sbjct: 239 LKTELLIQMDGL-TKTSELVFVLAATNLPWELDAAMLRRLEKRILVPLPEPEARRAMFEE 297 Query: 61 FLASENIEPGFQFDKLANATEGYSGSDLKNLCVAAAYRPV 100 L ++ E +D L + TEGYSGSD++ +C AA +P+ Sbjct: 298 LLPAQPDEEKLPYDLLVDRTEGYSGSDIRLVCKEAAMQPL 337 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53186 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2542 246 3e-67 >Contig2542 Length = 204 Score = 246 bits (628), Expect = 3e-67, Method: Compositional matrix adjust. Identities = 116/191 (60%), Positives = 157/191 (82%), Gaps = 1/191 (0%) Query: 86 HPDFIKDTKSAIAEVFRKTDADYLNEEKGQARDAGSTASTAVLVGDRLLVANVGDSRVVA 145 HP F+ DTK AI+E +++TDAD+L+ E+ RD GSTASTAVLVG+ L VANVGDSR V Sbjct: 3 HPQFMTDTKLAISESYQQTDADFLDSERDTYRDDGSTASTAVLVGNHLYVANVGDSRTVI 62 Query: 146 CRAGSAIPLSTDHKPDRSDERQRIEDAGGFVIWAGTWRVGGVLAVSRAFGDKLLKAYVVA 205 +AG AI LS DHKP+RSDER+RIE+AGG V+WAGTWRVGGVLA+SRAFG+++LK YVVA Sbjct: 63 SKAGKAIALSEDHKPNRSDERKRIENAGGVVMWAGTWRVGGVLAMSRAFGNRMLKQYVVA 122 Query: 206 DPEIQEEEI-DGVDFIIIASDGLWNVLSNKEAVAIVQDIMDAEAASRKLIHEAYARGSSD 264 +PEIQ++ + D +F+++A+DG+W+VL+N+ AV + + + EAA+RKL A+ RGS+D Sbjct: 123 EPEIQDQVVDDDFEFLVLATDGVWDVLTNEVAVEVAKTEEEPEAAARKLTAVAFCRGSAD 182 Query: 265 NITCVVVRFKN 275 NITC+VV+F++ Sbjct: 183 NITCIVVKFRH 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22163 (460 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41546 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 124 2e-30 >Contig2543 Length = 199 Score = 124 bits (310), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 69/168 (41%), Positives = 99/168 (58%), Gaps = 4/168 (2%) Query: 17 KLLLIGDSGVGKSTLLLSFTSNTF-EDLSPTIGVDFKVKHVNIGGKKLKLAIWDTAGQER 75 KL+L+GD G GK++L+L F + F E TIG F + +++ +K IWDTAGQER Sbjct: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 Query: 76 FRTLTSSYYRGAQGVIMVYDVTRRETFTNLSDIWAKEIDLYSTNQDCIKMLVGNKVDKES 135 + +L YYRGA ++VYD+T ++F + W E+ N I L GNK D E Sbjct: 72 YHSLAPMYYRGAAAAVVVYDITSMDSFLR-AKKWVLEVQ-RQANPTLIMFLAGNKADLED 129 Query: 136 ERVVTKKEGIDFAREYGCLFLECSAKTRVNVEQCFEELVLKILE-TPS 182 +R V +EG +A+E G +FLE SAKT NV + F E+ K+ + +PS Sbjct: 130 KRKVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKLAKASPS 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22330 (69 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31274 (103 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42037 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7436 (196 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27037 101 8e-24 >Contig27037 Length = 227 Score = 101 bits (252), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 38/65 (58%), Positives = 51/65 (78%) Query: 132 FDCNICLDLARDPVVTCCGHLFCWPCLYRWLHVHSDAKECPVCKGEVTVKNVTPIYGRGD 191 F+CNIC +LA+DP++T CGHLFCWPCLYRWLH HS+++ECP CK + + + P+YGRG Sbjct: 29 FECNICFELAQDPIITRCGHLFCWPCLYRWLHHHSNSQECPFCKALIEEEKLVPLYGRGK 88 Query: 192 NIREP 196 +P Sbjct: 89 TQTDP 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31645 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41061 (78 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54952 (573 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11929 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3266259 (431 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9355 677 0.0 >Contig9355 Length = 475 Score = 677 bits (1747), Expect = 0.0, Method: Compositional matrix adjust. Identities = 322/389 (82%), Positives = 353/389 (90%) Query: 5 CCDSPALAESLTVAFPVSRAREVNTVQRTLVETWGLIRETFIDPTFNHQDWDLKLQQTMV 64 CC+ PA+AESLTVAFP SR EVN+VQ TLVETWGLIRETF+DPTFNHQDWD KLQQTM Sbjct: 87 CCNYPAMAESLTVAFPASRTTEVNSVQTTLVETWGLIRETFVDPTFNHQDWDQKLQQTMT 146 Query: 65 EMFPLRTADAAYNKISGMLSTLGDPFTRIISPKEYQNFRIGSDGNLQGVGIFINAEPRTG 124 EMFPLR+ADAAY KISGMLSTLGDPFTRIISPKEYQ+FRIGS+GNLQGVG+FIN EPRTG Sbjct: 147 EMFPLRSADAAYMKISGMLSTLGDPFTRIISPKEYQSFRIGSNGNLQGVGLFINREPRTG 206 Query: 125 HLIVLSCIEGSPAARAGIHEGDELIEINGERLDGTDDETAAQKLRGRVGTTVTVKLHSGT 184 HL+VLSC+EG PAARAGIH+GDEL+EINGE++DG + E A QKLRGRVGTTVTVK+H G Sbjct: 207 HLVVLSCVEGGPAARAGIHQGDELVEINGEKMDGIETEVAVQKLRGRVGTTVTVKVHRGN 266 Query: 185 GWGSDSGFREVKLSRDFIKLSPISSAIIPHKTPDGHVSKLGYVKLSAFSQTAAAEMENCI 244 DSG +EVKL R++IKLSPIS+A IPHKTPDG ++K GYVKLSAFSQTAAA+MEN I Sbjct: 267 DIRGDSGIKEVKLPREYIKLSPISTATIPHKTPDGRLTKTGYVKLSAFSQTAAADMENAI 326 Query: 245 HEMEAQDVCSYILDLRNNPGGLVKVGLDVAQIWLDGDETLVNTIDRDGNMLPINMVDGHA 304 +EM+ Q V SYILDLRNNPGGLVK GLDVAQIWLDGDETLVNTIDR+GN+LPINMV+GHA Sbjct: 327 NEMKRQGVHSYILDLRNNPGGLVKAGLDVAQIWLDGDETLVNTIDREGNLLPINMVNGHA 386 Query: 305 ITRDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTV 364 IT DPLVVLVNEGSASASEILAGALHDN RA LVGH+TFGKGKIQSVTELHDGSALFVTV Sbjct: 387 ITHDPLVVLVNEGSASASEILAGALHDNRRATLVGHRTFGKGKIQSVTELHDGSALFVTV 446 Query: 365 AKYLSPALHDIDQVGITPDVQCSTEMLSS 393 AKYLSPALHDIDQVGI PDVQC+T+ L S Sbjct: 447 AKYLSPALHDIDQVGIAPDVQCTTDKLHS 475 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18366261 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226750865 220 1e-59 >226750865 Length = 181 Score = 220 bits (560), Expect = 1e-59, Method: Compositional matrix adjust. Identities = 110/181 (60%), Positives = 123/181 (67%), Gaps = 9/181 (4%) Query: 1 MESHDETGCQAPEGPILCINNCGFFGSAATMNMCSKCHKDXXXXXXXXXXXXXXXXXXXX 60 MESHDETGCQAP+ PILC+NNCGFFG AATMNMCSKC+KD Sbjct: 1 MESHDETGCQAPDRPILCVNNCGFFGRAATMNMCSKCYKDTLLKQEQANLAASSIDSIVN 60 Query: 61 XXXXXXXK---------EPIVAGTVDVQAGPVEVKAISTEASNDSSSNQIIESKVKEGPN 111 +P+VA VDVQA VE +STEA +SS + IE K +GP+ Sbjct: 61 GGGGSSSSNSSSSNIFIDPVVASVVDVQAVRVETSVVSTEAYIESSPSMKIEMKENKGPS 120 Query: 112 RCTACRKRVGLTGFNCKCGNLFCAVHRYSDKHDCPFDYRTAARDAIAKANPVVKAEKLDK 171 RCT CRKRVGLTGFNCKCGN FCA HRYSDKHDCPFDYRTA +DAIAKANP+VKA+KLDK Sbjct: 121 RCTTCRKRVGLTGFNCKCGNTFCASHRYSDKHDCPFDYRTAGQDAIAKANPIVKADKLDK 180 Query: 172 I 172 I Sbjct: 181 I 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28359 (140 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13048 (92 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2466261 (322 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11429 225 9e-61 >Contig11429 Length = 321 Score = 225 bits (573), Expect = 9e-61, Method: Compositional matrix adjust. Identities = 109/154 (70%), Positives = 122/154 (79%) Query: 166 SNLSNKPTVRVFCKAKPNHSLTILDGKVYLAPSDKTDMLQHWIKDEKYSTSVKDEEGFPS 225 S LSNKPT R+F KA PN SL+I +GKV LA S TD Q W KDEKYST VKDEE FPS Sbjct: 165 SYLSNKPTFRIFSKADPNFSLSIREGKVILARSQPTDDFQLWYKDEKYSTQVKDEERFPS 224 Query: 226 FALVNKATGQAMKHSIGASHPVQLIPYNPDVLDESVLWTESKDLGDNFRSIRMINNIHLN 285 FAL+NKATG A+KHSIGA+ PVQL PYNPD LDES+LWTES DLGD FR++RM+NNIHLN Sbjct: 225 FALINKATGHALKHSIGATQPVQLRPYNPDDLDESLLWTESADLGDGFRTVRMVNNIHLN 284 Query: 286 VDALHGDRSHGSVHDCTTIVLNKWKKGDNQLWKI 319 +DA HGD+ G VHD TTIV+ KGDNQ WKI Sbjct: 285 LDAYHGDKKSGGVHDGTTIVVWNKNKGDNQRWKI 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7237 (146 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57840 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28266264 (325 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10126 (433 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7888 (525 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31365 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14913 (381 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20723 295 6e-82 >Contig20723 Length = 369 Score = 295 bits (756), Expect = 6e-82, Method: Compositional matrix adjust. Identities = 150/247 (60%), Positives = 182/247 (73%), Gaps = 17/247 (6%) Query: 141 YGQAASNLVAGNNLEVTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPEQA 200 YGQAAS LVAG NLE TIQQI+DMGGG+WD++TV RALRAAYNNPERAV+YLYS IPE Sbjct: 134 YGQAASTLVAGTNLEQTIQQIMDMGGGNWDKETVTRALRAAYNNPERAVDYLYSSIPETT 193 Query: 201 E-GPPAARPPASGLAVNLPTQAPQGPQTTVASSGPNANPLDLFPQGLPSMGSNASAGTLD 259 E P PAS Q S PN+ PL++FPQ S + G+L+ Sbjct: 194 EVAVPVGNFPAS-----------QATDVAPVSGAPNSAPLNMFPQETLSGAGAGALGSLN 242 Query: 260 FLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EG 318 FL+N+ QFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH +FL+LINEPVEG EG Sbjct: 243 FLKNNRQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHTEFLQLINEPVEGSEG 302 Query: 319 NVLGQLG----TVPQAVTITPEERESIERLEAMGFDRALVLEVFFACNKNEELAANYLLD 374 ++ Q +P A+ +TP E+E+IERLEAMGFDRALV+E F AC++NEELAANYLL+ Sbjct: 303 DIFDQADGPDQDLPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE 362 Query: 375 HMHEFEE 381 + +FE+ Sbjct: 363 NAGDFED 369 Score = 110 bits (274), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 51/79 (64%), Positives = 61/79 (77%) Query: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIHQGKVLKDATTLD 60 MK+ VKTLKG+HFEI V+P D V VKKNIE + G D YP QQ+LIH GKVLKD TTL Sbjct: 1 MKLTVKTLKGSHFEIRVQPTDAVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA 60 Query: 61 ENQVAENSFVVIMLSKNKV 79 +N+V E+ F+V+MLSKNK Sbjct: 61 DNKVTEDGFLVVMLSKNKT 79 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57483 (423 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58529 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 165 4e-43 >Contig2543 Length = 199 Score = 165 bits (418), Expect = 4e-43, Method: Compositional matrix adjust. Identities = 84/202 (41%), Positives = 122/202 (60%), Gaps = 14/202 (6%) Query: 8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGRPIKLQIWDTAGQES 67 K +++GD G GK+ L+L+F +F + TIG F ++++++ IK IWDTAGQE Sbjct: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 Query: 68 FRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANPNMTIMLIGNKCDLAHRR 127 + S+ YYRGAA A++VYDIT ++F W+ + ++ ANP + + L GNK DL +R Sbjct: 72 YHSLAPMYYRGAAAAVVVYDITSMDSFLRAKKWVLEVQRQANPTLIMFLAGNKADLEDKR 131 Query: 128 AVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAARILQNIQEGVFDLSNESSGIKV 187 V EEGEQ+AKENGL+FLE SA+TAQNV E F + A ++ + + SGIK+ Sbjct: 132 KVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKLAKAS-------PSRQSGIKL 184 Query: 188 GYGRPQGPSGDGTVSQRGGCCN 209 PQ S+R CC+ Sbjct: 185 HSRSPQN-------SRRMFCCS 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43587 (324 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10241 211 1e-56 >Contig10241 Length = 311 Score = 211 bits (538), Expect = 1e-56, Method: Compositional matrix adjust. Identities = 104/214 (48%), Positives = 145/214 (67%), Gaps = 5/214 (2%) Query: 103 QLKSSDGSSSPFDPVERMKTGFIYFKKEKYDKNPALHAELAKGQSPKFMVFACSDSRVCP 162 ++ +D S F E MK F+ FK KY +N + LAKGQ+PKFMV +C+DSRVCP Sbjct: 82 RVAETDDRSELF---EDMKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCP 138 Query: 163 SHVLDFQPGDAFVVRNVANMVPAYDKIRYSGVGSAVEYAVLHLKVEHIVVIGHSSCGGIK 222 S +L FQPG+AF+VRN+AN+VP+ + S +A+E++V LKVE+I+V+GHS CGGI+ Sbjct: 139 STILGFQPGEAFIVRNIANLVPSLES-GPSETNAALEFSVNSLKVENILVVGHSCCGGIR 197 Query: 223 GLMSFPFDGTSSTDFIEDWVKIGLPAKSKVVAECGDLPFPEQCAYCEKEAVNVSLGNLLS 282 LMS D + FI++WV +G A+S A L F +QC +CEKE++N SL NLL+ Sbjct: 198 ALMSMD-DEIEKSSFIQNWVVVGKDARSWTKAAASTLSFDQQCKHCEKESINRSLLNLLT 256 Query: 283 YPFVREGLVKKTLTLKGGYYDFVKGTFELWGLDF 316 YP++ E + + L + GGYYDFV+ TFE W LD+ Sbjct: 257 YPWIEEKVKQGVLAVHGGYYDFVECTFEKWTLDY 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9852 (124 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58192 (94 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53269 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4715 75 7e-16 >Contig4715 Length = 160 Score = 75.1 bits (183), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 49/162 (30%), Positives = 80/162 (49%), Gaps = 12/162 (7%) Query: 4 EPTRIMIAVNESSIKGYPHPSISSKRAFEWTLQKIVRSNTSAFKLLFLHVHVPDEDGFDD 63 E ++M+A++ES Y AF W L+ + + S+ ++F P + Sbjct: 9 ERKKVMVAIDESEFSLY---------AFNWALENLRETIQSSQLVVF--TAQPIDFASTY 57 Query: 64 MDSIYASPEDF-KNLERRDKARGLQLLEHFVKSSHEFGVSCGAWIKKGDPKEVICHEVKR 122 S A+P +L K L LLE + + G+ + GDPK VIC V++ Sbjct: 58 AASYGAAPAQLVTSLLENHKKVALALLERAKEICAKHGIVPETVTEVGDPKVVICEAVEK 117 Query: 123 IQPDLLVVGCRGLGPFQRVFVGTVSEFCVKHAECPVITIKRR 164 LLV+G G G QR F+G+VS +CV +A+CPV+ ++++ Sbjct: 118 HNIQLLVLGSHGRGGIQRAFLGSVSNYCVHNAKCPVLVVRKQ 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41657 (66 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25841 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15952 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16051 273 8e-76 >Contig16051 Length = 297 Score = 273 bits (699), Expect = 8e-76, Method: Compositional matrix adjust. Identities = 132/150 (88%), Positives = 137/150 (91%) Query: 1 MLTYGFPLAIIGMALKYAELKPVPCLTYSDAQKLRETSXPPILKQVRNDVIRYRYGDEQH 60 MLTYGFPLAIIGMA KYAELKPVPCLTYSDA +LRETS PIL QVRNDV RYRYGDEQH Sbjct: 140 MLTYGFPLAIIGMAFKYAELKPVPCLTYSDALQLRETSATPILTQVRNDVTRYRYGDEQH 199 Query: 61 LEEALKRIFQYGLGGGIPRRSAPTLQMIREEVTEDGKYCLVLVFEAKALQLSDFEKRQAK 120 L+EALKRIFQYG GGGI RRSAPTLQ IREEVT DG+Y LVLVFEAKALQLSDFE+RQAK Sbjct: 200 LDEALKRIFQYGQGGGIARRSAPTLQSIREEVTGDGRYSLVLVFEAKALQLSDFEQRQAK 259 Query: 121 FASFFGPGITAEVAKGENDLYEVRLISNST 150 FASFFGPGITAEV KGEN+LYEVRLISNS Sbjct: 260 FASFFGPGITAEVGKGENNLYEVRLISNSN 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3581 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18502 196 3e-52 >Contig18502 Length = 359 Score = 196 bits (498), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 94/201 (46%), Positives = 133/201 (66%), Gaps = 4/201 (1%) Query: 15 SVVVAKM-GDLDSLCDAFRGCHAVFHTSSFIDIHGVSGYSEWMAFLETEAARNVIEACCR 73 S V+AK+ D++SL AF GC VFHTS+F+D G+SGY++ MA +E +A+ NV++AC Sbjct: 105 SAVMAKLTDDVESLSHAFDGCRGVFHTSAFVDPAGLSGYTKSMAEIEVKASENVMKACAV 164 Query: 74 AAYVKRCIFTSSLLASIWTDDDR---TGIIDESCWSDEEFCRDRKLWLAMGKTAAEKVAW 130 V++C+ TSSLLA +W D + +I+ WS E C D+KLW A+GK AEK AW Sbjct: 165 TPSVRKCVLTSSLLACVWQDSTHNHLSPVINHDSWSTESLCIDKKLWYALGKLRAEKAAW 224 Query: 131 SKSQEMKVKLVTVCPGLLMAPSFPNAHTETSVPYLKGGRMMLQRGVLATNDISKVAKAHV 190 ++E VKL T+CP L+ P + ++ YLKG + M Q GVLAT DI+++A+AH+ Sbjct: 225 KIAEEKGVKLATICPALITGPEISTRNPTATLAYLKGAQEMYQSGVLATVDITRLAEAHL 284 Query: 191 HVYEEMDYGACGRYFCFERVV 211 V+E M+ A GRY CF+RVV Sbjct: 285 GVFEAMNEAAFGRYICFDRVV 305 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41871 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47361 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26604 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41076 (296 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65342 (482 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47781 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50988 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9726 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26166260 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55385 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18017 (138 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49949 (228 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27941 169 4e-44 >Contig27941 Length = 305 Score = 169 bits (428), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 73/104 (70%), Positives = 92/104 (88%) Query: 1 MSCNGCRVLRKGCSESCILRPCLQWIESAESQGHATVFVAKFFGRAGLMSFISAVPENQR 60 +SCNGCR+LRKGCSE+C +RPCLQWI+S ESQ +ATVF+AKF+GRAGLM+ I+A PE+ R Sbjct: 3 ISCNGCRILRKGCSENCSIRPCLQWIKSPESQANATVFLAKFYGRAGLMNLINAGPEHLR 62 Query: 61 PALFRSLLYEACGRTVNPVNGAVGLLGTGNWHVCQAAMETVLRG 104 PA+FRSLLYEACGR VNP+ G+VGLL +G+W +CQ A+E VL+G Sbjct: 63 PAIFRSLLYEACGRIVNPIYGSVGLLWSGSWQLCQVAVEAVLKG 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50683 (143 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35043 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55149 (523 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9815 753 0.0 >Contig9815 Length = 530 Score = 753 bits (1945), Expect = 0.0, Method: Compositional matrix adjust. Identities = 369/531 (69%), Positives = 426/531 (80%), Gaps = 15/531 (2%) Query: 4 QGILGWIFASLLG---FVVFRSVLLKNKKKGGASVEIRDECVKS-------TANGECRSK 53 Q +LG + SLLG F++ + L KKK VE V T NG + + Sbjct: 4 QYVLGGVLVSLLGSVFFMIINTTLSGEKKK---VVEKVSNGVNGNGYVRMPTQNGNFQPE 60 Query: 54 TACEEADXXXXXXXXXXXXLANTLGKDGRRVRVIERDLTEPDRIVGELLQPGGYLKLIEL 113 +A D LA TL KDGRRV VIERDL+EPDRIVGELLQPGGYLKLIEL Sbjct: 61 SA-SGTDVVIVGAGVAGAALAYTLAKDGRRVHVIERDLSEPDRIVGELLQPGGYLKLIEL 119 Query: 114 GLQDCVEE-IDAQRVFGYALFKDGKNTKLSYPLEKFDSDVAGRSFHNGRFIQRMREKAAT 172 GL+DC E IDAQ+VFGYAL+KDG +TKLSYPLE + SD+AGRSFHNGRFIQ+MRE+A Sbjct: 120 GLEDCANESIDAQKVFGYALYKDGNDTKLSYPLENYPSDIAGRSFHNGRFIQKMRERATA 179 Query: 173 LPNVQLEQGTVTSLLEEKGTIRGVNYKTKDGETMTAYAPLTIVCDGCFSNLRRSLCTPKV 232 L NV LEQGTVT+L+EEKGT++GV YK K G+ M +YAPLTIVCDGCFSNLRR+LCTPKV Sbjct: 180 LKNVTLEQGTVTTLIEEKGTVKGVMYKNKAGDEMRSYAPLTIVCDGCFSNLRRNLCTPKV 239 Query: 233 DVPSCFVGLLLEDCELPFANHGHVVLADPSPILFYRISSTEIRCLVDVPGQKVPSISNGE 292 D PSCFVGL+LE+C+LP+ANHGHV+L DPSPILFY IS TE+RCLVDVPG KVPS++NGE Sbjct: 240 DNPSCFVGLILENCDLPYANHGHVILGDPSPILFYPISGTEVRCLVDVPGTKVPSVANGE 299 Query: 293 MAKYLKTVVAPQIPPELYDGFIAAINKGNIRTMPNRSMPAAPHPTPGALLMGDAFNMRHP 352 MAKYLK VVAPQ+PP+L F+AA+ KGNIRTM N+SMPA P PTPGA+L+GDAFNMRHP Sbjct: 300 MAKYLKNVVAPQVPPQLLRSFLAAVEKGNIRTMQNKSMPATPQPTPGAILLGDAFNMRHP 359 Query: 353 LTGGGMTVALSDIVVLRDLLGPLHDLNDAATLCKYLESFYTLRKPVASTINTLAGALYRV 412 LTGGGMTVALSDIV+LRDLL PL DLNDA LC+YLESFYTLRKPV+STINTLAGALY+V Sbjct: 360 LTGGGMTVALSDIVLLRDLLRPLTDLNDAPALCEYLESFYTLRKPVSSTINTLAGALYKV 419 Query: 413 FCASPDQARKEMRDACFDYLSLGGVCSSGPVSLLSGLNPRPLSLVCHFFAVAIFGVGRLL 472 FCASPD AR+EMR+ACFDYLSLGG+C+ GP+SLLSGLNPRP+ L HFFAVA++GVGRL+ Sbjct: 420 FCASPDPARQEMREACFDYLSLGGICARGPISLLSGLNPRPIHLFLHFFAVAVYGVGRLM 479 Query: 473 LPFPSPKRVWXXXXXXXXXXXXXFPIIKAEGVRQMFFPATVPAYYRAPPVK 523 +PFP+PKRVW FPIIK EGVRQMFFPAT+PAYYRAPP++ Sbjct: 480 IPFPTPKRVWLGTRLILGASGIIFPIIKGEGVRQMFFPATIPAYYRAPPLQ 530 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1866260 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41723 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10798 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226761285 62 1e-11 >226761285 Length = 46 Score = 62.0 bits (149), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 28/40 (70%), Positives = 32/40 (80%) Query: 187 VAQEEDFILEPLAYNMDPVLVPEGYVFVLGDNRNNSFDSH 226 V + E FILEP AYNM P+ VPE VFV+GDNRNNS+DSH Sbjct: 1 VERNEKFILEPPAYNMTPIRVPENSVFVMGDNRNNSYDSH 40 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24196 (102 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58110 (313 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19704 104 2e-24 >Contig19704 Length = 181 Score = 104 bits (260), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 51/110 (46%), Positives = 71/110 (64%), Gaps = 1/110 (0%) Query: 3 SSKKDLDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQLSPQ 61 SS +D++ KGPW+ EED L + HG W+ ++KS R+GKSCRLRW N L P Sbjct: 8 SSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPD 67 Query: 62 VEHRAFTPEEDATIIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKR 111 V TPEE I+ HA++GN+W+ IA+ L GRTDN IKN+W + +++ Sbjct: 68 VRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQK 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1466263 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24372 99 3e-23 >Contig24372 Length = 148 Score = 99.4 bits (246), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 52/152 (34%), Positives = 82/152 (53%), Gaps = 7/152 (4%) Query: 5 IARGRLAEERKAWRKNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGYFPLTLH 64 +A R+ +E K +K+ P A P + ++ W TI G + + GG F +++H Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPV-----AEDMFHWQATIMGPGDSPYTGGVFLVSIH 55 Query: 65 FSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQP 124 F DYP KPPK F FHPN+ +G++CL IL E W PA+T+ ++L+ I LL P Sbjct: 56 FPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ--WSPALTISKVLLSICSLLTDP 113 Query: 125 NPADPAQTDGYQLFIQEPAEYKRRVRQQAKQY 156 NP DP + ++ + A+Y+ R ++Y Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARSWTQKY 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1537 (329 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2643 (319 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18960 115 1e-27 >Contig18960 Length = 140 Score = 115 bits (287), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 60/142 (42%), Positives = 91/142 (64%), Gaps = 4/142 (2%) Query: 179 TGVATDMVSMNSTVKLTFRNTATFFGVHVTSTPLDLSYSRLRVASGTIKKFYQSRKSHRS 238 TGV T M++MN +V++T N ATFFG+HV+STP+ L YS + VA+G +KK+YQ RKS+R+ Sbjct: 2 TGVPTKMLTMNCSVRMTVYNPATFFGIHVSSTPIKLMYSEIAVATGQLKKYYQPRKSYRN 61 Query: 239 LTIVLMGDKIPLYXXXXXXXXXXXXXXEPLPLKLSFMLRSRAYVLGKLVKPKFYKRIECS 298 +T+ L G K+PLY +P+ L F +RSR V+G+LV+ K + + C+ Sbjct: 62 VTVNLQGIKVPLYGAGASLAVSDNNGG--VPMMLVFEVRSRGNVVGRLVRSKHRRHVSCT 119 Query: 299 VNLDPKKLNVPLSLK-KSCTYQ 319 + + + P+ LK SCTY+ Sbjct: 120 MEVGSHS-STPIKLKTSSCTYK 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10361 (135 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26779 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35348 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8594 (397 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30538 310 3e-86 >Contig30538 Length = 280 Score = 310 bits (793), Expect = 3e-86, Method: Compositional matrix adjust. Identities = 152/269 (56%), Positives = 193/269 (71%), Gaps = 12/269 (4%) Query: 10 FSPTWIFILCIFSFALGMLFTNRMWVAPESNRQMISTQRHEQELQIISEDCTSK----KK 65 S W LC+ F GM FTNRMW PES T E+ L ++SE C K K+ Sbjct: 16 ISQKWTLFLCLSCFCAGMFFTNRMWTIPESKGITRRTAMEEETLNLVSEGCNPKSLNQKE 75 Query: 66 VG-QDKDVMGEVYKTHEAIQSLDKTISTLQIELSATRTSH---KTGSLESLPDAMRSSHD 121 V ++KD+ GEVYKTH AIQ+LDKTIS L++EL+A R + ++GS P + S D Sbjct: 76 VQRENKDIFGEVYKTHNAIQTLDKTISNLEMELAAARATQESIRSGS----PLSGDSKTD 131 Query: 122 SSPRKKAFMVIGINTAFSSRKRRDSIRETWMPKGQKLLQLEREKGIVVRFMIGHSATSSS 181 S+ +++ MV+GINTAFSSRKRRDS+R TWMP+G+K +LE EKGI++RF+IGHSATS Sbjct: 132 STGKRRYLMVVGINTAFSSRKRRDSVRATWMPQGEKRKRLEEEKGIIIRFVIGHSATSGG 191 Query: 182 ILDRAIDSEESQHKDFLRLEHIEGYHELTAKTKTFFSMAVAQWDAEFYVKVDDDVHVNLG 241 ILDRA+++E +H D LRL+H+EGY EL+AKTK +F+ AVA WDA+FYVKVDDDVHVN+ Sbjct: 192 ILDRAVEAEGRKHGDILRLDHVEGYLELSAKTKIYFATAVATWDADFYVKVDDDVHVNIA 251 Query: 242 MLASTLARHRSKPRVYIGCMKSGPVLSQK 270 L TL RHR K +YIGCMKSGPVL+QK Sbjct: 252 TLGETLVRHRKKQHLYIGCMKSGPVLAQK 280 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56813 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8891 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36844 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30587 (355 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29681 75 2e-15 >Contig29681 Length = 323 Score = 74.7 bits (182), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 53/246 (21%), Positives = 113/246 (45%), Gaps = 5/246 (2%) Query: 99 CRTLQMLIAGLVLGSIFYQLKDNLIGAEERVGLFAF-ILTFLLSCTTEALPIFLQERDIL 157 R + + ++ GS+F+++ + ++R+GL ++ ++ T+ + +F +ER I+ Sbjct: 12 VRARMSVASAVIFGSVFWRMGRSQTSIQDRMGLLQVAVINTAMAALTKTVGVFPKERAIV 71 Query: 158 MKETSSGSYRVSSYAIANGXXXXXXXXXXXXXXXXXXXXXVGLNPNFMAFMHFLLLIWLI 217 +E + GSY + Y ++ L+P F F ++ + Sbjct: 72 NREHAKGSYTLGPYLLSKLLAEIPVGSAFPLMFGAILYPMARLHPTLSRFGKFCGIVTVE 131 Query: 218 LYTANSVVVCFSALVPNFIVGNSVISGVMGSFFLFSGYFISKNGMPDCWIFMHYISLFKY 277 + A+++ + A+VP +V +M F +F GY+++ P + ++ +SL ++ Sbjct: 132 SFAASAMGLTVGAMVPTTEAAMAVGPSLMTVFLVFGGYYVNAENTPIIFRWIPSVSLIRW 191 Query: 278 PFEGFLINEFSGSGKCLDYMFGTCVVKGEDVLREEGYGEESRWRNVVIMVCFILLYRF-I 336 F+G INEF G D+ + GE L +G S R ++ ILL+ + Sbjct: 192 AFQGLCINEF--RGLQFDHQHSYDIQNGEQALERISFG-GSHIRETLVAQSRILLFWYST 248 Query: 337 SYVILR 342 +Y++L+ Sbjct: 249 TYLLLQ 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10612 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27588 (281 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53808 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8855 97 1e-22 >Contig8855 Length = 167 Score = 97.1 bits (240), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 53/149 (35%), Positives = 80/149 (53%), Gaps = 14/149 (9%) Query: 1 MKALRWALDNIKLRSPPSHAEAGSFVILHVQSPPSIATGLNPGAIPFGGPTDLEVPAFTA 60 M AL W L N+ + V+LH + P ++ T L+ A F A Sbjct: 22 MHALSWCLKNV-----AGQNSKDTLVLLHAKPPRAVFTALDGTAYLFSSD-------ILA 69 Query: 61 AIEAHQRRITEAILDHALKICSDKNVNVK--TDVVIGDPKEKICEAAVNLHADLLVMGSR 118 A E + + + +++ A K+C D ++K T V GDP++ IC+ + AD+LVMGS Sbjct: 70 ATEKYGADVADCVMEKARKMCKDLQPDLKAETKVESGDPRDVICQMVERVRADVLVMGSH 129 Query: 119 AFGPIRRMFLGSVSNYCTNHAQCPVMIVK 147 +G I+R FLGSVSN+C + +CPV+IVK Sbjct: 130 GYGVIKRAFLGSVSNHCAQNVKCPVLIVK 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25430 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34451 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25685 152 4e-39 >Contig25685 Length = 227 Score = 152 bits (383), Expect = 4e-39, Method: Compositional matrix adjust. Identities = 99/226 (43%), Positives = 114/226 (50%), Gaps = 50/226 (22%) Query: 1 MTTSKAGTVGGAA-------SQPSPECCMCGDYGFSYELFQCKVCQFRSQHRYCSNLYPK 53 MTTS G ++ + S ECCMCGD+GFSYELF CKVCQFRSQHRYCSNLYP Sbjct: 1 MTTSSKGNNNASSVVQVQEQAAGSHECCMCGDFGFSYELFVCKVCQFRSQHRYCSNLYPN 60 Query: 54 ADSYRVCNWCLNQKDDTPEKTQXXXXXXXXXXXXXXXDGRXXXXXXXXXXXXXXQ----- 108 A+SYR+CNWCL QK+DT EK+Q Sbjct: 61 AESYRICNWCLTQKEDTKEKSQNSSNSSSSCKKESQDQDHPITKISIKKKISSKNSHYPY 120 Query: 109 ----RGSLQLPVSGPIKKQKSPE------------------------RSPTTRKRIIASG 140 RG++QL SGPIKKQ+S + TRKRII + Sbjct: 121 GGCLRGTMQLQPSGPIKKQRSLDLHHLHHLHRQSSAVSPSPSPSPKSAPVVTRKRIITNA 180 Query: 141 CME-ERLTRTNSEG---------SGITKHVFRNKVRRYKLLDEVSS 176 E ER+ RT SE GIT+ VFRNKVRRYKLLDEVSS Sbjct: 181 AKEAERIKRTRSEDISNIKNTSTIGITRQVFRNKVRRYKLLDEVSS 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4016 (349 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19963 (160 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 71823815 68 1e-13 >71823815 Length = 211 Score = 67.8 bits (164), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 43/137 (31%), Positives = 66/137 (48%), Gaps = 17/137 (12%) Query: 32 EVPTVDFSQLTAGTPDERSKAIQVIGKACREWGFFMVINHSMPRRLMDEMLNVGERFFDL 91 ++P +D S L+ +E +K + +AC+EWGFF V+NH + L+ EM + +FF+L Sbjct: 44 KIPILDLSMLSREHKEELNK----LDQACKEWGFFHVVNHGVATELLHEMKDATAKFFEL 99 Query: 92 AEEEKQDH---AGKELFDPIRCGTGFNNGLGNVFLWRDYLKVHVHP----HFHA-PHKPA 143 EEK G+E + G + G W D L + ++P H P P Sbjct: 100 PLEEKNKRRMSGGREGY-----GQAYAISEGQTMDWSDTLILSLYPAQSRDLHVWPTAPN 154 Query: 144 DFRETSEEYCKKSSRRG 160 F+ET E Y + R G Sbjct: 155 GFKETIEAYSSEVKRIG 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4834 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29059 433 e-124 >Contig29059 Length = 329 Score = 433 bits (1114), Expect = e-124, Method: Compositional matrix adjust. Identities = 206/227 (90%), Positives = 218/227 (96%) Query: 1 MKNAENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAIGS 60 +KNAE LA+PSVRNDAAFLFTVVGTTGFLG+LAGQLPGDWGFFVPYL+GSISLIVL +GS Sbjct: 102 IKNAETLAVPSVRNDAAFLFTVVGTTGFLGLLAGQLPGDWGFFVPYLLGSISLIVLGVGS 161 Query: 61 ISPGLLQVAIGGFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDER 120 +PGLLQ AI GFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDER Sbjct: 162 TAPGLLQAAISGFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDER 221 Query: 121 LEKLIYSGQLDTKELDRLAVVAMAGLAAEGLQYDKVVGQSADLFTLQRFINRSKPQLSKD 180 LEKLIYSGQLD KELDRLAVVAMAGLAAEGL+YDKV+GQSADLFTLQRFINRSKPQLSKD Sbjct: 222 LEKLIYSGQLDAKELDRLAVVAMAGLAAEGLKYDKVIGQSADLFTLQRFINRSKPQLSKD 281 Query: 181 QQQNLTRWAVLFAGSLIKNNKAIHEALMTAMSKKGTVLECIEAIEKA 227 QQQNLTRWAVLFAGSL+KN+K IHEAL+TAMS K T+LECIEAIEKA Sbjct: 282 QQQNLTRWAVLFAGSLLKNDKVIHEALITAMSNKATILECIEAIEKA 328 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20699 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53333 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20450 110 2e-26 >Contig20450 Length = 148 Score = 110 bits (274), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 57/152 (37%), Positives = 84/152 (55%), Gaps = 7/152 (4%) Query: 5 IARGRLMEERKAWRKNHPHGFVAKPETLPDGQVNLMVWQCTIPGKPGTDWEGGYFPLTLH 64 +A R+++E K +K+ P A P ++ WQ TI G P + + GG F +T+H Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVA-----EDMFHWQATIMGPPDSPYAGGVFLVTIH 55 Query: 65 FSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQP 124 F DYP KPPK F FHPN+ +G++CL IL E W PA+T+ ++L+ I LL P Sbjct: 56 FPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ--WSPALTISKVLLSICSLLTDP 113 Query: 125 NPADPAQTEGYHLFIQDAAEYKRRVRQQAKQY 156 NP DP E H++ D +Y+ R ++Y Sbjct: 114 NPDDPLVPEIAHMYKTDRNKYETTARSWTQKY 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59348 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8654 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34046 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21039 (120 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11602 104 6e-25 >Contig11602 Length = 299 Score = 104 bits (259), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 75/131 (57%), Positives = 86/131 (65%), Gaps = 21/131 (16%) Query: 1 METMQLLSHTHLQSPAALKPGEMYRYGQF--RR--AGETQMLHILPPQLSSPNYQ-IQFP 55 +E+ LL T+LQS P EM++YGQF RR A + QM H PP +SPNY IQFP Sbjct: 176 LESEALL-RTNLQSQV---PAEMHKYGQFTSRRPTAEDIQMPHNFPPHFNSPNYHHIQFP 231 Query: 56 SSSN-GGRIAVNGGDLSL--ATNHQQWQSGPP--QLFATAAASSGFPPQMIRPN---QQW 107 SSS GGRI G DLSL + +HQQWQS P LFATAAASSGFPPQ I+P+ W Sbjct: 232 SSSEGGGRI---GSDLSLSMSDHHQQWQSATPTSDLFATAAASSGFPPQ-IKPSYTQNGW 287 Query: 108 PQKNGFHSLIR 118 QKNGFHSL R Sbjct: 288 LQKNGFHSLTR 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7372 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30239 201 5e-54 >Contig30239 Length = 227 Score = 201 bits (511), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 94/135 (69%), Positives = 116/135 (85%) Query: 15 EDKYPQHPLLPPDLKKRAINYQAASFVSSSIQPLQNLVEQKYIAEEVGSDEKLSWVKHHM 74 E+KYPQHPLLPPDL+K+AINYQAA+ VSSSIQPLQN+ KYI E+V EKL WV+ H+ Sbjct: 89 EEKYPQHPLLPPDLQKKAINYQAANIVSSSIQPLQNMTVLKYIEEKVRPVEKLEWVQFHI 148 Query: 75 EKGFAALEKLLKDHAAKYASGDEVFLADLFLAPQIHDALTRFNVDMTQFSLLLRLNDAYN 134 KGF ALE+LL +HA KYA+GDEV++ADLFLAPQ++ A+TRF +DMTQF LL RL++AYN Sbjct: 149 GKGFLALEELLNNHAGKYATGDEVYMADLFLAPQLYAAITRFQLDMTQFPLLARLHEAYN 208 Query: 135 ELPAFQDAMPEKQPD 149 ++PAF DA+PEKQPD Sbjct: 209 KIPAFLDALPEKQPD 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6035 (143 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25403 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4758 (383 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 149780162 218 2e-58 >149780162 Length = 363 Score = 218 bits (554), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 138/385 (35%), Positives = 201/385 (52%), Gaps = 45/385 (11%) Query: 3 VQQVLCMKGGDGEASYANNSLLQKKVILEVKPILEESITE-LYCKTFS----ECLKIADL 57 V + M GGDG SY NS Q+ K +L+++I E L + FS +IADL Sbjct: 8 VPEAYPMNGGDGAYSYTKNSNCQRAAANVSKSLLDDAIAEKLDVEDFSCNPSNAFRIADL 67 Query: 58 GCSSGPNTFLPLWEIIDCIG----ATCSRFSREPPAFQIFLNDLPQNDFNAIFKSLARFY 113 GCS GPNTF + I++ + + C S + P FQ+F +D NDFN +F SL Sbjct: 68 GCSVGPNTFFSVQNILEAVKHKYQSQC--ISSQMPEFQVFFSDHVANDFNTLFASLPP-- 123 Query: 114 ERIEKEKEGMSRQCFIVGVPGSFHRRLFPDRSIHFFHSSYSLHWLSQVPEGLVSESGTPL 173 RQ F GVPGSFH +LFP S+HF HSSY+ HWLS+VPE +V ++ Sbjct: 124 ----------ERQYFAAGVPGSFHGQLFPKSSLHFVHSSYAAHWLSKVPEQVVDKNSPAW 173 Query: 174 NKGNIHLTVTTPPSVHKAYLNQFERDFTAFLRLRSQEIIPGGHMLLTLMGSDGNGQNSST 233 NKG I+ T T+P V AY QF +D TAFL R++E++ GG M++ +M + NG S Sbjct: 174 NKGKIYYT-TSPDEVVDAYAAQFGKDMTAFLEARAKELVVGG-MMVIIMQAIPNGTPPSR 231 Query: 234 DGLYKICELISMTLKDMVTEGSIQESELDSFNIPLFMPSPEQVRSVIQRESSFTLLRLET 293 + + + TL ++ EG I E E+DSFNIP + +P+++ VI+R F++ R+E+ Sbjct: 232 IPNGIMFDFLGSTLMEIAKEGLISEGEVDSFNIPTYNTTPKEMMEVIERNGCFSIARIES 291 Query: 294 FKLXXXXXXXXXXXXQVFDKYGR---AKYVVMYIRAVGEPILASHFGGAVMDSLFHRFFM 350 + K G + M +RA E + +HFG + D +F R + Sbjct: 292 --------------TSPWSKAGHMINGPGLTMQLRAGMEGVFKTHFGTEITDQMFDRVYE 337 Query: 351 K---VVENIEMGKGIYTNLVISLSR 372 K ++ IE T L ++L R Sbjct: 338 KSGELIHKIESSCKEGTQLFLALKR 362 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4900 (228 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 149780162 151 1e-38 >149780162 Length = 363 Score = 151 bits (381), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 84/203 (41%), Positives = 116/203 (57%), Gaps = 21/203 (10%) Query: 5 KPILEESITEL-----YCKTSSECLKIADLGCSSGPNTFLPLWEIIDCISATCSR--FSR 57 K +L+++I E + S +IADLGCS GPNTF + I++ + S Sbjct: 38 KSLLDDAIAEKLDVEDFSCNPSNAFRIADLGCSVGPNTFFSVQNILEAVKHKYQSQCISS 97 Query: 58 EPPAFQIFLNDLPQNDFNAIFKSLARFYERIEKEKEGMSRQCFIVGVPGSFHRRLFPDRS 117 + P FQ+F +D NDFN +F SL RQ F GVPGSFH +LFP S Sbjct: 98 QMPEFQVFFSDHVANDFNTLFASLPP------------ERQYFAAGVPGSFHGQLFPKSS 145 Query: 118 IHFFHSSYSLHWLSQVPEGLVSESGTPLNKGNIHLTVTTPPSVHKAYLNQFERDFTAFLR 177 +HF HSSY+ HWLS+VPE +V ++ NKG I+ T T+P V AY QF +D TAFL Sbjct: 146 LHFVHSSYAAHWLSKVPEQVVDKNSPAWNKGKIYYT-TSPDEVVDAYAAQFGKDMTAFLE 204 Query: 178 LRSQEIIPGGHMLLTLMGSDGNG 200 R++E++ GG M++ +M + NG Sbjct: 205 ARAKELVVGG-MMVIIMQAIPNG 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32131 (223 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 147 2e-37 >Contig7384 Length = 326 Score = 147 bits (370), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 81/179 (45%), Positives = 109/179 (60%), Gaps = 3/179 (1%) Query: 46 GYDVIDDAKTQLEAACPGVVSCADILALAARDSVVLTKGLMWKVPTGRRDGRVSLASDV- 104 G+D + AK +EA CPGVVSCADILA+AARD VVL G + V GRRDG +S AS V Sbjct: 100 GFDTVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAGGPSFPVELGRRDGLISKASRVA 159 Query: 105 NNLPGPRDSVEVQKQKFADKGLNDQDLVTLVGGHTIGTSACQAFRYRLYNFSTTTANGAD 164 NLP P ++ FA L+ D++ L G HT+G S C F RLYNFS ++ D Sbjct: 160 GNLPEPTFNLNQLTTMFAKHNLSLTDVIALSGAHTLGFSHCNRFSDRLYNFSPSST--VD 217 Query: 165 PTMDATFVTQLQALCPADGDASRRIALDTGSSDTFDASFFTNLKNGRGVLESDQKLWTD 223 P+++ + QL A CP D + + LD + TFD +++ NL G+G+L SDQ L++D Sbjct: 218 PSLNPDYAKQLMATCPIAVDPNIVMTLDPDTPFTFDNAYYRNLVAGKGLLSSDQVLFSD 276 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51078 (367 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14966265 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17391 136 4e-34 >Contig17391 Length = 196 Score = 136 bits (342), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 71/139 (51%), Positives = 90/139 (64%), Gaps = 7/139 (5%) Query: 3 ILPQCSRLLNQEIRRLSAIAPNQGFVDLERIEHDSPFRSLGQHPNGGPMDLEGWPA-MQT 61 +LP C+RLLNQEI R++ + N + IE SP S G NGG D+ GW + Q+ Sbjct: 64 VLPNCNRLLNQEILRVTTLLGNASVLGQSGIELASPLASRGMFSNGGA-DVNGWASRFQS 122 Query: 62 EENGPLRRMAPFQASSLGWHRAPGIPTTPVVKRVIRLDVPVDKYPNYNFVGRILGPRGNS 121 E +G L+ +S+ W + +VKR IR+D+PVDKYPNYNFVGR+LGPRGNS Sbjct: 123 EMSGLLQ-----SSSTQNWLSPQSSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNS 177 Query: 122 LKRVEAMTECRVYIRGQGS 140 LKRVE TECRV IRG+GS Sbjct: 178 LKRVEVTTECRVLIRGRGS 196 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63997 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7568 77 6e-17 >Contig7568 Length = 115 Score = 77.4 bits (189), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 37/93 (39%), Positives = 54/93 (58%) Query: 24 YAVTCGQVETSLAPCMPYLTGGGNPAAPCCNGVQNLKLLIPPPTDRRDACRCVKAAASKF 83 +A+TCGQV +SLAPC+ Y+ GG CCNG++ + L DR+ AC C+K A Sbjct: 23 HAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSI 82 Query: 84 QNIKEDAASALPTKCGVQIGIPISMTPNCDQIQ 116 + + A+ LP KCGV + IS + NC ++ Sbjct: 83 SGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9437 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53065 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4316 160 1e-41 >Contig4316 Length = 149 Score = 160 bits (404), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 80/112 (71%), Positives = 83/112 (74%) Query: 38 RKPVFTKVDQLKPGTGGHXXXXXXXXXXXXXQKGRSVSQHLRHTRIAECLVGDETGAIIF 97 RKPVF KVDQLKP T GH QK R +R RIAECLVGDETG IIF Sbjct: 9 RKPVFKKVDQLKPDTKGHTLVVKVVSSKMVMQKARPDGIQVRQVRIAECLVGDETGTIIF 68 Query: 98 TARNDQVDMMKAGATVILRNAKIDMFKGSMRLAVDKWGRVEVTEDANFVVKE 149 TARNDQVD+M GATVILRNAKIDMFKGSMRLAVDKWGRVEVTE A+F VKE Sbjct: 69 TARNDQVDLMTTGATVILRNAKIDMFKGSMRLAVDKWGRVEVTEPASFSVKE 120 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31627 (419 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11716 410 e-116 >Contig11716 Length = 294 Score = 410 bits (1053), Expect = e-116, Method: Compositional matrix adjust. Identities = 190/293 (64%), Positives = 236/293 (80%) Query: 126 VLARPGANILLPRPGFPYYEARAAADNLEVRHFDLLPEQGWEVDLEAVKALADENTVAMV 185 +LARPGANILLP+P FP YE +A +LE+RHFDLL E WEVDL+AV+ALAD NTVAMV Sbjct: 1 MLARPGANILLPKPCFPIYELCSAFRHLEIRHFDLLQENAWEVDLDAVEALADHNTVAMV 60 Query: 186 IVNPGNPSGSVFTYEHLKKVAETARNLGIMVISDEVYGHLAFGSKPFVPMGVFGSIVPIV 245 I+NPGNP G+V++Y+HL+K+AETA+ L I VI+DEVYGHLAFG KPFVPMGVFGS VP++ Sbjct: 61 IINPGNPCGNVYSYQHLEKIAETAKKLRIPVIADEVYGHLAFGDKPFVPMGVFGSTVPVL 120 Query: 246 TVGSISKRWVVPGWRLGWLVTNDLNGILHKSGVVESIISCLNISSDPATFIQGAIPEILE 305 T+GS+SKRW+VPGWRLGW VT D G+ V+E I +I PATFIQ A+P IL+ Sbjct: 121 TLGSLSKRWIVPGWRLGWFVTTDPCGMFRIPKVIERIKKYFDILGGPATFIQAAVPRILQ 180 Query: 306 KTKEDFFSNTISILRECADIIHDRIKGIPCITCPQKPEGSMFVMVKLNLFLLEDIDDDVE 365 +T+E FF T+ +L++ +DI DRI IPC+TCP KPEGSM VMVKL+L LLEDI+DD+E Sbjct: 181 QTEEAFFKKTLYLLKQSSDICWDRINEIPCLTCPSKPEGSMAVMVKLDLSLLEDINDDIE 240 Query: 366 FCMKLSKEESVIVLPGVSVGMKNWLRVTFAIDPPSLEDGLGRIKAFYQRHAKK 418 FC KL KEE+VI LPG +VG+ +W+RVTFA DP S+E+ L R K+FYQRHA+K Sbjct: 241 FCFKLVKEENVIFLPGTAVGLTSWIRVTFAADPSSIEEALRRTKSFYQRHARK 293 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34712 (680 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26296 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31808 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22165 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7160 140 2e-35 >Contig7160 Length = 279 Score = 140 bits (353), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 69/153 (45%), Positives = 97/153 (63%) Query: 3 ILNCWNMTLQYVTINATGDSLNTDGIHMGRSTGVNISDAIIKTGDDSLSIGDGSQHINVE 62 + C N+T+ V + A GDS NTDG+H+ S+ + + ++++ TGDD +SIG GS I V+ Sbjct: 1 MFGCKNVTMSNVHLIAPGDSPNTDGLHISTSSQIKVLNSVMATGDDCVSIGQGSHDITVK 60 Query: 63 KVTCGPGHGISVGRLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPVSVATDLHFE 122 VTCGPGHGIS+G LGKY +E V + V NCT NT NG R+KTW AT + +E Sbjct: 61 NVTCGPGHGISIGSLGKYADELSVSQIYVSNCTFRNTTNGARIKTWAGESAGEATGIIYE 120 Query: 123 DIIMNNVGNPILINQEYCPYDQCQAKVPSQVKI 155 DIIM+ V NPI+I+Q Y + + + K+ Sbjct: 121 DIIMDQVQNPIIIDQNYGAKKKVKKNIFGNKKM 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16346 (377 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6095 (117 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12666257 (327 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15994 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27589 185 6e-49 >Contig27589 Length = 543 Score = 185 bits (470), Expect = 6e-49, Method: Compositional matrix adjust. Identities = 83/125 (66%), Positives = 102/125 (81%), Gaps = 4/125 (3%) Query: 1 YNLQDFQTEYENAKFYVIKSFSEDDIHKCIKYDVWASTPNGNKKLDAAFHDAEAKANETG 60 YN DF EY +AKF++IKS+SEDD+HK IKY+VWASTPNGNKKL AA+ +A+ K+ Sbjct: 423 YNKADFPEEYTDAKFFIIKSYSEDDVHKSIKYNVWASTPNGNKKLHAAYQEAQEKSGGC- 481 Query: 61 TKFPIFLFFSVNGSGQFVGVAEMVGQVDFNKDMDFWQLDKWNGFFPVKWHIVKDIPNSQL 120 P+FL FSVN SGQFVG+AEM+G VDFNK++++WQ DKWNG PVKWHIVKD+PNS L Sbjct: 482 ---PVFLLFSVNTSGQFVGLAEMLGPVDFNKNLEYWQQDKWNGCSPVKWHIVKDVPNSLL 538 Query: 121 RHITL 125 +HITL Sbjct: 539 KHITL 543 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41823 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46147 (284 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 71825476 195 9e-52 >71825476 Length = 185 Score = 195 bits (495), Expect = 9e-52, Method: Compositional matrix adjust. Identities = 87/103 (84%), Positives = 98/103 (95%) Query: 1 MNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILNASNHIIRGEADMMLCG 60 MNPFC+PF+TTNMGSAMLAMDLGWMGPNYSISTACATSNFC+LNA+ HI RGE D+MLCG Sbjct: 72 MNPFCIPFSTTNMGSAMLAMDLGWMGPNYSISTACATSNFCMLNAAYHISRGETDLMLCG 131 Query: 61 GSDAAIIPIGLGGFVACRALSQRNNDPTKASRPWDTNRDGFVM 103 GS+AAIIPIGLGGF+AC+ALSQRN++PTKAS PWD NRDGFV+ Sbjct: 132 GSEAAIIPIGLGGFLACKALSQRNSEPTKASCPWDINRDGFVI 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31072 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6446 (139 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40843 (124 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4708 (471 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1830 159 1e-40 >Contig1830 Length = 128 Score = 159 bits (401), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 80/134 (59%), Positives = 95/134 (70%), Gaps = 9/134 (6%) Query: 338 VYNIPFTVEGLKNYRDIQSPVTGGVRVSTPVTRGGSVSPSSSGQTWCVANGETGKEKLQA 397 + +I T GL D SP +V P + SPS+ G TWCVAN + G+EKLQA Sbjct: 4 LLSIALTAAGLSG--DQSSPANE-SKVQVP-----TASPSA-GSTWCVANAKAGEEKLQA 54 Query: 398 ALDYACGEGQADCHPIQPGATCYDPNTLEAHASFAFNSYYQKKGRVIGTCDFQGAAYVVT 457 ALDYACGEG ADC PIQ G+TC+ PNTLEAHAS+AFNS+YQK+ R GTC+F GAAYVV Sbjct: 55 ALDYACGEGGADCRPIQEGSTCFTPNTLEAHASYAFNSFYQKRARGTGTCNFGGAAYVVA 114 Query: 458 QAPRFGKCEFPTGY 471 Q P++G CEFPTGY Sbjct: 115 QPPKYGTCEFPTGY 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15567 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18905 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17804 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20929 (268 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12583 243 3e-66 >Contig12583 Length = 280 Score = 243 bits (619), Expect = 3e-66, Method: Compositional matrix adjust. Identities = 143/285 (50%), Positives = 173/285 (60%), Gaps = 28/285 (9%) Query: 1 MSSSSDIADSGRFTGQRAPARGPEKSSFSQTCSLLSQYIKEKGTFGDLSLGMTCS---LE 57 MSSSS+ A+ +GQR + S+F+QTCS+L QY+KEKG+FGDL+L C+ Sbjct: 1 MSSSSETAE---VSGQRGMRTAEKPSNFTQTCSMLCQYLKEKGSFGDLNLDTACNNMQQS 57 Query: 58 GNGTPESLRQTATTTTMNLFPMTERSAGVSGIPARNMNLKSMNLFPQQAGFGSS--VSKD 115 GTPE RQ A MN FP E S +P + KSM+LFPQQAGFG S ++ Sbjct: 58 NGGTPEMFRQKAPP--MNFFPFVENS---RNMPTAVRDFKSMDLFPQQAGFGPSAPTPRE 112 Query: 116 DAPKIVNSSVKKSGNVEPQTAQMTIFYGGQVIVFNDFPADKAKEVMRLAGMGSSPVPSTT 175 + P +SSVKKS EPQ AQMTIFYGGQVIVFNDFPADKAKEVM LA SS + Sbjct: 113 EVPMTADSSVKKSAPGEPQKAQMTIFYGGQVIVFNDFPADKAKEVMLLASKESSQSHTAP 172 Query: 176 VKNPIDAGGMAPS---------------TPNVVPNFANSLIQERIQRPAQPVACELPIAR 220 P S + N+ PNF N IQE ++ +PV C+LPIAR Sbjct: 173 ASPPAKTNNAFASHLGKSPVNSSSSVPPSSNMFPNFGNQAIQEGVKPSPRPVVCDLPIAR 232 Query: 221 KASLHRFLEKRKDRITARAPYNISNSPAGPHKPAESKSWLGLAAK 265 KASLHRFLEKRKDR+ APY S+ + P KP E+KSWLGLAA+ Sbjct: 233 KASLHRFLEKRKDRLNTLAPYQTSSPASSPAKPTENKSWLGLAAQ 277 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61002 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48939927 118 2e-29 >48939927 Length = 124 Score = 118 bits (295), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 64/110 (58%), Positives = 66/110 (60%), Gaps = 23/110 (20%) Query: 1 MASLDSDVTMVPVXXXXXXXXXXXXXXXXXXXRFEIKKWNAVALWAWDIVVDNCAICRNH 60 MA+LDSDV M+P RFEIKKWNAVALWAWDIVVDNCAICRNH Sbjct: 1 MATLDSDVPMIPAGEGSSSAGPSSTKKPK---RFEIKKWNAVALWAWDIVVDNCAICRNH 57 Query: 61 IMDL--------------------WVCNHAFHFHCISRWLKTRQVCPLDN 90 IMDL VCNHAFHFHCISRWLKTRQVCPL Sbjct: 58 IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLGK 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21566256 (806 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12111 105 3e-24 >Contig12111 Length = 588 Score = 105 bits (262), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 73/198 (36%), Positives = 105/198 (53%), Gaps = 11/198 (5%) Query: 570 KPIIFSMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRK-ESKDLEEQSEMKKMH 628 KP+I ++AR D KN+T LV+ +G+ LREL NL ++ G+R + S + + Sbjct: 9 KPMILALARPDPKKNITTLVKAFGECRPLRELANLTLIMGNRDGIDEMSSTSASLLLSVL 68 Query: 629 ELIETYKLNGQFRWISSQMDRVRNGELYRYIADTKGVFVQPAFYEAFGLTVVEAMTCGLP 688 +LI+ Y L GQ + + ++YR A TKGVF+ PAF E FGLT++EA GLP Sbjct: 69 KLIDKYDLYGQVAY-PKHHKQSDVPDIYRLAAKTKGVFINPAFIEPFGLTLIEAAAHGLP 127 Query: 689 TFATCNGGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIE 748 AT NGGP +I +G IDP+ A+ L K AD W + + GLK I Sbjct: 128 IVATKNGGPVDIHQVLDNGLLIDPHDQQSIADALL----KLVADKQLWARCRQNGLKNI- 182 Query: 749 EKYTW----KIYSERLLT 762 ++W K Y R+ + Sbjct: 183 HLFSWPEHCKTYLSRIAS 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55748 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4687 112 3e-27 >Contig4687 Length = 172 Score = 112 bits (281), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 62/130 (47%), Positives = 79/130 (60%), Gaps = 23/130 (17%) Query: 53 DLEASDPDLEILRILKLDDAIDQIHVKKATPDWLPFVPGSSFWVPP-RGRFSGLADLVGK 111 D A P +LR KL+DAI +I V+++ PDWLPF+PG+S+WVPP R R GLA LV K Sbjct: 45 DSSADSPSDPLLR--KLEDAIHRIIVRRSAPDWLPFLPGASYWVPPPRSRSHGLAQLVDK 102 Query: 112 LAYVLSEDEAMSLTTVRGWPSLSYYVNGASPH--------------------SEVETTSN 151 LA LSE+E MS++TVRGWPS +Y++ G SP + SN Sbjct: 103 LANPLSEEETMSMSTVRGWPSSAYFIEGTSPQLMEPVVVFQSSDDVSNPQPMETADQISN 162 Query: 152 NASQSEDEEG 161 N S+SEDEEG Sbjct: 163 NVSKSEDEEG 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25564 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49623 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9712 (308 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50785 (306 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34902 (353 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3157 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10364 429 e-122 >Contig10364 Length = 221 Score = 429 bits (1104), Expect = e-122, Method: Compositional matrix adjust. Identities = 203/204 (99%), Positives = 203/204 (99%) Query: 1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG 60 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG 60 Query: 61 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI 120 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI Sbjct: 61 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI 120 Query: 121 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV 180 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV Sbjct: 121 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV 180 Query: 181 ESPALAPPEVQIDMAAQQQHEAEL 204 ESPALAPPEVQ DMAAQQQHEAEL Sbjct: 181 ESPALAPPEVQFDMAAQQQHEAEL 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46425 (104 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43604 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19349 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2691 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25017 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43776 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33167 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46391 (343 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65548 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26384 (450 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25664 432 e-123 >Contig25664 Length = 718 Score = 432 bits (1110), Expect = e-123, Method: Compositional matrix adjust. Identities = 228/441 (51%), Positives = 299/441 (67%), Gaps = 9/441 (2%) Query: 2 EVVEFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMF 61 EVV+FLK P+++TA+GA+IPKG LLVGPPGTGKTLLA+A+AGEAG PFFS + SEFVE+F Sbjct: 278 EVVDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGEAGTPFFSCAASEFVELF 337 Query: 62 VGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGF 121 VGVGASRVRDLF+KAK APCIVF+DEIDAV NDEREQT+NQLLTEMDGF Sbjct: 338 VGVGASRVRDLFEKAKSKAPCIVFIDEIDAVGRQRGAGMGGGNDEREQTINQLLTEMDGF 397 Query: 122 EGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHAGNKKFDGDVS 181 GN+G+IV+AATNR D+LDSALLRPGRFDRQVTVD PD+ GR +IL+VH+ K DV Sbjct: 398 SGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVD 457 Query: 182 LDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKTAITSKEIDDSIDRIVAGME--GTVMTD 239 D IA RTPGF+G RR I+ EI D+++RI+AG E V+++ Sbjct: 458 FDKIARRTPGFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSE 517 Query: 240 GKSKSLVAYHEVGHAICGTLTPGHDAVQKVTLIPRGQARGLTWFIPSD---DPTLISKQQ 296 K K LVAYHE GHA+ G L P +D V K+++IPRGQA GLT+F PS+ + L S+ Sbjct: 518 DK-KKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSY 576 Query: 297 LFARIVGGLGGRAAEEVIFGEPEVTTGAAGDLQQITGLAKQMVTTFGMSDIGPWSLMDTS 356 L ++ LGGR AEEVIFG+ VTTGA+ D Q++ +A+QMV FG S + S Sbjct: 577 LENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIGQVAIGAS 636 Query: 357 AQSADVIMRMMARNSMSEKLAEDIDTAVKRISDDAYEIALTHIRNNREAIDKIVEVLLEK 416 + + +M ++ S A+ +D V+ + + AY A + + + + + ++L+EK Sbjct: 637 GGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKDIVTTHIDILHTLAQLLMEK 696 Query: 417 ETMTGDEFRAILSEFVEIPAE 437 ET+ G+EF +S F++ AE Sbjct: 697 ETVDGEEF---MSLFIDGKAE 714 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7615 (367 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63082 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21491 270 1e-74 >Contig21491 Length = 268 Score = 270 bits (690), Expect = 1e-74, Method: Compositional matrix adjust. Identities = 135/177 (76%), Positives = 149/177 (84%), Gaps = 8/177 (4%) Query: 1 MASTACFLHHHALSTPTRVSSQRQLPSL-----RPSQLV-CRAQKQAAN--EDDGAAVSR 52 MASTACFLHHHAL+T S + +Q+V CRAQKQAA E+ GA VSR Sbjct: 1 MASTACFLHHHALTTAASARSSSSSQRQVVNINKHNQVVICRAQKQAAGQEEESGANVSR 60 Query: 53 RLALTVLIGAAAIGTKVNPADAAYGEAANVFGKPKTNTDFLPYNGEGFKLSIPSKWNPSK 112 RLALTVLIGAAA+G+KV+PADAAYGE+ANVFGKPK+NTDFLPY GEGFKLSIP+KWNPSK Sbjct: 61 RLALTVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGEGFKLSIPAKWNPSK 120 Query: 113 EREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDFLLGKQAFFG 169 E EFPGQVLRYEDNFDSNSNVSV ITPTDKKSI DYGSPEEFL+KVD+LLGKQA+FG Sbjct: 121 EVEFPGQVLRYEDNFDSNSNVSVTITPTDKKSIADYGSPEEFLAKVDYLLGKQAYFG 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40503 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12750 339 3e-95 >Contig12750 Length = 248 Score = 339 bits (870), Expect = 3e-95, Method: Compositional matrix adjust. Identities = 158/248 (63%), Positives = 192/248 (77%) Query: 1 MPEGITAEKLLNNIMETISDNAQXXXXXXXXXXXXXXXXTSQFKRLFGREKPVYNLLGAG 60 MPE ITAE LLNNI+ T++D Q F RLFGR+KPV+++LG G Sbjct: 1 MPEKITAEDLLNNIVGTLADKKQKSGSFFGEETSSSVTTQFNFNRLFGRQKPVHHILGGG 60 Query: 61 KSADLMLWRNKKISASFITGATLIWVLFEWLNYHFLTLLCFAVVLGMIAQFVWSNASGVF 120 KSAD++LWRNKKISAS +T AT++WVLFEWLNYHFLTL+ FA++LGM+AQF+WSN SG+ Sbjct: 61 KSADVLLWRNKKISASVLTAATIVWVLFEWLNYHFLTLVGFALILGMLAQFLWSNFSGMI 120 Query: 121 SRSSSEVPRIVLPDELFQNIGVAVGVQVNQALGFLQDVACGGNLKQFXXXXXXXXXXXXI 180 +RS S+VPR+VLP +LF NI +++G ++N+ L F+QDVAC GN+KQF I Sbjct: 121 NRSPSKVPRLVLPKDLFVNIAISIGAEINRGLAFVQDVACEGNVKQFIVVVVSLLIAAMI 180 Query: 181 GSWCNFLTVLYVGFIAAHTLPVLYERYEDQVDGFVYQVLGQLQHNYRKLDSGFLSKIPKG 240 GSWCNFLTVLY+GF+AAHTLPVLYERYEDQVD FVYQVLGQLQHNYRKLD+G LSKIPKG Sbjct: 181 GSWCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFVYQVLGQLQHNYRKLDTGVLSKIPKG 240 Query: 241 SLKGKKHE 248 L KK+E Sbjct: 241 KLSWKKYE 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41607 (174 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47664 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 85 7e-19 >Contig2543 Length = 199 Score = 84.7 bits (208), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 55/165 (33%), Positives = 89/165 (53%), Gaps = 14/165 (8%) Query: 8 KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVV-VDGSTVNLGLWDTAGQED 66 K V +GD GKT +++ + + F T+ F V+ ++ +T+ +WDTAGQE Sbjct: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 Query: 67 YNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYA-PTVPIVLVGTKLDLRED 125 Y+ L P+ YRGA ++ + + S S+ +KKW+ E++ A PT+ + L G K DL ED Sbjct: 72 YHSLAPMYYRGAAAAVVVYDITSMDSFLR-AKKWVLEVQRQANPTLIMFLAGNKADL-ED 129 Query: 126 KQFLIDHPGATPITTAQGEDLKKMIGAAVYIECSSXTQQNVKAVF 170 K+ + + +GE K G V++E S+ T QNV +F Sbjct: 130 KR---------KVGSEEGEQYAKENG-LVFLETSAKTAQNVNELF 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10197 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13602 (406 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7362 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24372 154 8e-40 >Contig24372 Length = 148 Score = 154 bits (388), Expect = 8e-40, Method: Compositional matrix adjust. Identities = 73/145 (50%), Positives = 97/145 (66%) Query: 8 RRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMA 67 +RI+KE + L +P SA P E+M ++ I+GP SPY GGVF + + P +YP Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPGDSPYTGGVFLVSIHFPPDYPFK 63 Query: 68 APKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENI 127 PKV F TK++HPNI+ G ICLDILK++WSPAL I VLLSI +LL+ PNPDDPL I Sbjct: 64 PPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 123 Query: 128 AKHWKSNEAEAVETAKEWTRLYASG 152 A +K++ A+ TA+ WT+ YA G Sbjct: 124 AHMYKTDRAKYEATARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58882 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38939 (77 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17366258 (339 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18537 92 1e-20 >Contig18537 Length = 246 Score = 92.0 bits (227), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 41/93 (44%), Positives = 56/93 (60%) Query: 147 KTQPKLVCPLCRGQINGWTVVEPARHFMNAKSRSCACETCDFSGTYTDLRKHARLEHPLV 206 ++Q L CP+CRG I GW VVE R ++N K RSC+ E+C FSG Y +LR+HAR HP Sbjct: 25 ESQLSLKCPMCRGAILGWEVVEDTRKYLNLKKRSCSRESCSFSGNYQELRRHARRVHPTT 84 Query: 207 RPSEADPXXXXXXXXXXXXXDLGDLLSTLQSSF 239 RPS+ DP + GD++S + S+ Sbjct: 85 RPSDIDPSRERAWRHLEHQREFGDVVSAIHSAM 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv994 (390 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8351 75 2e-15 >Contig8351 Length = 612 Score = 74.7 bits (182), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 63/219 (28%), Positives = 95/219 (43%), Gaps = 22/219 (10%) Query: 149 EEDSGIRLVHMMMTCAESVQRGDLPLAGSLIEEMQALLTRVNTGCGIGKVARYFIDALNR 208 E +S L+ ++ CA + SL+ +++ + G +VA YF +AL Sbjct: 235 EIESEPPLLKALLDCARLAESDPDGAVKSLVRLRESI---SDHGDPTQRVAFYFAEALQN 291 Query: 209 RV--------FTP--QAPCATGWSNENEILYHHFYEACPYLKFAHFTANQAILEAFDGHD 258 RV FT PC + + Y +ACPY KFAH TANQAILEA + Sbjct: 292 RVSFLQSEKSFTTAHDTPC-----EDFTLSYKALNDACPYSKFAHLTANQAILEATERAT 346 Query: 259 CVHVVDFNLMHGLQWPALIQXXXXXXXXXXXXXXXXXXXXSPDGRD---SLREIGLRLAE 315 +H+VDF ++ G+QW AL+Q G SL G RL E Sbjct: 347 KLHIVDFGIVQGVQWAALLQALATRSTGKPVSIRISGIPAPSLGDSPAASLIATGNRLRE 406 Query: 316 LARSVNVRFAFRGVAASRLEDVKPWMLQVSPKEAVXYKL 354 A+ + + F F + + + + ++V P EA+ L Sbjct: 407 FAKLLELNFEFEPI-LTPVHQLDESCVRVDPDEALAVNL 444 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19744 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21775 165 6e-43 >Contig21775 Length = 551 Score = 165 bits (418), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 93/226 (41%), Positives = 133/226 (58%), Gaps = 1/226 (0%) Query: 1 MADLHKSDRGDEIDAVKLSELLYGRHFRVVFIGSTLFALQQLSGINAVFYFSSTVFKSAG 60 M DL + G +L R+++VV +G+ LF LQQ++GINAV Y+S++VF+SAG Sbjct: 322 MHDLRSATSGSAEPEAGWFDLFSSRYWKVVSVGAALFLLQQMAGINAVVYYSTSVFRSAG 381 Query: 61 VPSDL-ANVFVGIANLSGSITAMILMDKLGRKALLVWSFFGMAVAMSVQVXXXXXXXXXX 119 + SD+ A+ VG+AN+ G+ A LMDK GRK+LL+ SF GMA +M + Sbjct: 382 ITSDVAASALVGLANVLGTAVASSLMDKQGRKSLLLTSFGGMAASMLLLSLSFTWKALAP 441 Query: 120 XXVFLSVSGMLLFVLTFXXXXXXXXXXXXXEIFPNRIRAKAMAVCMSVHWVINFFVGXXX 179 LSV+G +L+VL+F EIF +RIRAKA+++ + +HW+ NF +G Sbjct: 442 YSAPLSVAGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVSLSLGMHWISNFVIGLYF 501 Query: 180 XXXXXXXXXXXXYSMFCTFCLMAVVFVKRNVVETKGRSLQEIEIAL 225 Y F CL+AV+++ NVVETKGRSL+EIE AL Sbjct: 502 LSLVTKFGIGTVYFGFAGVCLLAVLYIAGNVVETKGRSLEEIERAL 547 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51896 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49116 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1830 104 1e-24 >Contig1830 Length = 128 Score = 104 bits (259), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 48/89 (53%), Positives = 61/89 (68%), Gaps = 1/89 (1%) Query: 96 GASWCVASQTSSQTALQVALDYACGYGGADCSAIQPAGSCYNPNTLRDHASFAFNDYYQK 155 G++WCVA+ + + LQ ALDYACG GGADC IQ +C+ PNTL HAS+AFN +YQK Sbjct: 37 GSTWCVANAKAGEEKLQAALDYACGEGGADCRPIQEGSTCFTPNTLEAHASYAFNSFYQK 96 Query: 156 NPVPT-SCNFGGTAVVTSTDPSSGTCQYP 183 T +CNFGG A V + P GTC++P Sbjct: 97 RARGTGTCNFGGAAYVVAQPPKYGTCEFP 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25066257 (565 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59929 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9404 (297 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30823 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28992 75 9e-16 >Contig28992 Length = 832 Score = 75.5 bits (184), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 39/130 (30%), Positives = 76/130 (58%), Gaps = 3/130 (2%) Query: 151 GWLRTGDLCYIDDDGFIFIVDRLKELIKYKGYQVPPAELEALLLTHPEIADAAVIPFPDK 210 G+ +GD C D DG+ ++ R+ ++I G+++ AE+E+ L++HP+ A+AAV+ + Sbjct: 679 GYYFSGDGCSRDKDGYHWLTGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGVEHE 738 Query: 211 EVGQYPMAYINRKAGSNLSES---AVMDFIAKQVAPYKRIRRVAFVDSIPKNASGKILRK 267 GQ A++ G SE +++ + KQ+ P+ ++ + +PK SGKI+R+ Sbjct: 739 VKGQGIYAFVTLVEGVPYSEELRKSLILAVRKQIGPFAAPDKIHWAPGLPKTRSGKIMRR 798 Query: 268 DLIQLATSKL 277 L ++A+ +L Sbjct: 799 ILRKIASRQL 808 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22092 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35159 (171 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3666261 (382 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28541 660 0.0 >Contig28541 Length = 531 Score = 660 bits (1704), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/382 (79%), Positives = 350/382 (91%) Query: 1 MSFAPKDEHEAQVQFALERGIPAISAVMGTTRLPFPSRVFDVVHCARCRVPWHIEGGKLL 60 MS APKDEHEAQVQFALERGIPAISAVMGT RLPFP +VFDVVHCARCRVPWHIEGGKLL Sbjct: 150 MSLAPKDEHEAQVQFALERGIPAISAVMGTKRLPFPGQVFDVVHCARCRVPWHIEGGKLL 209 Query: 61 LELNRVLRPGGYFVWSATPVYRKVPEDVGIWNAMSEITKKICWDLVAMSKDSLNGIGAAI 120 LELNRVLRPGG+FVWSATPVY+K+ EDV IWNAM E+TK ICW+LV+++KD++NG+G AI Sbjct: 210 LELNRVLRPGGFFVWSATPVYKKLGEDVEIWNAMKELTKSICWELVSITKDTVNGVGIAI 269 Query: 121 YRKPTSNECYEKRLRNEPPLCEESDNADAAWNIPLQACMHKVPVLTSERGSQWPEQWPLR 180 Y+KPTSNECYEKR +NEPP+C +SD+ +AAWN+PLQ+C+HKVPV ++RGS+WPEQWP+R Sbjct: 270 YKKPTSNECYEKRSQNEPPICAKSDDPNAAWNVPLQSCIHKVPVNATKRGSEWPEQWPVR 329 Query: 181 VEKAPNWLKSSQVGVYGKAAPEDFTSDYEHWKTVVSSSYLKGMGIKWSSVRNVMDMKAVY 240 ++KAP WL SSQVGVYGK APEDFTSD EHWK VV+ SYL GMGI W SVRNVMDM+AVY Sbjct: 330 LDKAPYWLLSSQVGVYGKPAPEDFTSDNEHWKRVVTKSYLNGMGINWKSVRNVMDMRAVY 389 Query: 241 GGFAAALKDLKVWVMNVVPINSPDTLPIIFERGLFGIYHDWCESFSTYPRSYDLVHADHL 300 GGFAAALKDLK+WVMNVV ++SPDTLPII+ERGLFG+YHDWCESF+TYPRSYDL+HADHL Sbjct: 390 GGFAAALKDLKIWVMNVVSVDSPDTLPIIYERGLFGMYHDWCESFNTYPRSYDLLHADHL 449 Query: 301 FSDLKKRCQLTAVIAEVDRILRPEGMLIVRDNVETVSEVESMAKSLQWEVRLTYSKDKEG 360 FS LKKRC L AV+AEVDRILRPEG LIVRD+VET+ E+E+MA+S+QWEV LTYSKDKEG Sbjct: 450 FSKLKKRCNLVAVVAEVDRILRPEGKLIVRDDVETIYELENMARSMQWEVSLTYSKDKEG 509 Query: 361 LLCVKKTFWRPTETQTIKSAIA 382 LLCV+K+ WRP E++T+K AIA Sbjct: 510 LLCVQKSMWRPKESETLKYAIA 531 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3626 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17666265 (256 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7976 279 3e-77 >Contig7976 Length = 241 Score = 279 bits (713), Expect = 3e-77, Method: Compositional matrix adjust. Identities = 147/234 (62%), Positives = 178/234 (76%), Gaps = 12/234 (5%) Query: 18 FFSNVNAFTASGWTKAHATFYGGSDASGTMGGACGYGNLYSTGYGTRTAALSTALFNDGA 77 S+VN + GW+ AHATFYGG DASGTMGGACGYGNLYS GYGT TAALSTALFN+G Sbjct: 14 LVSSVNGYYG-GWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL 72 Query: 78 SCGQCYKIICDYQSDSQWCKKGASVTITATNFCPPNYALPSNNGGWCNPPLQHFDMAQPA 137 +CG CY+I C +D QWC G S+ +TATNFCPP GGWC+PP QHFD++QP Sbjct: 73 TCGACYQIRC--VNDPQWCLPG-SIIVTATNFCPP--------GGWCDPPQQHFDLSQPV 121 Query: 138 WEKIGIYRGGIVPVLFQRVPCKKHGGVRFSVNGRDYFELVLISNVAGAGSIQSVSIKGSR 197 + +I Y+ G+VPV ++RV C++ GG+RF+VNG YF LVL++NV GAG +QSV+IKGSR Sbjct: 122 FLRIAQYKAGVVPVSYRRVRCRRRGGIRFTVNGHSYFNLVLVTNVGGAGDVQSVAIKGSR 181 Query: 198 TSWMAMSRNWGANWQSNAYLNGQSLSFKVTTTDGVTQEFDNVVPSDWGFGQTFS 251 T W AMSRNWG NWQSN+YLNGQSLSF VTT+DG NV P +W FGQT++ Sbjct: 182 TRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSYNVAPPNWSFGQTYT 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65609 (32 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30762 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5037 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48386554 215 7e-58 >48386554 Length = 134 Score = 215 bits (547), Expect = 7e-58, Method: Compositional matrix adjust. Identities = 103/134 (76%), Positives = 119/134 (88%) Query: 1 MSSFRNAISRRAYKERAQPHLRNKFGLLEKRKDYVVRAQAFHKKEEALQKLIEKAAFRNP 60 MSS RNA+SRRA+KERAQP R KFGLLEK KDYV RA+A+HKKEE L+ L +KA +RNP Sbjct: 1 MSSLRNAVSRRAHKERAQPESRKKFGLLEKHKDYVERAKAYHKKEETLRILKQKAFYRNP 60 Query: 61 DEFYFKMIKTRTVDGVHRPESQANKYSPEELMLMKTQDMGYVLQKVQSEKKKIEKLTAML 120 DEF FKMIKTRTV+GVH+ ESQANKY+PEELMLMKTQD+GY+ QKVQSEKKKIEKLTA L Sbjct: 61 DEFNFKMIKTRTVNGVHKLESQANKYTPEELMLMKTQDIGYIFQKVQSEKKKIEKLTATL 120 Query: 121 HSLDNQPTNRSVYY 134 HSLDN+P++R VY+ Sbjct: 121 HSLDNRPSSRHVYF 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46466 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22949 (317 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22951 (302 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42193 (107 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59520 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16366257 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33969 (256 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50709 (306 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34517 (488 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32253 265 1e-72 >Contig32253 Length = 200 Score = 265 bits (677), Expect = 1e-72, Method: Compositional matrix adjust. Identities = 125/199 (62%), Positives = 154/199 (77%) Query: 290 LESKDLAHIVNSNHFARLAKLLDDDKVSGKIIHGGQRDKANLKFAPTILLDVPEDSLVMN 349 + SKD++ IV+S F RLAKLLD+DKVS KI+ GGQ D+ LK APTILLDVPED+ +M Sbjct: 1 MNSKDISRIVSSTQFTRLAKLLDEDKVSNKIVLGGQMDEKQLKIAPTILLDVPEDAQIMQ 60 Query: 350 EEIFGPLLPILTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTV 409 EEIFGPL+PI+TV+K+EDSF +I S+ KPLA Y FTNN++LK+ FV VS+GG++INDTV Sbjct: 61 EEIFGPLMPIVTVEKIEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTV 120 Query: 410 LHFAEKTLPFGGVGESGMGSYHGKFSYEAFSHRKSVLYKGFAGDASARYPPYSDRKXXXX 469 LH + LPFGGVGESGMGSYHGKFS++ FSH+K+VLY+GFAGD+ RYPPY+ K Sbjct: 121 LHVSIGGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRGFAGDSDLRYPPYTPEKQRLF 180 Query: 470 XXXXXXXXXXXILALIGWS 488 ILALIGWS Sbjct: 181 RAVINRDIFTIILALIGWS 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23708 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6300 333 1e-93 >Contig6300 Length = 192 Score = 333 bits (854), Expect = 1e-93, Method: Compositional matrix adjust. Identities = 151/185 (81%), Positives = 173/185 (93%) Query: 3 LWVFGYGSLIWKAGFEYDDRRVCFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGEIC 62 +WVFGYGSLIWKAGF YD+R V FIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGE+C Sbjct: 6 IWVFGYGSLIWKAGFNYDERLVGFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGEVC 65 Query: 63 WGVAYKVSKEEDEQIALTYLEVREKQYDKKAYLDVYAEPMATTPVISGVMVYIASPDKKL 122 WGVAYK+S +ED+++A+TYLEVREKQYDKKAYLD + +PMATT +SGVMVYIASPDKK Sbjct: 66 WGVAYKISNKEDQEVAITYLEVREKQYDKKAYLDFFTDPMATTAAVSGVMVYIASPDKKH 125 Query: 123 NRNYLGPASVEEIAKQIIHAEGPSGPNREYLFQLEQALLQMGCEDKHVMDLANEVRRILS 182 N NYLGPAS EEI+KQI+ AEGPSGPNR+YLF+LE+ALLQ+GC+D+HV+DLANEVRRILS Sbjct: 126 NVNYLGPASTEEISKQIVQAEGPSGPNRDYLFRLEEALLQLGCKDRHVLDLANEVRRILS 185 Query: 183 EKELT 187 E+ELT Sbjct: 186 ERELT 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666258 (377 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15739 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48981 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55037 (444 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5396 84 6e-18 >Contig5396 Length = 134 Score = 83.6 bits (205), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 40/84 (47%), Positives = 56/84 (66%), Gaps = 1/84 (1%) Query: 66 MNTSSKMYSMSEVKKHNSADSTWIVVHGHVYDCTRFLKDHPGGTDSILINAGTDCTEEF- 124 M T +K+Y+M E +HN+ D+ W+V+ G VYD + +L DHPGG D +L G D TE+F Sbjct: 1 MPTLTKLYTMQEASQHNTKDNCWVVIDGKVYDVSTYLDDHPGGDDVLLDATGRDATEDFE 60 Query: 125 DAIHSDKAKKLLEDYRIGELMTTG 148 DA HS A++ +E + IGEL TT Sbjct: 61 DAGHSKTAREEMEAFCIGELDTTS 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9863 (332 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7270 142 6e-36 >Contig7270 Length = 365 Score = 142 bits (359), Expect = 6e-36, Method: Compositional matrix adjust. Identities = 97/331 (29%), Positives = 155/331 (46%), Gaps = 15/331 (4%) Query: 8 ALASGADLNELPAKFIRPAHERPENTKPLEGVSVPVISLAESHDV------LVKEIYKAC 61 L S A L KF+R ERP+ +P+ISLA +V + K+I AC Sbjct: 7 TLTSIAHEKTLQQKFVRDEDERPKVAYNDFSNEIPIISLAGIDEVEGRRGEICKKIVAAC 66 Query: 62 SEWGFFLLKDHGISPGLIEKLQEVGIXXXXXXXXXXXXYANDPSTGKFEGYGTKMTKNLD 121 +WG F + DHG+ LI ++ G+ D S GK G+ + Sbjct: 67 EDWGIFQIVDHGVDAELISEM--TGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQGE 124 Query: 122 EKVEWVDYFFHLMSPPSNVNHQIWPQTPSSYREVTEVYNXXXXXXXXXXXXXXXXXXXXX 181 +W + + P + ++ WP P ++REVT+ Y+ Sbjct: 125 AVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGLD 184 Query: 182 XKVL-KSHVGGDEIELEMKINMYPPCPQPQLALGVEPHTDMSALTLLVPNDVPGLQVWKD 240 + L K+ V D+ ++ +N YP CPQP L LG++ HTD +TLL+ + V GLQ +D Sbjct: 185 TEALTKACVDMDQ---KVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRD 241 Query: 241 D--YWVAVDYLPNALFVHVGDQIEVLSNGKYKSVLHRSTVNKERTRMSWAVFCAPPHKAM 298 D W+ V + A V++GD +LSNG++K+ H++ VN +R+S A F P +A+ Sbjct: 242 DGKTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQEAI 301 Query: 299 IGPLPELVDEPNPAKYSTKTFAEYRYRKFNK 329 + PL + + P + T+ E +K +K Sbjct: 302 VYPLS-VREGEKPILEAPITYTEMYKKKMSK 331 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53740 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47995 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3305 (286 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17959 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13466 155 6e-40 >Contig13466 Length = 361 Score = 155 bits (392), Expect = 6e-40, Method: Compositional matrix adjust. Identities = 89/198 (44%), Positives = 118/198 (59%), Gaps = 7/198 (3%) Query: 40 FSYKELKIATDSFHPSNKIGEGGFGSVYKGQLRDGTTVAVKVLSVEIESMRGEREFVSEL 99 S +ELK TD+F + IGEG +G VY L DG VAVK L V E EF++++ Sbjct: 59 LSVEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEP-ETNVEFLTQV 117 Query: 100 SALTDIKHENLVTLQGCCVEGASRFLVYDYMENNSLAQTLLGAK-----QNRMEFGWEAR 154 S ++ +KHENLV L G CV+G R L Y++ SL L G K Q W R Sbjct: 118 SMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQR 177 Query: 155 RDISLGVGRGLAYLHEEIQPHIIHRDIKAANILLDQNLAPKISDFGLSKLFVDSRSHI-S 213 I++ RGL YLHE++QP IIHRDI+++N+LL ++ KI+DF LS D + + S Sbjct: 178 VRIAVEAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLHS 237 Query: 214 TRVAGTLGYLAPEYALSG 231 TRV GT GY APEYA++G Sbjct: 238 TRVLGTFGYHAPEYAMTG 255 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1663 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22751 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23666259 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2794 (297 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7532 422 e-120 >Contig7532 Length = 295 Score = 422 bits (1084), Expect = e-120, Method: Compositional matrix adjust. Identities = 197/288 (68%), Positives = 229/288 (79%), Gaps = 2/288 (0%) Query: 6 SSSSAVSTALLISVVVSFLMA--ASAGNFYQDFGITWGDGRAKILDNGEFLTLSLDKTSG 63 S + ++ L+S+ + LM ASAGNF+QDF IT+GDGRAKIL+ G+ LTL+LDK SG Sbjct: 3 SCTVPMNMVFLLSLFTTSLMVMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASG 62 Query: 64 SGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILH 123 SGF+SKNEYLFG+IDMQ+KLV GNSAGTVTAYYLSS+GPTHDEIDFEFLGN +G+PY LH Sbjct: 63 SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSEGPTHDEIDFEFLGNSTGEPYTLH 122 Query: 124 TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPYP 183 TNVFSQGKGNREQQF+LWFDPT FHTYSI+WN QRIIF VD PIR F N ES GVP+P Sbjct: 123 TNVFSQGKGNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFP 182 Query: 184 KNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNADACIWFFGAXXXXXXXXX 243 KNQPMRIYSSLWNADDWATRGGL+KTDWTQAPFTASYRNF A+AC + Sbjct: 183 KNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTN 242 Query: 244 XXXXXXDWYSQELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPEC 291 W +Q LD+ + R++WVQ+ +M+YNYC+D KRFPQGLP EC Sbjct: 243 SLTEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPTEC 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45320 (458 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60432 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35776 (532 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9892 61 5e-11 >Contig9892 Length = 183 Score = 60.8 bits (146), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Query: 198 IQQNVWRPQRG--LPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFIN 255 I++ + R +R LP + SVL+AW H PYP + DK L ++TGL Q++NWFIN Sbjct: 92 IREEIMRKRRAGKLPGNTTSVLKAWWQSHSKWPYPTEEDKARLVQETGLHLKQINNWFIN 151 Query: 256 ARVRLW 261 R R W Sbjct: 152 QRKRNW 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61185 (361 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24514 79 1e-16 >Contig24514 Length = 181 Score = 78.6 bits (192), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 45/111 (40%), Positives = 61/111 (54%), Gaps = 11/111 (9%) Query: 23 CDSCKSAAALLFCRADSAFLCVGCDSKIHGANKLASRHERVWM----------CEVCEQA 72 CD C A +FC AD A LC CD ++H ANKLAS+H R + C++C++ Sbjct: 5 CDVCNKDDASVFCTADEAALCDACDHRVHHANKLASKHHRFSLVHPSSKEFPVCDICQER 64 Query: 73 PASVTCKADAAALCVTCDRDIHSANPLARRHDRVPVVPFYDSAES-LVKST 122 A + C+ D A LC CD IH+AN R+H+R + SA S L KS+ Sbjct: 65 RAFLFCQQDRAILCRECDLPIHNANEHTRKHNRYLLTGIKLSATSALYKSS 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33350 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28902 331 6e-93 >Contig28902 Length = 208 Score = 331 bits (848), Expect = 6e-93, Method: Compositional matrix adjust. Identities = 158/185 (85%), Positives = 164/185 (88%) Query: 1 MVNGSLKQFLQXXXXXXXXXXXXXXAMDASFGMEYLHGKNIVHFDLKCENLLVNMRDPHR 60 MVNGSLKQFLQ AMDA+FGMEYLHGKNIVHFDLKCENLLVNMRDP R Sbjct: 20 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 79 Query: 61 PVCKIGDLGLSKVKQHTLVSGGVRGTLPWMAPELLSGKTNMVTEKIDVYSFGIVMWELLT 120 PVCKIGDLGLSKVKQ TLVSGGVRGTLPWMAPELLSGK+NMVTEKIDVYSFGIVMWELLT Sbjct: 80 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSNMVTEKIDVYSFGIVMWELLT 139 Query: 121 GDEPYADMHCASIIGGIVNNTLRPQIPRWCEPEWKYLMESCWASDPAERPSFSEISQKLR 180 GDEPY DMHCASIIGGIVNNTLRPQIP WC+PEWK LMESCWA +P++RPSFSEISQKLR Sbjct: 140 GDEPYRDMHCASIIGGIVNNTLRPQIPPWCDPEWKSLMESCWAPEPSQRPSFSEISQKLR 199 Query: 181 NMADA 185 NMA A Sbjct: 200 NMAAA 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20565 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10804 152 4e-39 >Contig10804 Length = 576 Score = 152 bits (384), Expect = 4e-39, Method: Compositional matrix adjust. Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 1/101 (0%) Query: 1 MYGFKIKKCSKTRSHDWTECPFAHRGEKAKRRDPRKVNYAAISCPDFRNGAECPRGEACE 60 M+ FK+K CS+ SHDWTECPF H GE A+RRDP+K Y+ + CP+FR G+ C +G+ACE Sbjct: 225 MFTFKVKPCSRAYSHDWTECPFVHPGENARRRDPKKYPYSCVPCPEFRKGS-CQKGDACE 283 Query: 61 FAHGVFEYWLHPAKYRTRACNAGTFCQRKVCFFAHTPEQLR 101 +AHGVFE WLHPA+YRTR C T C RKVCFFAH PE+LR Sbjct: 284 YAHGVFESWLHPAQYRTRLCKDETGCTRKVCFFAHRPEELR 324 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39703 (285 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9011 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3951 (155 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38144 (274 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32739 307 1e-85 >Contig32739 Length = 279 Score = 307 bits (786), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 158/230 (68%), Positives = 173/230 (75%), Gaps = 3/230 (1%) Query: 17 FTRTHSIXXXXXXXXXXXXXXXXXXTTFQGLSLQDAKRGFSNSVLA-ADSRSSFAS-VRR 74 F R HS ++FQGLSL +AKRG S++A ++RS + VRR Sbjct: 19 FNRHHSTRTPQVATPKQFPPVQCQKSSFQGLSLGEAKRGVLYSLVADLNNRSGLGNNVRR 78 Query: 75 GLEITARTAGAAKNIEVEVDKPLGLTLGQKSGGGVVITAVEXXXXXXXXXXXXXDQVLYT 134 GL +TARTAGAAK+IE EVDKPLGLTLGQK GG V ITAV+ DQV+YT Sbjct: 79 GLRVTARTAGAAKSIEAEVDKPLGLTLGQKPGGPVTITAVDGGGNAAKAGLKAGDQVIYT 138 Query: 135 SSFFGDELWPADKLGFTKTAIQAKPDSVYFVVSR-GAEVDVKRLPKRPAPPRFGRKLTEA 193 SSFFGDELWPADKLGFTKTAI AKPDSVYFVVSR GA VDVKRLPKRPAPPRFGRKLTEA Sbjct: 139 SSFFGDELWPADKLGFTKTAINAKPDSVYFVVSRGGAPVDVKRLPKRPAPPRFGRKLTEA 198 Query: 194 QKARATHICLDCGFIYTLTKPFEEQSDAYVCPQCSAPKKRFARYDVVTGK 243 QKARATHICLDCGFIYTL KPF+EQ D+Y CPQC APKKRFA+YDV TGK Sbjct: 199 QKARATHICLDCGFIYTLQKPFDEQPDSYTCPQCLAPKKRFAQYDVNTGK 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49533 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24372 172 1e-45 >Contig24372 Length = 148 Score = 172 bits (435), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 81/83 (97%), Positives = 82/83 (98%) Query: 3 EVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 62 +VAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH 125 Query: 63 MYKTDRAKYETTARSWTQKYAMG 85 MYKTDRAKYE TARSWTQKYAMG Sbjct: 126 MYKTDRAKYEATARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40129 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48939 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27115 (141 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2542 106 2e-25 >Contig2542 Length = 204 Score = 106 bits (265), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 61/132 (46%), Positives = 86/132 (65%), Gaps = 3/132 (2%) Query: 1 RAGCAFALSKDHVASCLEERERVTNAGGQVKWQVDTWRVGPAALQVTRSIGDDDLKPAVT 60 +AG A ALS+DH + +ER+R+ NAGG V W TWRVG L ++R+ G+ LK V Sbjct: 64 KAGKAIALSEDHKPNRSDERKRIENAGGVVMW-AGTWRVG-GVLAMSRAFGNRMLKQYVV 121 Query: 61 AEPEITETILSVEDEFLVMASDGLWDVVSNAEVVSIIRDTVKEPGMCSKRLATEAAERGS 120 AEPEI + ++ + EFLV+A+DG+WDV++N EV + T +EP +++L A RGS Sbjct: 122 AEPEIQDQVVDDDFEFLVLATDGVWDVLTN-EVAVEVAKTEEEPEAAARKLTAVAFCRGS 180 Query: 121 KDNITVIVIFLR 132 DNIT IV+ R Sbjct: 181 ADNITCIVVKFR 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53215 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15666258 (608 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14765 86 1e-18 >Contig14765 Length = 173 Score = 85.9 bits (211), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 44/128 (34%), Positives = 71/128 (55%), Gaps = 2/128 (1%) Query: 477 IRILLTYSEELSHMLYAAADMVLVPSIYEPCGLAQMIGMRYGAIPIVRKTGGLADTVFDM 536 R + ++ +SH + A D++L+PS +EPCGL Q+ MRYG +P+V TGGL DTV + Sbjct: 36 FRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLNQLYAMRYGTVPVVHSTGGLRDTVVNF 95 Query: 537 DD--QLHRETANGFVFEGIDEGSLNWALDRAFSFYREKPEEWNTTIQKVMEIDNSWNNTA 594 + Q + G+ F + + S+ AL A +RE W +++ ME D +W + A Sbjct: 96 NPYAQGGKGDGTGWTFSPLTKESMLAALKLACRTFREYKPSWEGLMKRGMERDFTWESAA 155 Query: 595 GKYIDIYN 602 KY ++ Sbjct: 156 IKYERVFG 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20292 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6226 (404 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47538 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43368 (465 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16766258 (393 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48413346 102 8e-24 >48413346 Length = 127 Score = 102 bits (255), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 53/77 (68%), Positives = 62/77 (80%), Gaps = 5/77 (6%) Query: 1 MFDIPVDGSRSRKSGPINNAPSRTGSFGGAASHSGPIMSNSINRP-----GSVSSAGIPG 55 MFDIP+DGS+SRKSG + +APSRTGSFGGAASHSGPIM N+ R G VSS G+ G Sbjct: 51 MFDIPMDGSKSRKSGQLTSAPSRTGSFGGAASHSGPIMPNAAARASYTTSGPVSSGGMTG 110 Query: 56 SASVKKTNSGPLNRHGD 72 S S+KKTNSGPLN+HG+ Sbjct: 111 SVSIKKTNSGPLNKHGE 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39293 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13481 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61762 (155 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4466264 (57 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61067 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3063 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36389 (542 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32119 65 2e-12 >Contig32119 Length = 141 Score = 65.5 bits (158), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 2/55 (3%) Query: 473 SGEDVAQCYICLAEYEEGDKIRVLPCHHEYHMSCVDKWLKEIHGVCPLCRGDVRE 527 SGED A C ICLA+Y + D++R LPC H +H+ CVDKWLK I+ CPLC+ + E Sbjct: 78 SGED-AVCCICLAKYADDDELRELPCLHVFHVECVDKWLK-INASCPLCKSEAGE 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20864 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56446 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25190 363 e-102 >Contig25190 Length = 328 Score = 363 bits (931), Expect = e-102, Method: Compositional matrix adjust. Identities = 170/236 (72%), Positives = 196/236 (83%) Query: 4 DFWNEAIKLADLHHPNVVAFYGVVLDGPGGSVATVTEYMVNGSLRNSLQKNEKNLDKRKR 63 +FW EA L+ LHHPNVVAFYGVV +GPGG++ATV E+MVNGSLR+ L E++LD+RKR Sbjct: 90 EFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVAEFMVNGSLRHVLLSKERHLDRRKR 149 Query: 64 LLIAMDVAFGMEYLHGKNIVHFDLKSDNLLVNLRDPHRPICKVGDLGLSKVKCQPLISGG 123 L+IAMD AFGMEYLH KNIVHFDLK DNLLVNL+DP RPICKV D GLSK+K L++GG Sbjct: 150 LIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLKDPQRPICKVADFGLSKIKRNTLVTGG 209 Query: 124 VRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYADLHYGAIIGGIVSNTL 183 VRGTLPWMAPELLNG SS VSEKVDVFSFGIV+WE+LTGEEPYA++HYGAIIGGIV+NTL Sbjct: 210 VRGTLPWMAPELLNGGSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTL 269 Query: 184 RPSVPEFCDPEWRALMERCWSSEPSERPSFTEIANQLRSMAAKIPPKGQISQPQVQ 239 RP VP FCD EW+ LME+CW+++P RPSFTEI +LR M A P QPQ Q Sbjct: 270 RPHVPPFCDSEWKLLMEQCWAADPVVRPSFTEITKRLRVMTAACRPTKPPVQPQNQ 325 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25846 (432 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9892 320 2e-89 >Contig9892 Length = 183 Score = 320 bits (821), Expect = 2e-89, Method: Compositional matrix adjust. Identities = 160/185 (86%), Positives = 173/185 (93%), Gaps = 2/185 (1%) Query: 248 MEAVMACWELEQSLQSLTGVSPGEGTGATMSDDEDDQADSETNLFDGSLDGPDSMGFGPL 307 MEAVMACWE+EQSLQSLTGVSPGEGTGATMSDDEDDQ DS+ NLFDGS++G DSMGFGPL Sbjct: 1 MEAVMACWEIEQSLQSLTGVSPGEGTGATMSDDEDDQVDSDANLFDGSMEGHDSMGFGPL 60 Query: 308 VPTETERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSH 367 +PTE+ERSLMERVRQELKHELKQGYKEKIVDIREEI+RKRRAGKLPG+TTS+LKAWWQSH Sbjct: 61 IPTESERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGNTTSVLKAWWQSH 120 Query: 368 SKWPYPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSSSAVLKTKRKRSNAGEIN 427 SKWPYPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPS+S VLK+KRKR + Sbjct: 121 SKWPYPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSTSTVLKSKRKRGENS--S 178 Query: 428 NDHFL 432 D F+ Sbjct: 179 GDRFI 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7913 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7520 141 1e-35 >Contig7520 Length = 419 Score = 141 bits (355), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 75/211 (35%), Positives = 114/211 (54%), Gaps = 11/211 (5%) Query: 10 DKAYEFFLNMSIHLPRSAGIIVNTFEALEPRAVETILDGLCVLDGPTPPIFCIGPLIAVD 69 D + ++ ++ + GI+ NTF LE A+ + D PP++ +GP I +D Sbjct: 197 DGSRPAYIKLASRFRETRGIVANTFVELETHAITLFSN-----DTRIPPVYPVGPGIDLD 251 Query: 70 DRXXXXXXXXXXIPECLTWLESQPKRSVXXXXXXXXXXXXEEQLKEIAVGLERSGQRFLW 129 D + + WL+ QP++SV EQ+KEIA+GLE+SGQRFLW Sbjct: 252 DGQAHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFRAEQVKEIALGLEQSGQRFLW 311 Query: 130 VVRSPPSKDPSRRFLAPPE-PDLNSLLPDGFLDRTKERGLVVKSWAPQVAVLNHASVGRF 188 +R P K P + +L + PDGFL+RT + ++ WAPQ VL H++ G F Sbjct: 312 SLRMQPPKG-----TVPSDCSNLEEVFPDGFLERTNGKKGLICGWAPQEEVLAHSATGGF 366 Query: 189 VTHCGWNSVLEAVCAGVAMVAWXLYAEQRFN 219 ++HCGWNS+LE++ GV + W +YAE + N Sbjct: 367 LSHCGWNSILESLWHGVPIATWPMYAEHQLN 397 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38202 (478 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39281 (339 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31687 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46601413 181 8e-48 >46601413 Length = 118 Score = 181 bits (459), Expect = 8e-48, Method: Compositional matrix adjust. Identities = 84/118 (71%), Positives = 94/118 (79%) Query: 39 ENRQTNDFIILNDHVEAPEELPKKTKLFFAHAADNWDAEFYAKVNDDVYVNIDALVTTLE 98 EN +TNDFIIL+D VEA EE PKKTKLF+ HA +NWDAEFY KVNDDVYVN+D L TL Sbjct: 1 ENDRTNDFIILDDQVEASEERPKKTKLFYIHAVENWDAEFYVKVNDDVYVNLDVLGATLT 60 Query: 99 AHLQVSRTYIGCMKSGEVFSDVGHKWYESDWWKFGDGKSYFRYASGEMYVISRGLAKF 156 ++ R YIGCMKSGEVFS+ HKWYE DWWKFGD KSYFR+ASGE+Y I R LA F Sbjct: 61 TYIDKPRVYIGCMKSGEVFSEPTHKWYEPDWWKFGDAKSYFRHASGELYAIFRALAHF 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31403 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33937 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34026 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32276 70 2e-14 >Contig32276 Length = 166 Score = 70.5 bits (171), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 35/86 (40%), Positives = 53/86 (61%), Gaps = 3/86 (3%) Query: 97 FIFTSNKE---MQEAVSNLAYLLGATMLLNSMQPVLSXVAVGSGWQALVAYINLGCYYII 153 F SN ++E +++ LL +++++S+Q V S VA G GWQ LV Y+NL +Y + Sbjct: 29 FFIDSNANYAVLKEDFASMTPLLAISIIVDSVQSVFSSVARGCGWQHLVVYVNLATFYFV 88 Query: 154 GVPLGCLLGYLAKFGVKGLWGGMICG 179 G+ + LLG+ K KGLW G+ICG Sbjct: 89 GMTIAVLLGFKFKLYAKGLWIGIICG 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19130 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31992 153 2e-39 >Contig31992 Length = 566 Score = 153 bits (386), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 68/148 (45%), Positives = 97/148 (65%), Gaps = 1/148 (0%) Query: 21 ASMAEGRTHYYDFVLKETNFTKLCKTKSMMTVNDSFPGPVIRIHRGDLVYINVHNQDDFG 80 +S+A G + F + T+LC+ +S+ VN+S+PGP I GD + I+V NQ + Sbjct: 17 SSVASGAIVEHSFNVNNLTVTRLCQNQSITVVNESYPGPTIYAREGDTLIIHVLNQSPYN 76 Query: 81 VTIHWHGVKQTRNPWSDGPDHITQCKIQPGTNFTYKVIFGEDQEGTLWWHAHSDWTRASV 140 +TIHWHG+ Q + W+DGP ++TQC I PG ++TYK QEGTLWWHAH W RA+V Sbjct: 77 ITIHWHGIYQLLSAWADGPAYVTQCPIPPGQSYTYKFNI-TGQEGTLWWHAHISWLRATV 135 Query: 141 HGAIVILPTEGTTYPFPKPDGDHLLVLG 168 HGA++I P G ++PFPKP + ++LG Sbjct: 136 HGALIIHPKAGQSFPFPKPAKEVPIILG 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10907 (415 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10475 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27904 96 3e-22 >Contig27904 Length = 191 Score = 96.3 bits (238), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 76/196 (38%), Positives = 101/196 (51%), Gaps = 29/196 (14%) Query: 3 KKMKRMVMESSPHAVYEDAKSRFKHQSLLQDFHELQKETEAMKKKLQSVNLNKLTLLAEV 62 KKMK +V ++ ED ++RFKHQSL+QD+ ELQK+ +AMKKKLQ + K TL+AEV Sbjct: 2 KKMKGVVSDA-----VEDQRTRFKHQSLMQDYEELQKDADAMKKKLQMMKQKKSTLVAEV 56 Query: 63 RFXXXXXXXXXXNMAPKTPPEPELKQPQNSATQ-----------------------LKNI 99 RF N + T P+ ++ + N TQ L Sbjct: 57 RFLRRRYNYLMGNQSTHTRPKQDVVKTHNLDTQRVTYLKGKSSSKKESASRCPLPALDLN 116 Query: 100 TREKNHSGKQAAAMRNPAPVFGGNMKERIHKGKVAALPNPDPGYELNQKTRGYSGKEAAL 159 +EK G + +R P P F N+ R GK A L P P ++LN+K R SGK+ A Sbjct: 117 KKEKVKHGME-DIVRKPPPKFDLNLNARALGGKEATLRTPTPNFDLNKKERVQSGKDTAK 175 Query: 160 RNPVPVFDLNKISVSK 175 R PVFDLN+ISV K Sbjct: 176 RKSTPVFDLNQISVIK 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19945 (463 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13297 (329 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59383 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31992 135 3e-34 >Contig31992 Length = 566 Score = 135 bits (341), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 66/141 (46%), Positives = 96/141 (68%), Gaps = 3/141 (2%) Query: 1 NNISFQSPT-IDILQAYYYNISGVYGDKFPSHPPLVFDFTAEYPPLKYET--PRKGTEVR 57 NN SF +PT +L+A++ N++GVY FP+ PP+ FD+T L K T+V+ Sbjct: 385 NNESFMAPTNTSMLEAHFNNVNGVYTRDFPNEPPVKFDYTDTNLSLDLSLIFAPKSTKVK 444 Query: 58 VLEYNSTVEIVFQGTNLVAGTDHPMHLHGYSFYVVGWGFGNFDKNRDPLRYNLVDPPLQN 117 L++NSTV++VFQ T +A +HPMHLHG+ F+V+ GFGN+D DP ++N V+P ++N Sbjct: 445 TLKFNSTVQLVFQNTAFLAIENHPMHLHGFDFHVLAQGFGNYDPINDPKKFNFVNPQVRN 504 Query: 118 TIAVPKNGWTAIRFKASNPGM 138 TI VP GW IRF+A+NPG+ Sbjct: 505 TIGVPVGGWAVIRFRANNPGI 525 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53854 (532 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55460 (272 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53383 (292 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22916 139 4e-35 >Contig22916 Length = 286 Score = 139 bits (351), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 74/211 (35%), Positives = 124/211 (58%), Gaps = 1/211 (0%) Query: 76 DGNWLLKKKGQEVASNLNGRCIFLVGMMGSGKTTVGKILSEALGYSFVDSDTFVEKAVGG 135 D + +K K ++ L G IFLVGM S KT++GK+L+ L Y + DSD+ VE+A GG Sbjct: 68 DPSSAVKNKAIDITPELKGTSIFLVGMKSSMKTSLGKLLANVLRYYYFDSDSLVEEAAGG 127 Query: 136 TSVSQIFNQCGEKFFRDYESEALRKLASIPKQVVATGGGAVVRPINWKYMKQGVSVFLDV 195 S +++ + +R+ E+E L++L+S+ + VV G GAV N ++ G+S+++DV Sbjct: 128 GSAAKLLREADTNGYRESETEVLKQLSSMGRLVVCAGDGAVQSSTNLALLRYGISIWIDV 187 Query: 196 PLDTLARRIADVGTDSRPLLHFESGDAYTKAFVGLFTLSKKRTEAYANADATVSLQHIAA 255 PLD +AR + + P L+ + +Y + L T+ ++ Y ADATVS++ +A Sbjct: 188 PLDLVARGMIE-DQSQLPALNVSASASYPEVLTHLSTMYEEVRGGYETADATVSIEKLAY 246 Query: 256 RLGLEDISDITPAAIAMEVLVQIENYLQGKN 286 +LG +D D+T +A EVL+++E + K Sbjct: 247 QLGYDDFGDVTTEDVAFEVLMEMEKLTRVKK 277 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45652 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57539 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60833 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19092 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63036 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9746 132 2e-33 >Contig9746 Length = 169 Score = 132 bits (333), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 69/142 (48%), Positives = 97/142 (68%) Query: 5 LTEEQLDEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQNGTI 64 LT+++ E KEAF LFD DG G I KEL MR+LG TE ++ MI +VD D +G I Sbjct: 21 LTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAI 80 Query: 65 DFPEVLNLMARKMKDTDSEEKLKEAFKGFDKDQNGFISAAELRHVMTNLGEKLTDEEVDE 124 DF E ++M K+ + D++E+L +AF+ D D+NG ISAA+++ + +LGE TD E+ E Sbjct: 81 DFDEFAHMMTAKIGERDTKEELMKAFQLIDLDRNGKISAADIKSIAKDLGENFTDSEIQE 140 Query: 125 MIREADVDGDGQVDYEEFVRMM 146 MI EAD D DG+V+ +EF+RMM Sbjct: 141 MIEEADRDRDGEVNADEFIRMM 162 Score = 60.1 bits (144), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 30/66 (45%), Positives = 45/66 (68%) Query: 84 EKLKEAFKGFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVDYEEFV 143 +++KEAF+ FD D +G I A EL M LG ++T+E++ +MI + D DG G +D++EF Sbjct: 27 QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAIDFDEFA 86 Query: 144 RMMLAK 149 MM AK Sbjct: 87 HMMTAK 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6626 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15327 197 1e-52 >Contig15327 Length = 186 Score = 197 bits (501), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 99/147 (67%), Positives = 120/147 (81%), Gaps = 1/147 (0%) Query: 1 MVRGKIQMRRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSSS 60 MVR K++M+RIEN TSRQVTFSKRR GLLKKAYELSVLCDAEVAVI+FSQKGR+YEFSSS Sbjct: 1 MVRKKVEMKRIENNTSRQVTFSKRRKGLLKKAYELSVLCDAEVAVIVFSQKGRIYEFSSS 60 Query: 61 NMQSAIERYREHAK-QVETNNPELEQYMQNLKQDAESMAKKIELLEVSQRKLLGQGLSSC 119 +MQ I RY +H TN E+EQY+Q+LK ++ +AKKIE+LE SQRKLLG L SC Sbjct: 61 DMQRTINRYHKHENGSGPTNKVEVEQYVQHLKHESAIIAKKIEILEASQRKLLGNDLDSC 120 Query: 120 SLDEILEIDSQLEKSLKSIRARKAQIF 146 ++E+ EI SQLE+SL+SI RKAQ++ Sbjct: 121 PVEELQEISSQLERSLRSISERKAQLY 147 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20094 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4779 70 2e-14 >Contig4779 Length = 606 Score = 70.1 bits (170), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 40/111 (36%), Positives = 64/111 (57%), Gaps = 4/111 (3%) Query: 45 GEQLGWGQFGVI-KACSDK--LAGEVLACKSIAKDRLVTQDDVRSVKLEIEIMTKLSGHP 101 GE++G G FG KA K L G+ A K I K ++ T + V+ E++I+ LSGH Sbjct: 155 GEEVGRGHFGYTCKATFKKGELKGQQAAVKVIPKAKMTTAIAIEDVRREVKILRALSGHD 214 Query: 102 NVVDLKAVYEEEDYVHLVMELCAGGELFHQ-LEKHGRFSXRGXRVLFKHLM 151 N+V YE+++ V++VMELC GGEL + L + G+++ R + ++ Sbjct: 215 NLVKFYDAYEDQENVYIVMELCEGGELLDRILARGGKYTEDDARTVMTQIL 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65963 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28469 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13709 (426 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23749 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25511 213 2e-57 >Contig25511 Length = 242 Score = 213 bits (543), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 113/240 (47%), Positives = 145/240 (60%), Gaps = 5/240 (2%) Query: 1 MRPEIYLFGDSITEASFCDGGWGASLAHHFSRTVDVVLRGYSGYNTRWALEVIEKVFPVV 60 MRPEI LFGDSITE SF GGWGA+LA +SR DV +RGY GYNTRWAL +++ +FP+ Sbjct: 1 MRPEIVLFGDSITEQSFQSGGWGAALADSYSRKADVKVRGYGGYNTRWALFLLQNLFPLD 60 Query: 61 SRGGGAPLAVTVFFGANDACLPDRCSAFQHVPIHEYKQNLHSIVSFLKKRWXXXXXXXXX 120 S P A T+FFGANDA + R S QHVP+ EYK+NL V LK+ Sbjct: 61 S--DKPPAAATIFFGANDAAILGRTSERQHVPLEEYKENLRKFVLHLKECSPTILIVLIT 118 Query: 121 XXXXDEEGR---LRNPYVENPMGLPERTNEAAGAYAKACVDVAGECGGPVVDIWTKMQHI 177 DE+GR R+ Y ++ LPERTNE G YAK C+++A E G +++W+ +Q Sbjct: 119 PPPVDEDGRNEYARSLYGKDARELPERTNEVTGVYAKKCIELAEEMGLRSINLWSTLQET 178 Query: 178 SDWPRICLSDGLHLTQSGNKIVFEEVVARLREEGISLETLLVDLPHIAEIDPNDPLKSFS 237 W + LSDGLHLT GN +V +EVV E S + D PH +EID +P K+F Sbjct: 179 EGWQKKFLSDGLHLTPEGNAVVHQEVVKVFTEAWFSATEMPHDFPHHSEIDGKNPEKAFQ 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12866259 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1132 419 e-119 >Contig1132 Length = 265 Score = 419 bits (1077), Expect = e-119, Method: Compositional matrix adjust. Identities = 213/270 (78%), Positives = 229/270 (84%), Gaps = 11/270 (4%) Query: 1 MAASIMALSSPSFAGTTVKLGPNASDI------LGGGRVSMRKTGFKAPSGSPWYGPDRV 54 MA S A+ +FAG T +S++ LGGGR SMR+T AP S WYGPDR Sbjct: 1 MATS--AIQQSAFAGQTAL--KQSSELVRKIGGLGGGRFSMRRTVKSAPQ-SIWYGPDRP 55 Query: 55 LYLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFP 114 YLGP S PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFP Sbjct: 56 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFP 115 Query: 115 ELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYR 174 E+LSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG +EGYR Sbjct: 116 EILSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYR 175 Query: 175 IAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTG 234 + GGPLGE DPLYPGG+FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTG Sbjct: 176 VGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTG 235 Query: 235 KGPLENLADHLADPVNNNAWAYATNFVPGK 264 KGP+ENL DH+ADPV NNAWAYATNFVPGK Sbjct: 236 KGPVENLFDHIADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56279 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9192 247 1e-67 >Contig9192 Length = 243 Score = 247 bits (630), Expect = 1e-67, Method: Compositional matrix adjust. Identities = 140/241 (58%), Positives = 159/241 (65%), Gaps = 3/241 (1%) Query: 1 MQRDQQFCPEKVMLPLANEVGNDYMYNTPVESAFGAVFPPGAKDLGPFHGVEFQPSDVCP 60 MQ DQQF P K P +N+VGN+YM+ PV S GAV P A PFHGVEFQ S +CP Sbjct: 1 MQSDQQFDPNKAAPPFSNQVGNNYMH-IPVASGCGAVLPNDANHFRPFHGVEFQTSSICP 59 Query: 61 KNFIIFDQTDHRSQIMFHPAIAQKFNCPSLNLCATYIHNNLEKREINIDEGEASSALKED 120 KNFIIFDQTDHRSQIMF+P I+ K P+ NLCA YI +NL + NID EASS LKED Sbjct: 60 KNFIIFDQTDHRSQIMFNPEISHKITGPAFNLCAAYIQDNLGLNKGNIDNREASSTLKED 119 Query: 121 SEDIDALLSLXXXXXXXXXXXXVSTARTHGNYGSNCEDTCSSYGXXXXXXX--XXXXXXX 178 S+DIDALLSL VSTART GNYGS+ D+CSSYG Sbjct: 120 SDDIDALLSLEEEELEDYDEEEVSTARTRGNYGSSFSDSCSSYGLKTKKERLCSSLEKST 179 Query: 179 XXXXXXXXXXXXXRQKMKKMVKALRGIVPGSSQMNTVAVLDEAVRYLKSLKVEVQKLGVS 238 RQKMKKMV+ LRGIVPG+++MNTVAVLDEAV+YLKSLKVE+QKLGV Sbjct: 180 AIGSSSSCNSERKRQKMKKMVRTLRGIVPGANEMNTVAVLDEAVQYLKSLKVELQKLGVE 239 Query: 239 N 239 N Sbjct: 240 N 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39660 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6966261 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10510 107 3e-25 >Contig10510 Length = 330 Score = 107 bits (266), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 49/82 (59%), Positives = 60/82 (73%), Gaps = 6/82 (7%) Query: 53 QKRVVSVPIKDVEGSRVKGDCAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPARK 112 QKR+V VP ++ + + P D ++WRKYGQKPIKGSP+PRGYY+CSS +GCPARK Sbjct: 240 QKRIVRVPAISLKLADI------PPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARK 293 Query: 113 QVERSRVDPTMLVVTYSCEHNH 134 VER+ D MLVVTY EHNH Sbjct: 294 HVERALDDAAMLVVTYEGEHNH 315 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15977 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9834 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1732 (222 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv166265 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2242 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1727 (325 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21228 (503 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13809 275 9e-76 >Contig13809 Length = 180 Score = 275 bits (704), Expect = 9e-76, Method: Compositional matrix adjust. Identities = 133/178 (74%), Positives = 152/178 (85%) Query: 325 VESLQQQIKAREKQLLPVYTQIATRFAELHDTSLRMAAKGVIKEVVDWGNSRSFFYRRLH 384 VE+LQ QI++REKQLLPVYTQIATRFAELHDTSLRMAAKGVI+EV+DW +SRSFFY+RL Sbjct: 2 VETLQHQIRSREKQLLPVYTQIATRFAELHDTSLRMAAKGVIREVLDWNSSRSFFYKRLR 61 Query: 385 RRVIEGSLIKVVRDAAGDQMSHKCAMDLIKKWFLDSEIASGSKDAWADDQAFFTWKNDPA 444 RR+ E SLIK VRDAAG+Q+SHK A DLIK WFL S+I +DAW DD+ FF WK +P Sbjct: 62 RRISEESLIKTVRDAAGEQLSHKSASDLIKNWFLSSDIPGCREDAWVDDEIFFRWKENPK 121 Query: 445 NYEEKLQELRAQKVLLHLSKIGDSASDLQSLPQGLAALLQKVEPSSRAQLIGELRKVL 502 NYE+KL+ELR QKVLL L+ IGDS SDLQ+LPQGLAALL KVEPSSRA LI ELR+VL Sbjct: 122 NYEDKLKELRVQKVLLQLANIGDSVSDLQALPQGLAALLSKVEPSSRALLIDELRRVL 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45541 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65214 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9034 71 9e-15 >Contig9034 Length = 386 Score = 71.2 bits (173), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 43/101 (42%), Positives = 52/101 (51%), Gaps = 10/101 (9%) Query: 28 AFALNNSIIPPIKRQTTPTSS------ALEPARTIAKKHYRGVRRRPWGKYAAEIRDSAK 81 AF+ N P R +T S A + A+ K YRG+R+RPWGK+AAEIRD K Sbjct: 78 AFSAGN---PSFARGSTAVKSVEFDGQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRK 134 Query: 82 HGARTWLGTFETXXXXXXXXXXXXFRMRGSKALLNFPVIAP 122 G R WLGTF T R+RG KA +NFP P Sbjct: 135 -GVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEETP 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv583 (42 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1104 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43494 (505 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41034 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14063 86 5e-19 >Contig14063 Length = 580 Score = 85.5 bits (210), Expect = 5e-19, Method: Composition-based stats. Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 3/128 (2%) Query: 50 KTPFITFVVGGPGSGKGTQCAKIVETFGFTHISAGELLRREISCNSEHGSMILDSIREGK 109 K P + G P SGKGTQC IV FG HIS G+LLR E+S +E G+ + + G+ Sbjct: 72 KEPLKVMISGAPASGKGTQCELIVNKFGLVHISTGDLLRAEVSSGTEIGNKAKEFMNAGR 131 Query: 110 IVPSEVTVKLIEKEM--ESSKNNKFLIDGFPRTEENRIAFERVIGAEPXFVLFFHCPEEE 167 +VP EV ++ + + +K +L+DG+PR+ + ++ + P + P+E Sbjct: 132 LVPDEVVTAMVTARLSRDDAKEKGWLLDGYPRSFNQAQSLQK-LKIIPDVYIVLDVPDET 190 Query: 168 MVKRLLSR 175 ++ R + R Sbjct: 191 LIDRCVGR 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38447 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43152 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16110 (298 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8310 (142 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4384 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3268 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9954 144 2e-36 >Contig9954 Length = 252 Score = 144 bits (362), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 108/266 (40%), Positives = 124/266 (46%), Gaps = 35/266 (13%) Query: 1 MAPKEKVAG----VKPSANAKEVHFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTXXXX 56 MAP+EK A + + N KEVHFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDT Sbjct: 1 MAPREKTATAAVRMNGNGNVKEVHFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTAEEA 60 Query: 57 XXXXXXXXXXFRGAKAKTNFPLVXXXXXXXXXXXXXXXXXXXXXXXXXX----------- 105 FRGAKAKTNFP Sbjct: 61 ARAYDAAAIEFRGAKAKTNFPQPSENVSLNVTKNNNNKISSGSNNQSPSQSSTVESSSRE 120 Query: 106 -PALMVDSSPLDLNLLHXXXXXXXXXXXXXYATA-LRFPFQHHQFQVSSPSPAAGI-VPT 162 PALMVDSSPLDLNL H +++A +RFPFQHHQ P A I VP+ Sbjct: 121 PPALMVDSSPLDLNLAH-------GVSSGGFSSAPMRFPFQHHQV----PGFGAVIGVPS 169 Query: 163 GGLPAANHLFYFDAMLRTGRV-NQDF--QXXXXXXXXXXXXXXXTGGXXXXXXXXXXXXL 219 AA + Y D++ R G + N F + GG L Sbjct: 170 SAAAAAKQVLYLDSVFRAGAMKNHQFHPRMRFDHPNFHQPDFHAAGGAQSDSDSSSVVDL 229 Query: 220 NHNDLKPRARVLIDLDLNRPPPPEIA 245 N NDL PR DL+L PPPP++A Sbjct: 230 NQNDL-PRGGGGFDLNL--PPPPDLA 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11666263 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5128 (356 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27164 (381 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48577 (514 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22793 649 0.0 >Contig22793 Length = 406 Score = 649 bits (1673), Expect = 0.0, Method: Compositional matrix adjust. Identities = 297/406 (73%), Positives = 351/406 (86%), Gaps = 1/406 (0%) Query: 110 GSSNLWVPSSKCYFSVPCYFHSKYKSSQSSTYRKNGKSADIHYGTGAISGFFSEDNVKVG 169 GSSNLWVPSSKCY S+ C+FH+KY S QS TY+ NG SA I YG+GAISGFFS DNVKVG Sbjct: 1 GSSNLWVPSSKCYVSLACFFHAKYNSGQSRTYKNNGTSASIQYGSGAISGFFSNDNVKVG 60 Query: 170 DLVVKNQEFIEATREPSVTFLVAKFDGILGLGFQEISVGNAVPVWYNMVKQGLVKEPVFS 229 D+VVKNQ+FIEAT EP +TF+ AKFDG+LGLGFQEISVG +VPVWYNMV++GL+KEPVFS Sbjct: 61 DIVVKNQDFIEATSEPGLTFVTAKFDGLLGLGFQEISVGGSVPVWYNMVERGLIKEPVFS 120 Query: 230 FWLNRKTDDDEGGELVFGGVDPDHFKGEHTYVPVTQKGYWQFDMGEVLIDGETTGYCAGG 289 FWLNR D+ GGE+VFGGVDP HFKG+HTYVPVT+KGYWQF+MG+VLI G+ TG+CAGG Sbjct: 121 FWLNRNAQDEAGGEIVFGGVDPKHFKGKHTYVPVTRKGYWQFNMGDVLIGGKPTGFCAGG 180 Query: 290 CAAIADSGTSLLAGPTAVVAMINHAIGATGVVSQECKTVVAQYGETIMDLLLS-EASPQK 348 C AIADSGTSLL GP+ + IN AIGA+GVVSQECK VV QYG TI+DLL++ E P+K Sbjct: 181 CFAIADSGTSLLTGPSTSITKINQAIGASGVVSQECKAVVNQYGRTILDLLVAHEVQPKK 240 Query: 349 ICSQIGLCTFDGTRGVGMGIESVVDEKNGDKSSGVHDAGCSACEMAVVWMQSQLRQNQTK 408 +CSQIG+CTFDGTR V MGIESVVDEKNG S +HDA CSACEMAVVWMQ++L++N T+ Sbjct: 241 VCSQIGVCTFDGTRSVSMGIESVVDEKNGKSSGILHDASCSACEMAVVWMQNELKKNITQ 300 Query: 409 ERILEYVNELCDRLPSPMGESAVDCLQLSSMPNVSLTIGGKVFDLSANEYVLKVGEGAAA 468 +RIL YVNELC+++P +G+S VDC +LSSMP VS TIGG+ F L+++EY+LKVGEGA A Sbjct: 301 DRILNYVNELCEKMPDTLGQSTVDCGKLSSMPPVSFTIGGRAFKLTSDEYILKVGEGAQA 360 Query: 469 QCISGFIAMDVPPPRGPLWILGDVFMGRYHTVFDYGNMRVGFAEAA 514 QCISGF ++D+P PRGPLWILGD+FMGRYHTVFDYG MRVGFA+AA Sbjct: 361 QCISGFTSLDIPRPRGPLWILGDIFMGRYHTVFDYGKMRVGFADAA 406 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10975 (393 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14799 224 2e-60 >Contig14799 Length = 428 Score = 224 bits (571), Expect = 2e-60, Method: Compositional matrix adjust. Identities = 123/318 (38%), Positives = 188/318 (59%), Gaps = 14/318 (4%) Query: 84 NIELSDQEAR-----SEAAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWXXXXXXX 138 IE++D + SE L G +F W+ LNV+FNI NKKV N FPYP+ Sbjct: 100 EIEIADGYGKPTKSFSEKFPFLITGFFFFMWYLLNVIFNILNKKVYNYFPYPYFVSVIHL 159 Query: 139 XXXXXXXXISWAVRIAEPPKTDLDFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKS 198 +SW+V + + D + L PVA H +GHV + VS + VAVSFTH IK+ Sbjct: 160 LVGVVYCLVSWSVGLPKRAPIDKEQLALLTPVAFCHALGHVMSNVSFAAVAVSFTHTIKA 219 Query: 199 GEPAFSVLVSRFLLGETFPVPVYFSLLPIIGGCALAAVTELNFNMTGFMGAMISNLAFVF 258 EP F+ S+F+LG P+ ++ SL P++ G ++A++TEL+FN GF AMISN+AF + Sbjct: 220 LEPFFNASASQFVLGHHIPLSLWLSLAPVVIGVSMASLTELSFNWLGFGSAMISNIAFTY 279 Query: 259 RNIFSKRGMKGKSVGGMNYYACLSMLSLLILTPFAIAVEGPQMWAAGWQKAISQIG---- 314 R+I+SK+ M G + N YA +S+++LL+ P AI +EGPQ+ G++ AI+++G Sbjct: 280 RSIYSKKAMTG--MDSTNVYAYISIIALLVCIPPAILIEGPQLMQYGFKDAIAKVGLYKF 337 Query: 315 PNFIWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRXXXXXXXXXXFHTPVQPVN 374 + ++W+ +FYHLYNQ++ +L++++PLT ++GN +KR F + Sbjct: 338 VSDLFWIG---MFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSIVVFGNKISTQT 394 Query: 375 ALGAAIAILGTFLYSQAK 392 +G AIAI G +YS K Sbjct: 395 GIGTAIAIAGVAIYSLIK 412 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59138 (341 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56886 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40797 (71 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8263 (460 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19366261 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6466264 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8447 188 7e-50 >Contig8447 Length = 236 Score = 188 bits (478), Expect = 7e-50, Method: Compositional matrix adjust. Identities = 105/233 (45%), Positives = 139/233 (59%), Gaps = 8/233 (3%) Query: 1 MLAIFHKAFAHPPEELNSPASRDGSRKPKLPEETL-REFLSAHPANTFSMSFGTAAALAY 59 ML +F A PPEEL + SR S PK+ +L F+ + A S+ G A LAY Sbjct: 1 MLGVFSSAIVSPPEELVAAGSRTPS--PKITATSLVNRFVQTNDA-AVSVQVGDDAQLAY 57 Query: 60 VSPDRSYPTHQRLFGGFDDIYCLFMGSLNNLCILNRQYGLSKGSNEAMLVIEAYRTLRDR 119 + S R F D+I+CLF G+L+NL L +QYGL+K +NE +LVIEAY+ LRDR Sbjct: 58 SHSNES-ALQPRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDR 116 Query: 120 GPYPADQVVKDLEGSFAFVVYDSKAGTVFTALGSDGGVKLFWGVAADGSVVISDDLGVIK 179 PYP + VV L G+FAF+V+D TVF A G + L WG+ ADG V +DD ++K Sbjct: 117 APYPPNHVVGHLSGNFAFIVFDKSTSTVFVASDQFGKIPLSWGITADGYVAFADDAELLK 176 Query: 180 AGCAKSFAPFPTGCMFHSD-GGLMSFEHPMNKMKAMPRIDSEGVMCGANFKVD 231 C KS A FP GC + + GGL S+E+P NK+ A+P D E + GA FKV+ Sbjct: 177 GACGKSLASFPQGCFYSTSVGGLRSYENPKNKITAVPATDEE--IWGATFKVE 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3122 (506 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10162 615 e-178 >Contig10162 Length = 552 Score = 615 bits (1586), Expect = e-178, Method: Compositional matrix adjust. Identities = 310/511 (60%), Positives = 379/511 (74%), Gaps = 37/511 (7%) Query: 30 TTSRWIVDEDGARVKLACVNWPSHREAPVAEGLSNHPVDLISKRIASLGFNCVRLALPLF 89 T+SRWIVDE G RVKLACVNW SH +A VAEGLS PVD I+KRIASLGFNCVRL PL Sbjct: 31 TSSRWIVDESGQRVKLACVNWVSHLDAVVAEGLSKQPVDAIAKRIASLGFNCVRLTWPLL 90 Query: 90 LATDQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLADNNMMVIL 149 LAT+++LA++TVRQSFQ LGLLES++G Q+NNP+++DLPL AYQAVVS+L NN+MVIL Sbjct: 91 LATNETLAAVTVRQSFQSLGLLESISGIQSNNPALVDLPLLKAYQAVVSSLGSNNVMVIL 150 Query: 150 DNHFSKPGF-----HGNDIFSDQYFNPDLWVKGLTRMATVFSGVPNVVGMSLRNELRCPK 204 DNH S PG+ N F D+YFNPDLW+ GLTRMAT+F GV NVVGMSLRNELR PK Sbjct: 151 DNHLSTPGWCCNNNDDNGFFGDKYFNPDLWITGLTRMATLFKGVSNVVGMSLRNELRGPK 210 Query: 205 QNVKDWYRYMQKGAEAVHSANPDVLVIISGLSDGTDLSFLLNQQLELTFTGKLVLEMHWH 264 QNV DWY+YMQ+GAEAVHSAN DVLVI+SGLS TDLSFL + + LTF GK V E+HW+ Sbjct: 211 QNVDDWYKYMQRGAEAVHSANADVLVILSGLSFDTDLSFLAKRPVSLTFAGKTVFEVHWY 270 Query: 265 GSRAGET---SNPNKVCGRVVDSIMRRGGVLLQQGWPLMFVSELGVD-------DNRNLN 314 G G+ NPN+VCG+V +++ R+ G LL G PL FVSE GVD DNR LN Sbjct: 271 GFSDGQAWKNGNPNQVCGQVYNNVKRKSGFLLDNGLPL-FVSEFGVDHRGTNVNDNRYLN 329 Query: 315 CFFGLAAELDFDWALWTV-------------EETNGLMNW------NSSVFQRISALQSP 355 CF AAE D D+ALWT+ EE G++NW NSS+ QR+S LQSP Sbjct: 330 CFMAAAAEFDVDFALWTLVGSYYLRQGVVGMEEYYGILNWDWSDIRNSSLTQRLSVLQSP 389 Query: 356 LQGPDVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFC 415 LQGP +++ R HKII HP TGLC+L + PLKLGPC++S AW Y+ +K+L +KG+YFC Sbjct: 390 LQGPGLAQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCSQSGAWAYSSRKVLTLKGTYFC 449 Query: 416 LQAVELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGDSTTVCLDVDSSSTIVTDACKC 475 +QA +L KPA + I+CT S WDIISDSK++L +K D T VCLDVDSS+T+VT++C C Sbjct: 450 IQADKLNKPAAVGILCTTRNSQWDIISDSKLHLQSKTMDGTEVCLDVDSSNTVVTNSCNC 509 Query: 476 LGRDDTCDPGSQWFKVVDSTNIS--RRPILQ 504 L RD +CDPG+QWFK+VDST S + P+L+ Sbjct: 510 LSRDSSCDPGNQWFKLVDSTINSSPKSPMLE 540 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65797 (399 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29010 91 3e-20 >Contig29010 Length = 295 Score = 90.9 bits (224), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 54/124 (43%), Positives = 70/124 (56%), Gaps = 24/124 (19%) Query: 300 KSLSDLEYEEVQGFKDLGFTFEKEDLSPSVVNILPGLQ------------VKDRGGPME- 346 +SL +LE EEV+GF DLGFTF+KE LSP +++++PGLQ D +E Sbjct: 172 RSLGELELEEVKGFIDLGFTFKKEHLSPRMMSLVPGLQRLGVSNSKKLRNKNDDSAEIEV 231 Query: 347 ---------EDSVRRPYLSEAWIEQCSAPPIPNWV--GKSSAQDMKAQIKFWARAVASNV 395 E V RPYLSEAW+ + P+ N S+A DMK +KFWAR VAS + Sbjct: 232 PKEDKDDEKEGEVMRPYLSEAWLIKRPDSPLLNLRLPRVSAAADMKKHLKFWARTVASEI 291 Query: 396 HQEC 399 HQE Sbjct: 292 HQES 295 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22966261 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11638 73 9e-16 >Contig11638 Length = 66 Score = 73.2 bits (178), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 35/62 (56%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Query: 30 CGNCDCADKSQ--KKGNAYGIDIVETEKSYVATVVMEVPAAQHEGSCKCGDSCACIDCTC 87 C NCDCAD +Q KKGN+Y + IVETE + TV ++ PAA+H+G CKCG C+C+ CTC Sbjct: 5 CDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFVDAPAAEHDGKCKCGTGCSCVSCTC 64 Query: 88 GQ 89 G Sbjct: 65 GH 66 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49553 (139 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8189 150 9e-39 >Contig8189 Length = 136 Score = 150 bits (379), Expect = 9e-39, Method: Compositional matrix adjust. Identities = 68/137 (49%), Positives = 94/137 (68%), Gaps = 2/137 (1%) Query: 1 MDRVEASKIAMTTWAKWVDENIDPSKPRVFFQGVSAVHVIGADWDEPGAKQCIGQTPPVN 60 MDR+ A ++TWA+WVD N+D S+ +VFFQG+S H G +W+ P K C G+ P++ Sbjct: 1 MDRLTAYYKGLSTWARWVDSNVDTSRTKVFFQGISPTHYQGKEWNSP-KKTCSGELGPLS 59 Query: 61 GSAYPGGTLPAEDVLRSIISRMKNPPFLMAIPLLTQLRKDGHSSVYAGQGKALVDCSHWC 120 GS YP G P+ V+ ++S +KNP +L+ I L+QLRKD H S Y+G DCSHWC Sbjct: 60 GSTYPAGAPPSVAVVYKVLSTIKNPVYLLDITTLSQLRKDAHPSTYSGDHSG-NDCSHWC 118 Query: 121 LAGVPDSWNELLYAALL 137 L G+PD+WN+LLYAAL+ Sbjct: 119 LPGLPDTWNQLLYAALI 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33541 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8189 176 4e-46 >Contig8189 Length = 136 Score = 176 bits (446), Expect = 4e-46, Method: Compositional matrix adjust. Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 2/138 (1%) Query: 114 MNRLVAFKEGLTTWSKWVESNINPAVTRVFFQGISPTHYNGDEWKQSGSTTCNGQTQPLS 173 M+RL A+ +GL+TW++WV+SN++ + T+VFFQGISPTHY G EW S TC+G+ PLS Sbjct: 1 MDRLTAYYKGLSTWARWVDSNVDTSRTKVFFQGISPTHYQGKEW-NSPKKTCSGELGPLS 59 Query: 174 GSMYPGGMPSEAKILKEVLSKMSKPVQLLDITTLSQLRKDGHPSYYGNNGRKEDDCSHWC 233 GS YP G P ++ +VLS + PV LLDITTLSQLRKD HPS Y + +DCSHWC Sbjct: 60 GSTYPAGAPPSVAVVYKVLSTIKNPVYLLDITTLSQLRKDAHPSTYSGD-HSGNDCSHWC 118 Query: 234 LAGVPDTWNELLYASLIM 251 L G+PDTWN+LLYA+LIM Sbjct: 119 LPGLPDTWNQLLYAALIM 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34883 (63 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24125 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11572 (233 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13560 298 4e-83 >Contig13560 Length = 238 Score = 298 bits (764), Expect = 4e-83, Method: Compositional matrix adjust. Identities = 141/179 (78%), Positives = 157/179 (87%) Query: 53 RGLKIQSAATKPAKSPAEEDWKIKREVLLEKKVRSVDAKEALRLQQENNFVILDVRPEAE 112 +GL+I+SAATK AK+PAEEDWK KRE+LL+KKVRSVD KEALRLQ+ENNFVILDVRPEAE Sbjct: 54 QGLRIRSAATKQAKTPAEEDWKTKRELLLQKKVRSVDVKEALRLQKENNFVILDVRPEAE 113 Query: 113 FKEAHPPGAINVQIYRLIKEWTAWDXXXXXXXXXXXXXXXTEENPEFMQSVESKIDKSAK 172 FKEAHPPGAINVQIYRLIKEWTAWD TEENP+F+ SV S++DK AK Sbjct: 114 FKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFAGTEENPDFISSVGSQLDKKAK 173 Query: 173 IIVACSSGGTMKPSQNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLYTWFKEGLPSVS 231 IIVAC++GGTM+P+QNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLY WFKEGLPSV+ Sbjct: 174 IIVACAAGGTMRPTQNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLYAWFKEGLPSVA 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13534 (67 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2167 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39992 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24718 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37428 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34509 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52603 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49015 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51469 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2565 157 1e-40 >Contig2565 Length = 144 Score = 157 bits (397), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 85/147 (57%), Positives = 115/147 (78%), Gaps = 4/147 (2%) Query: 1 MKKYGLQLRVPPSQQKKQPTRXXXXXXXGFCDENEDD-IEREISRQASKNKTLKDIEEQH 59 M KYGL LR QQKKQPTR GF D+++D+ +E+EISRQASKNK+LKDIEEQ Sbjct: 1 MIKYGLNLR---GQQKKQPTRPPVPKPLGFGDDDDDNDVEKEISRQASKNKSLKDIEEQQ 57 Query: 60 KKALEEDPTAFDYDDVYEEMKEKTIRPLAQDRQERKPKYIQKLIEKAKQREREHEIIYEK 119 +KALE+DP+ FDYD VY++MK+K I+P QDRQER +YI + KA++R+RE EIIY++ Sbjct: 58 RKALEQDPSVFDYDGVYDQMKQKAIQPRVQDRQERMARYIPGIQRKAEERKREQEIIYKR 117 Query: 120 KLVKERSKDDALYADKDKFITGAYKKK 146 KL KER+++D L+A+K++F+ AY+KK Sbjct: 118 KLTKERNQEDHLHANKERFVHSAYQKK 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14666265 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31944 140 7e-36 >Contig31944 Length = 143 Score = 140 bits (353), Expect = 7e-36, Method: Compositional matrix adjust. Identities = 75/116 (64%), Positives = 82/116 (70%), Gaps = 7/116 (6%) Query: 1 MATTMAAASRVIGLGXXXXXXXXXXXXKRTHLASGFVKAPVAPRNPLRQAKACGGKFTCF 60 MA +MA AS VIGLG RT L SGFVK P+ NPLRQ +A GG+FTCF Sbjct: 1 MAVSMATASTVIGLGSSSLSP------NRTCLTSGFVK-PIVVGNPLRQVRASGGRFTCF 53 Query: 61 ERDWLRTDLNVIGFGLIAWLAPSSIPAIDGNSLTGLFFSSIETELSHLPTGPALPS 116 +RDWLR DLNVIGFGLI WLAPSSIP IDG SLTGLFF SI EL+H P+ PAL S Sbjct: 54 QRDWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTS 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60386 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26728 144 8e-37 >Contig26728 Length = 96 Score = 144 bits (364), Expect = 8e-37, Method: Compositional matrix adjust. Identities = 81/96 (84%), Positives = 82/96 (85%) Query: 111 MDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPE 170 MDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPE Sbjct: 1 MDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPE 60 Query: 171 RTVDDTWMQELNIXXXXXXXXXXXXXDLDRNSLAYI 206 R +DDTWMQELNI DLDRNSLAYI Sbjct: 61 RVIDDTWMQELNIQRPPTPTRGRPQPDLDRNSLAYI 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26266262 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3113 (393 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65380 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51169 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47835 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14001 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24436 278 4e-77 >Contig24436 Length = 152 Score = 278 bits (710), Expect = 4e-77, Method: Compositional matrix adjust. Identities = 136/152 (89%), Positives = 137/152 (90%) Query: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 Query: 61 AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 AAEL+ LM IVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH Sbjct: 61 AAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 Query: 121 RGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 152 RGLRHYWGLRVRGQH SKKR Sbjct: 121 RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4698 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19280 222 3e-60 >Contig19280 Length = 169 Score = 222 bits (565), Expect = 3e-60, Method: Compositional matrix adjust. Identities = 111/172 (64%), Positives = 123/172 (71%), Gaps = 3/172 (1%) Query: 1 MDHDETGCQAHPEGPILCINNCGFFGSPATMNMCSKCHKDMMLKQEQAKLAAXXXXXXXX 60 M+H+ETGCQ+ PEGPILC+NNCGFFGS ATMNMCSKCHKDM+LKQEQ KLAA Sbjct: 1 MEHEETGCQSAPEGPILCVNNCGFFGSAATMNMCSKCHKDMVLKQEQTKLAASSFGSIVN 60 Query: 61 XXXXXXXKEPAIASTVDVQVDAKEPKIISVQXXXXXXXXXXXXAKPKEGPNRCSTCKKRV 120 EP ++VDVQ EPK +S Q KP EGP RC+TC KRV Sbjct: 61 RTSSINANEPV--ASVDVQPHPMEPKTLSSQPSFSFGSGSSGEPKP-EGPKRCNTCNKRV 117 Query: 121 GLTGFNCRCGHLFCATHRYSDKHDCPFDYRTAARDAIAKANPVVKAEKLDKI 172 GLTGFNCRCGHLFCA HRYSDKHDC +DY TA +DAIAKANPVVKA+KL KI Sbjct: 118 GLTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANPVVKADKLGKI 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40297 (223 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16198 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32983 171 1e-44 >Contig32983 Length = 136 Score = 171 bits (432), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 79/134 (58%), Positives = 108/134 (80%), Gaps = 2/134 (1%) Query: 4 ALSVVGSSIFDPKTCPCLCLDALPSSNMSVKAGGGDLVWQRNSVGKKRLSRPGTVEMGSS 63 ALS+VGSS+ D T PCLCLDALP++ M++K+GG ++V QRNS+ KK + +PG++E+GSS Sbjct: 5 ALSLVGSSVVDSHTSPCLCLDALPTTAMNLKSGG-EMVLQRNSMAKKHVVKPGSLELGSS 63 Query: 64 FVESWHEWRLEAKVLSSIVNKSSRRQHKARRLLVVSEVAGQYEDSFEDVKTQIVNYFTYK 123 F++ H+ R K L N+S+R++ K R ++V+E+ GQYEDSFEDVKTQ++NYFTYK Sbjct: 64 FIDFGHDRRFSMKSLPVTGNRSTRKR-KNRGFVIVNELGGQYEDSFEDVKTQLLNYFTYK 122 Query: 124 AVRTVMHQLYEMNP 137 AVRTVM+QLYEMNP Sbjct: 123 AVRTVMNQLYEMNP 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41286 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23013 211 5e-57 >Contig23013 Length = 203 Score = 211 bits (538), Expect = 5e-57, Method: Compositional matrix adjust. Identities = 95/174 (54%), Positives = 124/174 (71%), Gaps = 1/174 (0%) Query: 4 VPHVPKINGEIPSLDEATXXXXXXXXXXXXXXXVELKVQGDGNCQFRSLSDQVYCTPEHH 63 +PH P++NGEIP +++AT EL+++GDGNCQFR+L+DQ++ PE+H Sbjct: 31 IPHTPRVNGEIPDVNDATQDHERLSARLATYDLSELQIEGDGNCQFRALADQLFRNPEYH 90 Query: 64 QFIRQQVVNQLKSYPEIYEGYVPMAYGDYLEKMSKTGEWGDHVTLQAAADLYGVKIFVIT 123 + +R+QV+ QLK + ++YE YVPM Y YL KM KTGEWGDH+TLQAAAD +G KI +IT Sbjct: 91 KHVRKQVIKQLKHHKKLYEAYVPMKYSRYLMKMEKTGEWGDHLTLQAAADRFGAKICLIT 150 Query: 124 SFKDTCYIEILPNVQRSERVMLLSFWAEVHYNSIYFKGDVPEFETKKKKRWWSF 177 SF+DTCYIEILP R + LSFW+EVHYNS+Y DVP T +KK W SF Sbjct: 151 SFRDTCYIEILPKDGNHARELWLSFWSEVHYNSLYASADVPS-RTPRKKHWLSF 203 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21434 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566261 (365 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 677 0.0 >Contig27182 Length = 447 Score = 677 bits (1748), Expect = 0.0, Method: Compositional matrix adjust. Identities = 326/337 (96%), Positives = 333/337 (98%) Query: 1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD 240 VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD Sbjct: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEASNFTSXVIIMNH 337 KNVAVKDLKRGFVASNSKDDPAKEA+NFTS VIIMNH Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNH 337 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566257 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 342 3e-96 >Contig27182 Length = 447 Score = 342 bits (876), Expect = 3e-96, Method: Compositional matrix adjust. Identities = 165/173 (95%), Positives = 169/173 (97%) Query: 1 MCVPFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAK 60 M V FGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAK Sbjct: 264 MVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAK 323 Query: 61 EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLK 120 EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLK Sbjct: 324 EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLK 383 Query: 121 NGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG 173 NGDAG VKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK+P+G Sbjct: 384 NGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59489 (375 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24129 686 0.0 >Contig24129 Length = 370 Score = 686 bits (1769), Expect = 0.0, Method: Compositional matrix adjust. Identities = 323/362 (89%), Positives = 342/362 (94%) Query: 14 SDFPAVPTHGGLFFQHNIFGNLFEITAKYRPPIMPIGRGAYGIVCSVLNSETNEMVAIKK 73 DFPAVP+HGG + Q+NIFGNLFEIT KYRPPIMPIGRGAYGIVCSVLNSET EMVAIKK Sbjct: 9 GDFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSETKEMVAIKK 68 Query: 74 IANAFDNHMDAKRTLREIKLLRHLDHENVIGIRDVVPPPLRREFSDVYIATELMDTDLHQ 133 IANAFDNHMDAKRTLREIKLLRHLDHENVI IRDV+PPPLRREFSDVYIATELMDTDLHQ Sbjct: 69 IANAFDNHMDAKRTLREIKLLRHLDHENVIAIRDVIPPPLRREFSDVYIATELMDTDLHQ 128 Query: 134 IIRSNQGLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARP 193 IIRSNQGLSEEHCQYF+YQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARP Sbjct: 129 IIRSNQGLSEEHCQYFMYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARP 188 Query: 194 TAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPLFAGKDHVHQM 253 TAENE +TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR+PLF GKDHVHQM Sbjct: 189 TAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFPGKDHVHQM 248 Query: 254 RLLTELLGTPTESDLGFVRNDDARRYIMQLPQHPRQPLVNVFPHIHPLAIDLIDRMLTFD 313 RLLTELLGTPTESDLGFVRN+DARRYI QL QHPRQPL +FPH++P+AIDL+DRMLTFD Sbjct: 249 RLLTELLGTPTESDLGFVRNEDARRYIRQLAQHPRQPLERLFPHVNPMAIDLVDRMLTFD 308 Query: 314 PTKRITVEEALAHPYLSRLHDTADEPVCPEPFSFEFEQQALVEEQMKDMIYQEALFFNPG 373 PT+RITVE+ALAHPYL RLHD ADEP+C EPFSF+FEQQ L EEQMKDMIY+EA+ NP Sbjct: 309 PTRRITVEQALAHPYLERLHDVADEPICTEPFSFDFEQQPLGEEQMKDMIYREAIALNPE 368 Query: 374 YA 375 YA Sbjct: 369 YA 370 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25720 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14225 211 7e-57 >Contig14225 Length = 170 Score = 211 bits (536), Expect = 7e-57, Method: Compositional matrix adjust. Identities = 100/168 (59%), Positives = 123/168 (73%) Query: 1 MASASTNQASXXXXXXXXXXCKNPVDGFSAGLVDESNIFEWSVTIIGPPDTLYDGGFFNA 60 MA+A ++QAS CK+PVDGFSAGLV+E NIFEW+VTIIGPPDTLY+GGFFNA Sbjct: 1 MATAPSSQASLLLQKQLKDLCKHPVDGFSAGLVNEDNIFEWNVTIIGPPDTLYEGGFFNA 60 Query: 61 IMSFPPNYPNSPPTVKFTSEVWHPNVYPDGRVCISILHPPGEDPNGYELASERWMPIHTV 120 IMSFP +YP +PP V+FTSE+WHPNVY DG+VC+SILHPPG+DPNGYELA+ERW P+HTV Sbjct: 61 IMSFPEDYPCNPPIVRFTSEMWHPNVYADGKVCVSILHPPGDDPNGYELATERWNPVHTV 120 Query: 121 EXXXXXXXXXXXXPNDESPANIEAAAELVNYKLCCLHALCMCIPKCCQ 168 E PNDESPAN++AA + + + C+ K + Sbjct: 121 ESILLSIISMLSSPNDESPANVDAAKQWRESRDEFRKKVGRCVRKSQE 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3106 (251 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23352 420 e-119 >Contig23352 Length = 437 Score = 420 bits (1080), Expect = e-119, Method: Compositional matrix adjust. Identities = 201/216 (93%), Positives = 206/216 (95%) Query: 1 MCCLFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII 60 MC LFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII Sbjct: 222 MCALFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII 281 Query: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPNREDRIGVCKGIFRSDNVPDDDIVKIVDTFPGQS 120 VTGNDFSTLYAPLIRDGRMEKFYWAP REDRIGVC GIFRSDNV +DIVK+VDTFPGQS Sbjct: 282 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQS 341 Query: 121 IDFFGALRARVYDDEVRKWISGVGVDFIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 180 IDFFGALRARVYDDEVRKWI+GVGVD IGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV Sbjct: 342 IDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 401 Query: 181 MEQENVKRVQLADKYLSEAALGDANVDSIERGTFYG 216 EQENVKRVQLADKYLSEAALGDAN D++ GTFYG Sbjct: 402 QEQENVKRVQLADKYLSEAALGDANSDAMNTGTFYG 437 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17018 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 51912285 177 6e-47 >51912285 Length = 154 Score = 177 bits (450), Expect = 6e-47, Method: Compositional matrix adjust. Identities = 86/150 (57%), Positives = 107/150 (71%) Query: 11 VDFSQGSNIALKWAIDNLLDKGDTLFFIHVKPSQGDESRNLLWSATGSPLIPLEEFRDLD 70 +DFS+ S AL+WAI NL DKGDTL+ IH+KP+ ESR+ LW+ +GSPLIPL EFR+ Sbjct: 1 MDFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLTEFREPQ 60 Query: 71 VAQKYEINLDPEFLGMLATASSQXXXXXXXXXYWGDARDKLCDAVAELKLDSLVMGSRGL 130 + + Y + D E L L T S Q YWGDAR+KL AV +LKLDSLVMGSRGL Sbjct: 61 IMKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGL 120 Query: 131 GTIQRTFLGSVTNYVMVHATCPVTIVKDPS 160 TI+R LGSV+N+V+ +A+ PVTIVKDPS Sbjct: 121 STIKRIVLGSVSNFVLTNASIPVTIVKDPS 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60079 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20041 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57327 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17314 154 2e-40 >Contig17314 Length = 325 Score = 154 bits (390), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 72/97 (74%), Positives = 85/97 (87%) Query: 1 GLADLVGRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGF 60 GLAD+VGRRFG QK+PYNRNKS +GS+AMA AGFL SIGYM+YF+SFG++QESW M GF Sbjct: 229 GLADIVGRRFGTQKLPYNRNKSIAGSVAMASAGFLTSIGYMYYFSSFGYVQESWGMALGF 288 Query: 61 LVVSLGSTLVESLPISNEIDDNLTIPVTSLLLGTLVF 97 LVVSL S LVESLPIS E+DDNLT+ +TS L+G+LVF Sbjct: 289 LVVSLASALVESLPISTELDDNLTVSLTSALIGSLVF 325 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60046 (572 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41997 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33767 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7228 74 1e-15 >Contig7228 Length = 400 Score = 74.3 bits (181), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 53/158 (33%), Positives = 80/158 (50%), Gaps = 4/158 (2%) Query: 40 DPDNVLQSWDPTLVNPCTWFHVTCNQDNR-VTRVDLGNSNLSGHLVPEXXXXXXXXXXXX 98 DP +L SW N C++ V C+ D++ VT +DL ++NL G+LV E Sbjct: 81 DPSKILDSW--VGPNVCSYKGVFCSPDSQEVTGIDLNHANLKGNLVQELSLLSQLSLIHL 138 Query: 99 XXNHIQGTIPVELGNLRSLISLDLYSNNISGTIPASLGKLKSLVFLRLNDNQLTGQIPRE 158 N G IP L +L +L LDL +N+ SG+ P ++ +L++L L N +G IP E Sbjct: 139 NSNRFSGQIPETLRDLTALQELDLSNNDFSGSFPTVTLQIPNLIYLDLRYNSYSGTIPGE 198 Query: 159 LVGISSLKIVDVSSNNLCGTIPTTGPFEHIPLNNFENN 196 L L + +++NN G IP + + NF NN Sbjct: 199 LFN-QKLDAIFLNNNNFEGEIPESLGNSQASVINFANN 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37449 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13872 (218 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1093 (304 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3227 80 5e-17 >Contig3227 Length = 191 Score = 79.7 bits (195), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 48/117 (41%), Positives = 65/117 (55%), Gaps = 18/117 (15%) Query: 1 MFGFVTFVYPETVKLILAKGNPHFVCDSRVLVKPYKEKGKVPEKKXXXXXXXXXXXXXLE 60 MFGFVTFVY ETV+ IL+KGNPHFVC +RVLVKPY+EK ++ + K + Sbjct: 1 MFGFVTFVYAETVRQILSKGNPHFVCGARVLVKPYREKSRLVDWKHS------------D 48 Query: 61 RGEYSTCSSPSGIDPREPYDLHLGARMFYNTQEMLLRRKLEEQADLQQAIELQGRRL 117 ++S C +D D L A LR++ E+ +QA+EL+ RRL Sbjct: 49 TMQHSMCYHSHLMDG----DSELQAMPRVCDSARFLRKQFIEEN--EQALELERRRL 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22966256 (306 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10799 381 e-108 >Contig10799 Length = 252 Score = 381 bits (978), Expect = e-108, Method: Compositional matrix adjust. Identities = 186/252 (73%), Positives = 216/252 (85%), Gaps = 1/252 (0%) Query: 56 MPFLRIAIGQPQDTYHPDALKKALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIA 115 MP IA+G+P++TYHPDAL+ ALAEF TLIFVFAGEGSGMAF+KLTDD +TTP+GL+A Sbjct: 1 MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA 60 Query: 116 EALGHGLGLFVAVSGAWNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLL 175 AL H GLFVAV+ + NISGGH+NPAVTFGAF+GGNI+LLRG+LYWIAQLLG+ VAC L Sbjct: 61 AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL 120 Query: 176 LKFCTHGMTTSAFAISSGETVWNAFVLEIVMTFGLVYTVYATAIDPRNGNVGIIAPLAIG 235 LK T+G TT+AF++S G VWNAFV EIVMTFGLVYTVYATAIDP+ G+VG IAP+AIG Sbjct: 121 LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIG 180 Query: 236 LIVAANILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGFVYETIFID 295 IV ANILAGGAFDGASMNPA+SFGPALVSW W NHWVYWAGPLIG GIAG +YE +FI Sbjct: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYEFVFIG 240 Query: 296 RT-HEPLPGSEF 306 + HE LP +++ Sbjct: 241 NSGHEQLPSTDY 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23251 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2986 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6378 173 3e-45 >Contig6378 Length = 299 Score = 173 bits (439), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 123/306 (40%), Positives = 141/306 (46%), Gaps = 19/306 (6%) Query: 1 MEFWGVEVKAGESFKVKSEDDKILHLSQAALGESKKEKGNESVPLFLKIDQQKLVLGTLL 60 + FW VEVKAGE KV E+ ++HLSQA LGE KK G + + +K+ QKLVL L Sbjct: 5 LGFWVVEVKAGEPLKVVPEESSVIHLSQATLGELKK--GGDQCVIHVKVGNQKLVLANLS 62 Query: 61 PANIPQLSFDLVFDKEFELSHNWKNGSVFFMGYKSVLPXXXXXXXXXXXXXXXXLPVNAI 120 IPQ+ FDLVFDKEFELSHN K+GSV F GY++ L LP+N Sbjct: 63 SDKIPQIPFDLVFDKEFELSHNLKSGSVHFCGYQTCL--ADESDEEDQSDSEEDLPLNFT 120 Query: 121 ENGKPEPKVEQAKAVPTNANA------GKAKVKXXXXXXXXXXXXXXXXXXXXXXXXXXX 174 +NG KV AK P NA GK KV Sbjct: 121 DNG----KVVAAKPAPPKTNAVKPESSGKQKVNIVEPIKDEDDSDDSDDIGDSDDDDDDR 176 Query: 175 XXXXXXXXXXXXXXXXXXXXXXXXXXTPKKKVEPGKKRPTESXXXXXXXXXXXXLVSPQK 234 TPKK KKRP ES V+PQK Sbjct: 177 SSDEDMLGADSSDEDDDDSEEEEETPTPKKN---SKKRPNESTPKTPVSAKKAKQVTPQK 233 Query: 235 TDGKKGGAHTATPHPNKKAGKTPAXXXXXX-XXXXXXXXQVSCKSCSKTFNSENALQSHS 293 TDGKK GAHTATPHP KK GKTPA SCK C+K+FNS+ AL SH Sbjct: 234 TDGKK-GAHTATPHPAKKGGKTPATSDKSKPQTPKSAGGDHSCKPCNKSFNSDGALSSHK 292 Query: 294 KAKHGV 299 KAKHG Sbjct: 293 KAKHGA 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24066257 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21945 144 2e-36 >Contig21945 Length = 282 Score = 144 bits (362), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 97/237 (40%), Positives = 118/237 (49%), Gaps = 47/237 (19%) Query: 2 STSKTHRRGH-EEKNRKGR-LAQRSSSFHSGIPMTMAPQAELRRPKTLPDXXXXXXXXXX 59 S + RRG EEK R+ R L+ RSSSFH P MA Q +LRRPKT+PD Sbjct: 88 SPKSSSRRGQPEEKYRRPRPLSDRSSSFHGQFP-EMATQ-QLRRPKTVPDMASFRNAVGT 145 Query: 60 XXP--EGGPRLTKLLLNVTVQRSLGPVQVVMSPDSTVGDLIAAVLRQYAKEGRRLVLPTT 117 E P+LTKLLLNVT+Q S+G +QVVMSP+ TVGDL+AA +RQY KEGRR +LP+ Sbjct: 146 TASSMELRPKLTKLLLNVTIQGSVGAIQVVMSPELTVGDLVAAAVRQYGKEGRRPILPSV 205 Query: 118 DPAGFDLHYSQFXXXXXXXXXXXXXXXXXXXXXXXXXXTRVVVVINTVFEWTAGLDRNEK 177 +P+ FDLHYSQF L R EK Sbjct: 206 EPSLFDLHYSQFSLE--------------------------------------SLAREEK 227 Query: 178 LMTLGSRNFFLCCKKSEPDVGXXXXXXXXXXXXXXXXXXXDKVSKISVPWLKFIDFL 234 LM LGSRNFFLC +KVS+ WLKF++F+ Sbjct: 228 LMELGSRNFFLC---PNAKAVGGGGGGGATASSASCSKEAEKVSRNGFAWLKFMNFM 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4738 (411 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11466257 (503 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22766257 (356 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6662 459 e-131 >Contig6662 Length = 368 Score = 459 bits (1182), Expect = e-131, Method: Compositional matrix adjust. Identities = 222/332 (66%), Positives = 265/332 (79%), Gaps = 1/332 (0%) Query: 25 DRQALLDFKAALNEPYLGIFKSWSGNDCCSSWFGISCD-SAGRVADINLRGESEDPIFER 83 D AL + L + LGIF SW G DCC +W+G+SCD + GRV DINLRGESEDPI ++ Sbjct: 29 DLAALQSIRTGLTDSSLGIFNSWVGTDCCVNWYGVSCDPTTGRVVDINLRGESEDPILKK 88 Query: 84 AGRSGYMTGAISPSICKLDSLTTLIIADWKGISGEIPPCISSLSKLRILDLVGNKITGVI 143 +G+SG+M+G+ISP IC LD LTTL++ADWKG++GEIP C+++LS LR+LDLVGNKI+G I Sbjct: 89 SGQSGFMSGSISPKICSLDRLTTLVLADWKGVTGEIPQCLTTLSNLRVLDLVGNKISGKI 148 Query: 144 PADIGKLQRLTVLNVADNSISGGIPASVVNLASLMHLDLRNNQITGGIPQDFGKLTMLSR 203 PADIG L+ L VLN+ADN ISG IPAS+V L+ LMH+DL NNQITG +P DFGKL MLSR Sbjct: 149 PADIGNLKMLRVLNLADNQISGKIPASLVGLSGLMHMDLSNNQITGELPADFGKLKMLSR 208 Query: 204 AMLGRNQLTGTIPSSISGLYRLADFDLSVNQISGVIPAELGSMPVLSTLNLDSNRLSGSI 263 A+L RNQLTG+IP SI + RLAD DLS NQ+ G +P LG M VLSTLNLD N+ SG + Sbjct: 209 ALLNRNQLTGSIPDSIGNMNRLADLDLSRNQMWGSVPDCLGKMQVLSTLNLDGNKFSGQL 268 Query: 264 PASLLSNTGLNILNLSRNSLEGKLPDVFGSKTYFIGLDLSYNNLKGQIPKSLSSAAYIGH 323 PAS+LSN G+ ILNLSRN EG +PDVF +YF+ LDLSYNNLKG IP SLS+A YIGH Sbjct: 269 PASVLSNRGMGILNLSRNGFEGNIPDVFHGNSYFMALDLSYNNLKGPIPGSLSAAKYIGH 328 Query: 324 LDLSHNHLCGSIPTGWPFDHLEASSFSFNDCL 355 LDLSHNHLCG+IP G PFDHLE SSF+ NDCL Sbjct: 329 LDLSHNHLCGAIPVGNPFDHLEVSSFTNNDCL 360 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66240 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19280 217 8e-59 >Contig19280 Length = 169 Score = 217 bits (553), Expect = 8e-59, Method: Compositional matrix adjust. Identities = 108/173 (62%), Positives = 133/173 (76%), Gaps = 5/173 (2%) Query: 1 MDHNETGCQAPPEAPILCINNCGFFGSAATMNMCSKCHKDLVLKQEQAKLAASSFESIVE 60 M+H ETGCQ+ PE PILC+NNCGFFGSAATMNMCSKCHKD+VLKQEQ KLAASSF SIV Sbjct: 1 MEHEETGCQSAPEGPILCVNNCGFFGSAATMNMCSKCHKDMVLKQEQTKLAASSFGSIVN 60 Query: 61 GSSNCNAKESMVAIAKADIIQTGPSESMPVPTQAACASPSETNDRVK-EGPNRCSSCRKR 119 +S+ NA E + ++ +Q P E + +Q + + S ++ K EGP RC++C KR Sbjct: 61 RTSSINANEPVASVD----VQPHPMEPKTLSSQPSFSFGSGSSGEPKPEGPKRCNTCNKR 116 Query: 120 VGLTGFNCRCGNIFCAVHRYSDKHACPFDYRTAARDAIAKSNPVIKPEKLDKI 172 VGLTGFNCRCG++FCAVHRYSDKH C +DY TA +DAIAK+NPV+K +KL KI Sbjct: 117 VGLTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANPVVKADKLGKI 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14109 (388 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9979 114 4e-27 >Contig9979 Length = 342 Score = 114 bits (284), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 98/347 (28%), Positives = 155/347 (44%), Gaps = 50/347 (14%) Query: 17 MTICMIGAGGFIGSHLCEKLMAETMHKVLAVDVYSDKIKHLLEPSTHPWSDRIQFHRINI 76 M I + G GFIGSHL +KLM ++V+ D Y K L+ W +F I Sbjct: 30 MRILVTGGAGFIGSHLVDKLMENEKNEVIVADNYFTGSKDNLK----KWIGHPRFEL--I 83 Query: 77 KHDSRLEGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIHF 136 +HD E L+ D +LA +P Y P+ TI +N I L ++ R++ Sbjct: 84 RHDV-TEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLT 142 Query: 137 STCEVYGKTIGSFLPKDSPLWQDPTYYVLKEDASPCIFGPIEKQRWSYACAKQLIERLIY 196 ST EVYG + P+ W + PI R Y K++ E L++ Sbjct: 143 STSEVYGDPL--IHPQTENYWGN--------------VNPI-GVRSCYDEGKRVAETLMF 185 Query: 197 AEGAENDLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRHEPLKLVDGGQ 256 ++ +E I R FN GPRM+ G RV++ F +R++PL + G Sbjct: 186 DYHRQHGIEIRIARIFNTYGPRMNIDDG---------RVVSNFIAQAIRNDPLTVQAPGT 236 Query: 257 SQRTFVYIKDAIEAVLLMIDNPARANGHIFNVGNPNNEVTVRQLAEMMTEVYAKVSGEPS 316 R+F Y+ D ++ ++ ++ N N+GNP E T+ +LAE + E+ P Sbjct: 237 QTRSFCYVSDMVDGLIRLMQG---DNTGPINIGNP-GEFTMLELAENVKELI-----NPK 287 Query: 317 LEVPTVDVSSKEFYGEGYDDSDKRIPDMTIINKQLGWNPKTSLWDLL 363 +E+ V+ + DD +R P+++ + LGW PK L + L Sbjct: 288 VEIIMVENTP--------DDPRQRKPNISKAKELLGWEPKVKLREGL 326 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48346 (140 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54183 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8 313 1e-87 >Contig8 Length = 262 Score = 313 bits (802), Expect = 1e-87, Method: Compositional matrix adjust. Identities = 145/203 (71%), Positives = 175/203 (86%) Query: 1 MVKFRSEFSHYVFFCLNLFSCIAVVESCMMVVASLVPNFLMGIITGAGLIGIMMMTSGFF 60 +VKFR EFSHYV+FCL+++ I+V+ES MMVVASLVPNFLMGIITGAG++GI+MMTSGFF Sbjct: 59 LVKFRPEFSHYVYFCLDIYLSISVIESLMMVVASLVPNFLMGIITGAGIMGILMMTSGFF 118 Query: 61 RLLSDLPKPFWRYPVSYISYGAWGLQGAYKNDLIGLEFEPLISGDPKLKGSEIITNMLGI 120 RLL DLPKPFWRYP+SYI YG+W LQG+YKNDLIGLEFEP+ G+PKL G II ++ GI Sbjct: 119 RLLPDLPKPFWRYPISYIGYGSWALQGSYKNDLIGLEFEPMTPGEPKLTGEYIIRHIFGI 178 Query: 121 QLDHSKWWDLTALFIILISYRLIFFLILKFKERAWPYFRTLYSNRTIQQLNRRPSFHTKP 180 +DHSKWWDL A+F ILI YR++FFLILKFKE A P F++LY+ RT+ +L++RPSF P Sbjct: 179 PIDHSKWWDLAAVFAILIIYRVLFFLILKFKESALPVFQSLYAKRTLHRLDKRPSFRKLP 238 Query: 181 SFPSKRHQALHSLSSQEGLSSPI 203 S SKRHQALHSLSSQEGL+SP+ Sbjct: 239 SISSKRHQALHSLSSQEGLNSPL 261 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11995 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31574 96 2e-22 >Contig31574 Length = 119 Score = 95.9 bits (237), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 46/69 (66%), Positives = 57/69 (82%), Gaps = 3/69 (4%) Query: 27 RFLKPPHCAPL---QQIQEQIDVGIMCEPCNGKGWLLCDFCKGQKTNVKAENNRIYRRCP 83 RF KP +C+P+ QQ Q++ DV I+CE CNG+GWLLCDFCKGQKTNVK+E +RIYRRCP Sbjct: 28 RFFKPANCSPIIQQQQQQQEADVSILCEDCNGRGWLLCDFCKGQKTNVKSETSRIYRRCP 87 Query: 84 SCRAVSCLL 92 SCRA+ +L Sbjct: 88 SCRAIGQVL 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29302 (222 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6300 203 2e-54 >Contig6300 Length = 192 Score = 203 bits (516), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 90/180 (50%), Positives = 130/180 (72%), Gaps = 1/180 (0%) Query: 3 LWVFGYGSLVWNPGFDYDEKVIGFIKDYKRVFDLACIDHRGTPEHPARTCTLEQSEGAIC 62 +WVFGYGSL+W GF+YDE+++GFIK Y+RVF DHRGTPE+P RT TLE +EG +C Sbjct: 6 IWVFGYGSLIWKAGFNYDERLVGFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGEVC 65 Query: 63 WGAAFCVRGGPEKERLAMEYLERRECEYDCKTLVDFYKEGNTSAPALTGIIVFTSTPDKV 122 WG A+ + E + +A+ YLE RE +YD K +DF+ + + A++G++V+ ++PDK Sbjct: 66 WGVAYKI-SNKEDQEVAITYLEVREKQYDKKAYLDFFTDPMATTAAVSGVMVYIASPDKK 124 Query: 123 SNKYYLGPAPLEDMARQIATAVGPCGNNRDYLFLLEKAMFDIGHEDDMVIELASEVRKVL 182 N YLGPA E++++QI A GP G NRDYLF LE+A+ +G +D V++LA+EVR++L Sbjct: 125 HNVNYLGPASTEEISKQIVQAEGPSGPNRDYLFRLEEALLQLGCKDRHVLDLANEVRRIL 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31003 (427 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6102 309 5e-86 >Contig6102 Length = 212 Score = 309 bits (792), Expect = 5e-86, Method: Compositional matrix adjust. Identities = 148/179 (82%), Positives = 159/179 (88%) Query: 213 MKIAAGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHPKLSDFGLAKVGPTGDKTHVS 272 MKIAAGAAKGL+YLHDK PPV++R+LKCSNILLGEGYHPKLS FGLAK+GP GD THVS Sbjct: 1 MKIAAGAAKGLKYLHDKASPPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVS 60 Query: 273 TRVMGTYGYCAPDYAMTGQLTFKSDIYSFRVVLLELITGRKAIDNSKGAREQNLVAWARP 332 VMGTYGYCAP+YAMTGQLT KSDIYSF VVLLE+ITGR AIDN++GA EQ LV WAR Sbjct: 61 KWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWART 120 Query: 333 LFKDRRKFSQMADPLLHGQYPVRGLYQALAIAAMCVQEQPNMRPLIADVVTALNYLASQ 391 LFKDRRK SQMADP L GQYP RGLYQALA+A MCVQEQPNMRP+IADVVTAL YLASQ Sbjct: 121 LFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTYLASQ 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3302 (652 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5971 340 3e-95 >Contig5971 Length = 318 Score = 340 bits (873), Expect = 3e-95, Method: Compositional matrix adjust. Identities = 166/295 (56%), Positives = 222/295 (75%), Gaps = 1/295 (0%) Query: 325 KCLRDAKMDKSGVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXX 384 K + DA ++K + ++VLVGGSTRIPKVQQLL+D+F+GKE K +NPDE Sbjct: 2 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 61 Query: 385 ILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGV 444 ILSGEG E+ +D ET GGVMT LIPRNT IPTKK QVF+TY D Q V Sbjct: 62 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 121 Query: 445 LIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKTTGQK 504 IQV+EGER+ T+D LGKF+L+GIPPAPRG PQI V F++DANGILNV AEDK TG+ Sbjct: 122 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRAEDKGTGKS 181 Query: 505 NKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKD-EK 563 KITITNDKGRLS+EEI++MV+EAE++ ED++ K++++A+N+LE Y YNM+N I D +K Sbjct: 182 EKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDK 241 Query: 564 IGAKLPPEDKKKIEDAIEQAIQWLDANQLAEADEFEDKMKELESLCNPIIAKMYQ 618 + KL ++K+KIE A ++A++WLD NQ AE +++++K+KE+E++CNPII+ +YQ Sbjct: 242 LADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISAVYQ 296 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23866261 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35628 (196 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6102 121 7e-30 >Contig6102 Length = 212 Score = 121 bits (304), Expect = 7e-30, Method: Compositional matrix adjust. Identities = 56/113 (49%), Positives = 77/113 (68%) Query: 1 MGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLA 60 MGTYGY APEY TG LT +SD+YSFGVVLLE+++GR A+D R +GE LVEWA+ Sbjct: 64 MGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWARTLFK 123 Query: 61 NKRKIFRILDNRLEGQYSLEGAHKASNLALRCLSTEAKFRPTMTEVVTALEQL 113 ++RK+ ++ D L+GQY G ++A +A C+ + RP + +VVTAL L Sbjct: 124 DRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTYL 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38423 (131 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58117 (516 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21541 588 e-170 >Contig21541 Length = 520 Score = 588 bits (1516), Expect = e-170, Method: Compositional matrix adjust. Identities = 313/521 (60%), Positives = 366/521 (70%), Gaps = 6/521 (1%) Query: 1 MAPTLTSNSFXXXXX-XXXXXXXKNPSLRVYAKRAGPLSAFRLGKQSDGPS--EESQENG 57 MA TLTSNSF KN L V+AKR GPLSAFR GK D S +E Q + Sbjct: 1 MAATLTSNSFLLTSTPNSRATTRKNARLSVFAKRGGPLSAFRFGKSGDNGSVSDEGQADD 60 Query: 58 SANSAPFSFNFGKVSDVSSLIPVMTKPSSGLSFG--RRKDPGTVFVAGATGQAGIRIAQA 115 S NS+ F +FGK+ DV +LIPV+++PS GLSFG R KDPGTVFVAGATGQAG+RIAQA Sbjct: 61 STNSSSFRLDFGKIPDVKALIPVVSRPSLGLSFGNQRAKDPGTVFVAGATGQAGVRIAQA 120 Query: 116 LLREGFSVRAGVSDLGAAQELARLGAKYKIISNEESKRLNAVESSFQDAESIAKAIGNAS 175 LLREGFSVRAGV +LGAAQELAR+ +KYKIISNEESKRLNAVES FQDAESIAKAIGNAS Sbjct: 121 LLREGFSVRAGVPELGAAQELARVASKYKIISNEESKRLNAVESVFQDAESIAKAIGNAS 180 Query: 176 KVVVTIGPGENGPTAEVTPLDALQVIQAADLAGVGHVAIIYDESPFVSSTYNVIDGISTF 235 K VVTIGP ENGPT EVTP DALQV+QAA LAGVGHVAI+YD + +STYNV+DGIS F Sbjct: 181 KAVVTIGPAENGPTTEVTPFDALQVVQAAQLAGVGHVAIVYDGNSVGTSTYNVLDGISLF 240 Query: 236 FNNLFSRSQPLTVTEFLQKVVETDVSYTLIRTNLTEDFSPESSYNVVVSAEGSVSSNDYK 295 FNNLFSRSQPL+V+EFLQKV+E DVSYT I+T+LTEDFSPESSYN+VVSAEGS ++NDYK Sbjct: 241 FNNLFSRSQPLSVSEFLQKVIEMDVSYTFIKTSLTEDFSPESSYNIVVSAEGSRAANDYK 300 Query: 296 VATSQIASLVANVFSNTAVAENKVVKVFTDPGAPSKPAVELFSAIPKDGRRXXXXXXXXX 355 VA SQIA+LVA+VFSNT+VAENKVV+V+TDP AP +P +LFS IP+D RR Sbjct: 301 VAKSQIAALVADVFSNTSVAENKVVEVYTDPSAPLRPVDQLFSTIPEDERRKAYAIMVAK 360 Query: 356 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEQETRXXXXXXXXXXXXXXXXXSVEVFL 415 +EQE R S++ L Sbjct: 361 AKAEEEAIIAAERAREAAEATKKLEEEVKKLTEQEARSTNLAEDAQVKAEAAGASIDSLL 420 Query: 416 SKAKDLGSGLSWEKFSSQLAISVQKPTEKPKVQIATVRGQAKARSLQPKKAVVKLPTFXX 475 +KAK++G G+SW+KFS+Q+A +VQ +E PKVQIATVRGQAKAR+L P+KAV K T Sbjct: 421 NKAKNIGMGMSWKKFSTQVADTVQN-SETPKVQIATVRGQAKARTLSPQKAVSKPVTTPK 479 Query: 476 XXXXXXXXXXXXXXXXXXXXAEVRKVFGGLFKQETIYIDDD 516 EVRKVFGGLF QET+Y+D++ Sbjct: 480 PVSLKRKEQPKPKAKQTDEKKEVRKVFGGLFTQETVYVDEE 520 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32059 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46990835 182 6e-48 >46990835 Length = 192 Score = 182 bits (461), Expect = 6e-48, Method: Compositional matrix adjust. Identities = 87/154 (56%), Positives = 114/154 (74%) Query: 19 MTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGSVCDVSS 78 MTALVTGGTKGIG+AIVEELAGLGA +HTC+R E +LN+CL W+ KGF V+GSVCDV S Sbjct: 1 MTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVS 60 Query: 79 RAQREKLMQTISSVFNGKXXXXXXXXXXTIQKPTVEVTAEEFSTIMAINFESVYHLSQIA 138 + QRE+L+ +SS+F+GK K T+E TAE++S +M+ N ES YHL Q++ Sbjct: 61 KTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAYHLCQLS 120 Query: 139 HPLLKASGAGSIVFISSVCGIVAHKNISAYSVTK 172 HPLLKASG+ +IV +SS+ G+V+ + YS TK Sbjct: 121 HPLLKASGSANIVLLSSIAGVVSLNIGTIYSATK 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16221 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16325 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27776 161 7e-42 >Contig27776 Length = 419 Score = 161 bits (408), Expect = 7e-42, Method: Compositional matrix adjust. Identities = 80/103 (77%), Positives = 83/103 (80%) Query: 44 VENPGNNLYVTGLSTRVTKRELEKHFASEGSVADVHLVTDPWTRESRGFGFVTMSTVEEA 103 VENPGNNLYVTGLS RVTKRELEKHFA+EG V DVHLV DPWTRESRGFGFVTM V+EA Sbjct: 55 VENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEA 114 Query: 104 NRCIKYLDRSVLEGRVITVEKAXXXXXXXXXXXKYLGLRTVRV 146 RCIKYLD SVLEGRVITVEKA +YLGLRTV V Sbjct: 115 ERCIKYLDGSVLEGRVITVEKARRRRGRTPTPGRYLGLRTVHV 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43351 (233 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20367 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54598 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49462 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15446 (50 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65578 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22383 179 3e-47 >Contig22383 Length = 371 Score = 179 bits (455), Expect = 3e-47, Method: Compositional matrix adjust. Identities = 95/215 (44%), Positives = 134/215 (62%), Gaps = 11/215 (5%) Query: 1 MLDMGFEPQIREVMQNLPQKHQTLLFSATMPMEIETLAQEYLNNPVQVKVGKVSCPTAN- 59 MLDMGFEPQIR++++ +P + QTL+++AT P E+ +A + L PVQV +G V AN Sbjct: 20 MLDMGFEPQIRKIVKEIPARRQTLMYTATWPKEVRKIAADLLVKPVQVNIGNVDELVANK 79 Query: 60 -VSQILEKVSESEKIDGLLALLVEEASQAERCGRPFPLTIVFVERKTRCDEVTEALVAQG 118 ++Q +E ++ EK L LL R P I+F K CD+++ L Q Sbjct: 80 SITQYVEVLTSMEKHRRLEQLL--------RSQEPGSKIIIFCSTKKMCDQLSRNLTRQ- 130 Query: 119 LRAVALHGGRSQAEREAALRDFRNGATNILVATDVASRGLDVTGVAHVINLDLPKAMENY 178 A A+HG +SQ+ER+ L FR+G T ILVATDVA+RGLD+ + VIN D P +E+Y Sbjct: 131 FGAAAIHGDKSQSERDYVLNQFRSGRTPILVATDVAARGLDIKDIRVVINYDFPTGVEDY 190 Query: 179 VHRIGRTGRAGSTGQATSFYTDRDVFLVAHIRKAI 213 VHRIGRTGRAG+TG A +F+ D+D + + K + Sbjct: 191 VHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVL 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13445 (102 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48827 (446 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226742903 150 3e-38 >226742903 Length = 195 Score = 150 bits (380), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 70/165 (42%), Positives = 105/165 (63%) Query: 111 ELIDSVLDVVRKEAENCDCLQGFQVCHXXXXXXXXXXXXXXISKIREEYPDRMMLTFSVF 170 E++D LD +RK A NC LQGF V + + ++ +Y + L F+V+ Sbjct: 19 EIVDLCLDRIRKLAYNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY 78 Query: 171 PSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLIS 230 PSP+VS +VVEPYN+ LS H L+E+ D ++LDNEA+YDIC R+L + P++ +LN L+S Sbjct: 79 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 138 Query: 231 ATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTS 275 +S +T LRF G LN D+ + NL+P+PR+HF + +AP+ S Sbjct: 139 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVIS 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47723 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44899 (111 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566262 (223 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 401 e-114 >Contig27182 Length = 447 Score = 401 bits (1031), Expect = e-114, Method: Compositional matrix adjust. Identities = 195/203 (96%), Positives = 200/203 (98%) Query: 10 LRLPLQDVYKIGGIGTVPVGRVETVVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPG 69 LRLPLQDVYKIGGIGTVPVGRVET V+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPG Sbjct: 234 LRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPG 293 Query: 70 DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT 129 DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT Sbjct: 294 DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT 353 Query: 130 SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA 189 SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFSEYPPLGRFA Sbjct: 354 SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA 413 Query: 190 VRDMRQTVAVGVIKSVEKKDPSG 212 VRDMRQTVAVGVIKSVEKK+P+G Sbjct: 414 VRDMRQTVAVGVIKSVEKKEPTG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23566259 (399 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 788 0.0 >Contig27182 Length = 447 Score = 788 bits (2036), Expect = 0.0, Method: Compositional matrix adjust. Identities = 377/388 (97%), Positives = 385/388 (99%) Query: 1 MNKRSFKYAWVLDKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQ 60 MNKRSFKYAWVLDKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQ Sbjct: 49 MNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQ 108 Query: 61 ADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYD 120 ADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYD Sbjct: 109 ADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYD 168 Query: 121 EIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKR 180 EIVKEVSSYLKKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKR Sbjct: 169 EIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKR 228 Query: 181 PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLP 240 P+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L Sbjct: 229 PSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQ 288 Query: 241 EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPV 300 EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPV Sbjct: 289 EALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPV 348 Query: 301 LDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPP 360 LDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFSEYPP Sbjct: 349 LDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPP 408 Query: 361 LGRFAVRDMRQTVAVGVIKSVEKKDPSG 388 LGRFAVRDMRQTVAVGVIKSVEKK+P+G Sbjct: 409 LGRFAVRDMRQTVAVGVIKSVEKKEPTG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34966257 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24826 133 6e-34 >Contig24826 Length = 447 Score = 133 bits (334), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 63/66 (95%), Positives = 66/66 (100%) Query: 10 NGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE 69 +GKELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE Sbjct: 371 SGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVE 430 Query: 70 KKDPSG 75 KKDP+G Sbjct: 431 KKDPTG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22361 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32189 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46331 (399 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45712 (346 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9938 72 1e-14 >Contig9938 Length = 492 Score = 72.4 bits (176), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 56/173 (32%), Positives = 83/173 (47%), Gaps = 10/173 (5%) Query: 85 IRRHEHFLALQLGVKPGQKVLDVGCGIGGPLREIARFSSTSVTGLNNNEYQITRGRELNC 144 I + F+A +L +KPGQKVLDVGCGIGG +A V G++ + I+ E + Sbjct: 269 IETTKEFVA-KLDLKPGQKVLDVGCGIGGGDFYMASNFDVEVIGIDLSVNMISFALEQSI 327 Query: 145 IAGVDKTCDFVKADFMKMPFSDNTFDAVYAIEATCHAPDALGCYKEIYRVLKPGQCFAAY 204 G+ +F AD K + DNTFD +Y+ + H D ++ Y LKPG Sbjct: 328 --GLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYEWLKPGGKVLIS 385 Query: 205 EWCMTDAFDPNNQEHQKIKAEIEIGDGLPDIRLTRQCLEALKQAGFEVIWEKD 257 ++C P+ + IK G L D++ Q LK AGF+ + +D Sbjct: 386 DYCRC-VGTPSENFAEYIKQR---GYDLHDVKAYGQ---MLKDAGFDEVIAED 431 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14908 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6492 (94 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39374 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13066260 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8443 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38760 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2940 117 7e-29 >Contig2940 Length = 312 Score = 117 bits (294), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 57/125 (45%), Positives = 83/125 (66%), Gaps = 5/125 (4%) Query: 18 VMNVHAIPEECSPNHYSATSSQAIWQDNVDPDNMTYEELLDLGEAVGTQSRGLSQEHINL 77 +M + I ++ + H +SQ W++ +DPD ++YEELL LGE VGT++RGLS + I Sbjct: 187 LMALSGINDQDTEEH--GGNSQDTWEE-IDPDELSYEELLALGEVVGTENRGLSADTIAS 243 Query: 78 LPTCRYKSGRLFSRKRSAERCVICQMGYKRGDRQIKLPCKHVYHTDCGTKWLTINKVCPV 137 LP+ YK+G S+ S E CVIC++ ++ G+ L CKH YH++C WLTINK+CPV Sbjct: 244 LPSVSYKTGS--SQNGSNESCVICRLDFEDGENLTILSCKHSYHSECINNWLTINKICPV 301 Query: 138 CNIEV 142 C+ EV Sbjct: 302 CSAEV 306 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23393 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47556 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2649 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43701 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26566259 (343 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44921 (146 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28056 (310 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566265 (364 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11866265 (337 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60795 (140 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv408 (80 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28976 155 2e-40 >Contig28976 Length = 293 Score = 155 bits (391), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 69/79 (87%), Positives = 75/79 (94%) Query: 1 MHHDCPVCFEYLFESTDDVTVMPCGHTIHQNCLKEMREHLQYACPLCSKSVCDMSKVWEK 60 MHHDCPVCFE+LFE+ DDVTVMPCGHTIH+NCL EMR+H QYACPLCSKSVCDMSKVWEK Sbjct: 180 MHHDCPVCFEFLFETRDDVTVMPCGHTIHKNCLNEMRDHYQYACPLCSKSVCDMSKVWEK 239 Query: 61 FDMEIAAIPMPEPYQNKMV 79 +DMEIAA PMPEPYQNK+V Sbjct: 240 YDMEIAATPMPEPYQNKLV 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2353 (368 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2536 649 0.0 >Contig2536 Length = 365 Score = 649 bits (1673), Expect = 0.0, Method: Compositional matrix adjust. Identities = 307/365 (84%), Positives = 337/365 (92%), Gaps = 1/365 (0%) Query: 1 MRAVAFLL-LLLCATCHIALSFTDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGF 59 MR VA LL +LL ATCH A S DG L NGNFEL PKPSD+KG+EVIG +AIP+WE SGF Sbjct: 1 MRGVAVLLSVLLFATCHSAFSLIDGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGF 60 Query: 60 IEYIKAGQKQGDMLLVVPEGAFAVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERL 119 +EYIK+GQKQGDMLLVVPEGA+AVRLGNEASIKQ +KV KG+YYSITFSAARTCAQEERL Sbjct: 61 VEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERL 120 Query: 120 NISVAPDWGVLPMQTLYSSNGWDSYAWAFQADYDVIEIVIHNPGVEEDPACGPLIDSVAF 179 N+SVAPD GVLP+QT+YSSNGWDSYAWAFQADY+ +E+V+HNPGVEEDPACGPLIDSVA Sbjct: 121 NVSVAPDSGVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGVEEDPACGPLIDSVAI 180 Query: 180 RALYPPRPSSKNLLKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI 239 R LYPPR ++KNLLKN GFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI Sbjct: 181 RTLYPPRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI 240 Query: 240 DSDHFSVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASNSCEGSMVVEAFAG 299 DSDHFSVP+ KRAVELVAGKESAIAQV RTIPGKTY LSFSVGDASNSCEGSM+VEAFA Sbjct: 241 DSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFAD 300 Query: 300 RDTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYASLCGPVLDDVKLL 359 ++T+KVPYESKGKGGFKRAVL+FVA S RTR+MFLST+YTMRSDD++SLCGPV+DDVKLL Sbjct: 301 KNTVKVPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLL 360 Query: 360 SLRTP 364 SLR P Sbjct: 361 SLRKP 365 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2471 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48056 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11014 110 1e-26 >Contig11014 Length = 227 Score = 110 bits (274), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 51/74 (68%), Positives = 56/74 (75%) Query: 1 MSPDGQYMASGDEDGTIMMWDLSSGRCVMPLMGHMSCVWSLAFSCEXXXXXXXXXXXXVK 60 MSPDG+YMASGDEDG IMMWDLS+GRCV PLMGH SCVW+L FS E VK Sbjct: 154 MSPDGRYMASGDEDGAIMMWDLSTGRCVTPLMGHTSCVWTLDFSGEGSLLASGSADCTVK 213 Query: 61 LWDVTTSTKVPRSE 74 LWDVT STK+PR+E Sbjct: 214 LWDVTASTKLPRTE 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43227 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48264387 199 2e-53 >48264387 Length = 126 Score = 199 bits (507), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 98/126 (77%), Positives = 110/126 (87%), Gaps = 3/126 (2%) Query: 1 MDPPSSWDALRKQARKLEAQLDEQMHLYRKLVSMKVD---GDKEKEIDSGIDQLLKQLQQ 57 M+ PSSWDALRKQARKLEAQLDEQM+ YRK VS K G E +++SGID+LLKQLQQ Sbjct: 1 MEVPSSWDALRKQARKLEAQLDEQMNSYRKFVSAKGSTKVGTAENDLESGIDRLLKQLQQ 60 Query: 58 VNSHMQAWVSSGGSEIFSHTLTRHQEILQDLTQEFYRLRSSFRAKKEHASLLEDFREFDR 117 VNS MQAWVSSGGSE+ SHTLTRHQEI QD+TQEFYRLR+S RAK+EHASLLEDFREFDR Sbjct: 61 VNSQMQAWVSSGGSEMVSHTLTRHQEIFQDITQEFYRLRNSLRAKQEHASLLEDFREFDR 120 Query: 118 SRLDLE 123 +R+DLE Sbjct: 121 TRVDLE 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25866264 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30431 202 3e-54 >Contig30431 Length = 228 Score = 202 bits (515), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 86/144 (59%), Positives = 113/144 (78%) Query: 17 VYLNVYDLTPMNGYAYWLGLGIYHSGVQVHGVEYAFGAHEHPTTGIFEVEPKQCPGFTFR 76 V LNVYDLTP+N Y W GLGI+HSG++VHG EY FGAH+ P +G+FEVEP+ CPGF +R Sbjct: 24 VVLNVYDLTPLNNYTVWFGLGIFHSGIEVHGKEYGFGAHDFPVSGVFEVEPRSCPGFIYR 83 Query: 77 KSILIGRTDLGPKDVRSFMEKLAEEYSGNTYNLITRNCNHFCNDVCNRLTGKPIPRWVNR 136 SI +GR ++ P + R+F+E +A EY G+TY+LI++NCNHF +D+ RLT K +P WVNR Sbjct: 84 CSIQLGRINMPPSEFRTFIEHVAAEYHGDTYHLISKNCNHFTDDMARRLTEKQVPGWVNR 143 Query: 137 LARLGFLCNCVLPVSLNETKVRQV 160 LARLG LC+C+LP SL T V+Q+ Sbjct: 144 LARLGALCSCLLPESLQVTTVKQI 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58648 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61809 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27035 148 3e-38 >Contig27035 Length = 291 Score = 148 bits (373), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 69/95 (72%), Positives = 78/95 (82%) Query: 7 KLAEELDGWLRASGLAKSPDVRGVIAPHXXXXXXXXXXXXXFGNIDPSSISRVFLLGPSH 66 KL+EE++GWLRASGL KSPDVRGVIAPH FGNIDP++I RVFLLGPSH Sbjct: 20 KLSEEIEGWLRASGLNKSPDVRGVIAPHAGYSYSGRAAAYAFGNIDPTNIKRVFLLGPSH 79 Query: 67 HYYTPKCALSRATVYKTPVGDLQIDLEVVEELKAT 101 H+YTPKCALS ATVYKTP+GDL IDLEV+EELKA+ Sbjct: 80 HHYTPKCALSTATVYKTPIGDLPIDLEVIEELKAS 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12996 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59526 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14935 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4327 (369 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42876 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35984 (174 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45747 (361 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27141 158 1e-40 >Contig27141 Length = 283 Score = 158 bits (400), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 77/78 (98%), Positives = 77/78 (98%) Query: 284 MRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPSSA 343 MRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTP SA Sbjct: 1 MRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSA 60 Query: 344 GGLEGPDRIFVGGLPYYF 361 GGLEGPDRIFVGGLPYYF Sbjct: 61 GGLEGPDRIFVGGLPYYF 78 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29628 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2658 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3027 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12566264 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12566264 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2671 (215 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32802 321 5e-90 >Contig32802 Length = 209 Score = 321 bits (823), Expect = 5e-90, Method: Compositional matrix adjust. Identities = 147/195 (75%), Positives = 170/195 (87%) Query: 21 LNERILSSMSRRSIAAHPWHDLEIGPGAPSVFNCVVEIGKGSKVKYELDKASGLIKVDRV 80 LNERILSS+SRRS+AAHPWHDLEIGP AP +FN V+EI KGSKVKYELDK +G+IKVDR+ Sbjct: 15 LNERILSSLSRRSVAAHPWHDLEIGPSAPDIFNVVIEITKGSKVKYELDKKTGMIKVDRI 74 Query: 81 LYSSVVYPHNYGFIPRTICEDSDPMDVLILMQEPVLPGSFLRARAIGLMPMIDQGEKDDK 140 LYSSVVYPHNYGFIPRT+CED+DP+DVL+LMQEPVLPG FLRARAIG+MPMIDQGEKDDK Sbjct: 75 LYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGVMPMIDQGEKDDK 134 Query: 141 IIAVCADDPEFRHYKDIKEIPPHRLAEIRRFFEDYXXXXXXXXXXXDFLPADSAIEAIKY 200 IIAVCADDPE+ HY + ++PPHRL+EIRRFFEDY FLPA +A+EAI+Y Sbjct: 135 IIAVCADDPEYTHYTALDDLPPHRLSEIRRFFEDYKKNENKEVAVNAFLPASTALEAIQY 194 Query: 201 SMDLYASYIVESLRQ 215 SMDLYA YI+ +LR+ Sbjct: 195 SMDLYAEYIMHTLRR 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20031 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 205 6e-55 >Contig7384 Length = 326 Score = 205 bits (522), Expect = 6e-55, Method: Compositional matrix adjust. Identities = 121/284 (42%), Positives = 165/284 (58%), Gaps = 7/284 (2%) Query: 3 KAVARE----VRMAASIMRLHFHDCFVKGCDAXXXXXXXXXXXXEKNSVPNRNSA-RGFE 57 +AV+R+ + A+ +RL HDCFV+GCDA EKN N + A GF+ Sbjct: 44 QAVSRKRDQTIITLAATLRLFLHDCFVEGCDASIIIASPNGDA-EKNFADNLSLAGDGFD 102 Query: 58 VIDDIKSAVEKECPHTVSCSDILAIAARDSSVLTGGPSWEVPLGRRDSRGASLSGSNNNI 117 + K AVE +CP VSC+DILA+AARD VL GGPS+ V LGRRD + S N+ Sbjct: 103 TVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAGGPSFPVELGRRDGLISKASRVAGNL 162 Query: 118 PAPNNTFQTILTKFKLHGLNIVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGRPDYSLDQ 177 P P + T F H L++ D++ALSG+HT+G S C F RLYN S + D SL+ Sbjct: 163 PEPTFNLNQLTTMFAKHNLSLTDVIALSGAHTLGFSHCNRFSDRLYNFSPSSTVDPSLNP 222 Query: 178 SYAAQLRARCPRSGGDQNLFFLDFVSPTKFDNSYFKNILASKGLLSSDQLLFTKNQASMD 237 YA QL A CP + + LD +P FDN+Y++N++A KGLLSSDQ+LF+ + AS Sbjct: 223 DYAKQLMATCPIAVDPNIVMTLDPDTPFTFDNAYYRNLVAGKGLLSSDQVLFS-DSASRS 281 Query: 238 LVKQYAANNKIFFEQFAQSMIKMANISPLTGSRGEIRKNCRRVN 281 V +A N F F +M K+ + TG++GEIR++C N Sbjct: 282 TVLNFANNADNFNGAFVTAMRKLGRVGVKTGNQGEIRRDCTTFN 325 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12740 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8651 123 3e-30 >Contig8651 Length = 243 Score = 123 bits (308), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 79/216 (36%), Positives = 125/216 (57%), Gaps = 26/216 (12%) Query: 1 MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYTSP 60 +GRGKIEIKRIEN TNRQVT+ KRRNG+ KKA EL+VLCDA+V+LI+FSN G+ +EY + Sbjct: 17 LGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYANN 76 Query: 61 TITTKKVYDQYQK-------TLGIDLWSSHYERMQENLRKLKEINNKLRREIRQRMGEDL 113 ++ K ++Y+K T + S+ Y Q+ KL+ KL+ + R MG+ L Sbjct: 77 SV--KGTIERYKKASADSSNTGSVSEASTQY--YQQEAAKLRAQIVKLQNDNRNMMGDAL 132 Query: 114 GDLSIEDLRGLEQKMDASLGLVRERKYHVIKTQTETYRKKVRNLEEQHGNLLLNFEAKCD 173 +S++DL+ LE K++ ++ +R +K ++ + E +K R L+ + N LL + Sbjct: 133 SSMSVKDLKSLENKLEKAISRIRSKKNELLFAEIEYMQK--RELDLHNNNQLLRAK---- 186 Query: 174 DPHYGLVENDGDYESAVAFANGASNLYAFRLHQAHP 209 + EN+ ++ A G S + + Q+ P Sbjct: 187 -----IAENERGQQNINVMAGGGS----YEILQSQP 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48899 (338 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8623 198 1e-52 >Contig8623 Length = 321 Score = 198 bits (503), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 136/337 (40%), Positives = 171/337 (50%), Gaps = 20/337 (5%) Query: 3 CVE-KALKSSVVRPELAFKLTQQPACLDDMCMGNGQSGVSGDDFSIDDLLDFTNGGIGEG 61 C+E KALKSS+ R ELA K TQ L+++ G SGV +DFS+DDLLD +NG +G Sbjct: 4 CIEAKALKSSLRR-ELAVKSTQH-VLLEELWCATGISGVPCEDFSVDDLLDLSNGEFEDG 61 Query: 62 LFQXXXXXXXXKGCGSLSPRRELTENDNSNLTTTTFSVKDEFPSVPATELTVPADDLADL 121 + +++ SN ++ D S AT+L VP DDLA+L Sbjct: 62 SVEEEEEEKESVS----------VDDEISNSSSLVLPDSD---SGLATQLLVPDDDLAEL 108 Query: 122 EWLSHFVEDSFSEYSAPFPHGTLTEKAXXXXXXXXXXXXXLQIKSCLKTPFPAKARSKRA 181 EW+SHFV+DS + S GT +A P K R+KR Sbjct: 109 EWVSHFVDDSLPDLSLFHTIGTQKPEALLMNRFEPEPKPVPLRAPLFPFQVPVKPRTKRY 168 Query: 182 RTGGRVWSMGXXXXXXXXXXXXXXXXXXXXXXWLIYPNTCQNVESFHSAVKPPAKKHKKR 241 + RVWS LI+ N Q+++ F +K K Sbjct: 169 KPASRVWSSSSSCSPSSSPCSSGFSFSTPC---LIF-NPVQSMDVFVGEPAAKKQKKKPA 224 Query: 242 LDPEASGSAQPTPHRCSHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRLLPEYRPACSP 301 + RCSHC VQKTPQWRTGPLG KTLCNACGVR+KSGRL PEYRPACSP Sbjct: 225 VQTGEGSIGGQFQRRCSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGRLFPEYRPACSP 284 Query: 302 TFSSEIHSNHHRKVLEMRRKKEVTRPESGLAPAVPSF 338 TFS +HSN HRKVLEMR++K+V PE L + SF Sbjct: 285 TFSGAVHSNSHRKVLEMRKRKDVGEPEPLLNRMIRSF 321 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65444 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25706 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2264 158 4e-41 >Contig2264 Length = 143 Score = 158 bits (399), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 75/96 (78%), Positives = 86/96 (89%) Query: 43 DPNKPKRPASAFFVFMEEFRKQYKEKHPANKSVSVVGKAGGDKWKSLSEAEKAPYVAKAE 102 DPNKPKRPASAFFVFME+FR ++K+ HP NKSV+ VGKAGGDKWKSLSEAEKAPY+AKAE Sbjct: 30 DPNKPKRPASAFFVFMEDFRVKFKKDHPNNKSVAAVGKAGGDKWKSLSEAEKAPYIAKAE 89 Query: 103 KRKTEYNKSMQAYNKRMAEGPTAAEEEESDKSRSEV 138 KRK EY K+M AYNKR+AEG A++EESDKS+SEV Sbjct: 90 KRKAEYTKTMNAYNKRIAEGGNGADDEESDKSKSEV 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20578 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24121 154 2e-39 >Contig24121 Length = 439 Score = 154 bits (388), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 94/268 (35%), Positives = 143/268 (53%), Gaps = 13/268 (4%) Query: 7 IGEYTVRSKVGQGPQSTVWKAEQKCSGEVVALKQVYLSK-LNRNLKTSLDCEINFLSSVS 65 +G+Y + +G+G + V A +GE VALK + K L + + EI + + Sbjct: 10 VGKYEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKLIK 69 Query: 66 HPNIIRLLHVFQAEGCIFLVLEFCSGGDLESYIRHHGRVQEWVARRFMQQLGAGLEVLHS 125 HPN+++L V ++ IF+V+EF +GG+L I ++GR++E ARR+ QQL ++ HS Sbjct: 70 HPNVVQLYEVMGSKTKIFIVMEFVTGGELFDKIVNNGRMKEDEARRYFQQLINAVDYCHS 129 Query: 126 HHIIHRDLKPGNILLSGPESDVLLKIADFG---LSRTVHPGEHAETVCGTPLYMAPEVLR 182 + HRDLKP N+LL + LK++DFG LS+ V T CGTP Y+APEVL Sbjct: 130 RGVYHRDLKPENLLLDAYGN---LKVSDFGLSALSQQVRDDGLLHTTCGTPNYVAPEVLN 186 Query: 183 FKKYD-EKVDMWSLGAILFELLNGYPPFRGRTNVQLLQNIESCKMLPFSQLISPGLHPDC 241 + YD D+WS G ILF LL GY PF + L + I + + P L Sbjct: 187 DRGYDGATADLWSCGVILFVLLAGYLPFDDSNLMNLYKKISAAEF-----TCPPWLSFGA 241 Query: 242 VDLCTKLLSTNPVHRLSFDEFCRHRFLR 269 + L ++L NP+ R++ E + + Sbjct: 242 MKLIARILDPNPMTRVTIAEILEDEWFK 269 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32486 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9420 207 4e-56 >Contig9420 Length = 377 Score = 207 bits (528), Expect = 4e-56, Method: Compositional matrix adjust. Identities = 97/134 (72%), Positives = 110/134 (82%) Query: 1 MCFIYFTLYGMMIVALTPNHQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWASPV 60 MCF YF++YGMM+VALTP HQIAAIVMSFFLSFWNLFSGFLIPR IPIWWRWYYW SPV Sbjct: 244 MCFTYFSMYGMMVVALTPGHQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPV 303 Query: 61 AWTIYGLVTSQVGDKEDPVQVPGADDMSVKQYLKEALGFEYDFLRAVALAHIGWVLLFLF 120 AWTIYG+ TSQVGD + + +P + +LK LGF+YDFL V +AH+GWVLLF F Sbjct: 304 AWTIYGIFTSQVGDMKTNIDIPIQGPQKIDVFLKNYLGFDYDFLIPVVIAHLGWVLLFFF 363 Query: 121 VFAYGIKFLNFQRR 134 VFAYGIK+LNFQRR Sbjct: 364 VFAYGIKYLNFQRR 377 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3936 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10935 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11260 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41392 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26170 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20450 74 1e-15 >Contig20450 Length = 148 Score = 74.3 bits (181), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 2/100 (2%) Query: 19 IACNRLQKELVEWQVNPPAGFKH-KVTDNLQRWVIEVHGAPGTLYANESYQLQVDFPEHY 77 +A R+ KEL + Q +PP V +++ W + G P + YA + + + FP Y Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 78 PMEAPQVIFLQPAPLHPHIYSNGHICLDILYDSWSPAMTV 117 P + P+V F HP+I SNG ICLDIL + WSPA+T+ Sbjct: 61 PFKPPKVAFRTKV-FHPNINSNGSICLDILKEQWSPALTI 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28666260 (429 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45040 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33528 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25085 79 1e-16 >Contig25085 Length = 138 Score = 78.6 bits (192), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 8/110 (7%) Query: 49 AVFDSLVLTASKILHKEANCVRIDPSPLDSTVVVVGDVHGQLHDVIFLLRDSGFP-SQNR 107 A L + A +I + N + + + V + GD+HGQ D++ + G+P S N Sbjct: 36 AEIRQLCVNARQIFLSQPNLLEVR-----APVRICGDIHGQYQDLLRVFEYGGYPPSAN- 89 Query: 108 FYVFNGDYVDRGAWGLETFLLLLAWKVFMPDRVFLLRGNHESKYCTSVYG 157 Y+F GDYVDRG LET LLLA+K+ P+++FLLRGN E +YG Sbjct: 90 -YLFLGDYVDRGKQSLETICLLLAYKIRYPNKIFLLRGNPEKAKNNRIYG 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47329 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11764 (416 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16928 (333 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64799 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33207 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48486593 146 3e-37 >48486593 Length = 78 Score = 146 bits (368), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 68/77 (88%), Positives = 75/77 (97%) Query: 108 CARNEYCESAIDFIARRSRLAFLDTDAASRALPRIIEILATEHNWDRTRKKKELQKAKEF 167 CARNEYCESAIDFIARRSRLAFLDTDAASRALPR+IEILATEHNWD +R+K EL+KAKEF Sbjct: 1 CARNEYCESAIDFIARRSRLAFLDTDAASRALPRVIEILATEHNWDDSRQKYELEKAKEF 60 Query: 168 LETFKSSRNAQFYDGKH 184 L+TFKSS+NAQF+DGKH Sbjct: 61 LKTFKSSKNAQFHDGKH 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23881 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32030 169 9e-45 >Contig32030 Length = 169 Score = 169 bits (428), Expect = 9e-45, Method: Compositional matrix adjust. Identities = 75/84 (89%), Positives = 84/84 (100%) Query: 1 MKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALIAWVG 60 MKKGQIVRV+K+KYLNS+NYLSVGHPPYYKGLDYIYEDRGE+LDLRIFETGEYAL+AWVG Sbjct: 86 MKKGQIVRVEKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEILDLRIFETGEYALVAWVG 145 Query: 61 IPTAPAWLPTDMLIKSDKLNYERM 84 +PTAPAWLPTDMLI+SDKL+YER+ Sbjct: 146 VPTAPAWLPTDMLIRSDKLDYERL 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13066259 (368 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39142 (325 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9171 140 3e-35 >Contig9171 Length = 496 Score = 140 bits (353), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 95/313 (30%), Positives = 147/313 (46%), Gaps = 10/313 (3%) Query: 5 KVGPALACGCTVVIKPSXXXXXXXXXXXXXXXQAGIPPGAVNVVFGNAPEIGDALLASRQ 64 K+ PAL G +V+KP AG P G ++ V G EIGD L Sbjct: 178 KIAPALIAGNALVLKPPTQGAVSCLHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPG 237 Query: 65 VRKITFTG-STAVGKKLMAGAAQTVKKVSLELGGNAPCIIFDDADLEVAVKGALGTKFRN 123 V I+FTG T + AG + + +ELGG CI+ +DADL++ + F Sbjct: 238 VNCISFTGGDTGIAISKKAG----MIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSY 293 Query: 124 SGQTCVCANRILVQEGIYEKFAIAFSQAVQSMQVGEGFTEGVVQGPLINEAAVQKVESFV 183 SGQ C +LV E + + + V + VG + P+++E++ +E V Sbjct: 294 SGQRCTAVKVVLVMESVADALVAKVNARVAKLTVGPPEDNSDIT-PVVSESSANFIEGLV 352 Query: 184 KDAVSKGAKVLLGGKRHSLGMTFYEPTVIGDIKNDMLIARNEVFGPVAPLLRFKTEEEAI 243 DA KGA KR P ++ +++ DM IA E FGPV P++R T EE I Sbjct: 353 VDAKQKGATFCQEYKRDG---NLIWPLLLDNVRPDMRIAWEEPFGPVLPVIRITTVEEGI 409 Query: 244 RIANDTAAGLAAYVFTENVQRMWRVTEALEYGLVGVNEGLVS-TEVAPFGGVKESGLGRE 302 N + GL VFT+++ + + +A+E G V +N + PF G+K+SG+G + Sbjct: 410 HHCNASNFGLQGCVFTKDINKAMLIGDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 469 Query: 303 GSKYGMDEFLEMK 315 G ++ ++K Sbjct: 470 GITNSINMMTKIK 482 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53456 (69 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23765 (328 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31917 65 2e-12 >Contig31917 Length = 245 Score = 65.1 bits (157), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 31/78 (39%), Positives = 50/78 (64%) Query: 9 FPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYDITLQRGAKTMSSLHLK 68 P ARIKKIM+ADEDV I+ PV+ ++A E+F+ +L R+++ T + +T+ + Sbjct: 95 LPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTMRSWNHTEENKRRTLQKNDIA 154 Query: 69 HCVQRHNVFDFLRDIVSK 86 + R ++FDFL DIV + Sbjct: 155 AAITRTDIFDFLVDIVPR 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48468 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30658 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12319 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50615 (63 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11666259 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29860 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36397 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10738 276 2e-76 >Contig10738 Length = 362 Score = 276 bits (707), Expect = 2e-76, Method: Compositional matrix adjust. Identities = 128/199 (64%), Positives = 145/199 (72%) Query: 20 EEEHPVKAFGWAARDNSGHLSPFNFSRRSTGEEDVRLKVLYCGICHTDLHNSKNEWGSAS 79 E+EHPVKAFGWAARD SGHLSPFNFSRRSTG+EDVR KVLYCGICHTDLHN KNEWG + Sbjct: 6 EQEHPVKAFGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNEWGISL 65 Query: 80 YPLVPGHXXXXXXXXXXXXXXXXXXXXXXXXXSLVGACHSCDDCSHDLENYCPKLILTYG 139 YP+VPGH +VGACH+C+ C+ +LENYCPK+ILTYG Sbjct: 66 YPMVPGHEIVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKMILTYG 125 Query: 140 SLYHDGTMTYGGYSDTMVANERYVIRIPDNMPLDKGAPLLCAGITVYSPLKYYGLNEPXX 199 S+Y D T+TYGGYSDTMVANERY++R P+N+PLD GAPLLCAGITVYSPLKY+GL EP Sbjct: 126 SIYADRTVTYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGLAEPGK 185 Query: 200 XXXXXXXXXXXXXAVKFAK 218 VKFAK Sbjct: 186 HVGIVGLGGLGHVGVKFAK 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26066265 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48684 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26935 102 4e-24 >Contig26935 Length = 201 Score = 102 bits (255), Expect = 4e-24, Method: Compositional matrix adjust. Identities = 66/199 (33%), Positives = 102/199 (51%), Gaps = 7/199 (3%) Query: 7 ESYRFYFSRRTLFQMLSDRGYNVPHSELTRSLSDFRASFGQNPDPSRLRICLPLISSPSK 66 E R Y R+T+ QML DR Y V E+ S F+ +G+N L I + + Sbjct: 7 EITRLYRVRKTVMQMLKDRNYLVGDFEINMSKEQFKDKYGENMKREDLIINKTKRTDTND 66 Query: 67 KILVVFCGTDEIRKAVIRVIFQQINREGLHRLILVLQSKMNSHARKVVDEYPIK--VELF 124 +I V F ++ ++ ++ E + R ILV Q + A+ + E K +E+F Sbjct: 67 QIYVFFPDEPKVGVKTMKTYTNRMKSENVFRAILVTQQSLTPFAKTCISEISGKFHLEVF 126 Query: 125 LITELLINITKHVSVPKHEILSAQEKRKLVNKYKLEDKQFPIMQKDDAIARYYGLEKGQV 184 L ELL+NI +HV VP+H +L+ +EK+ L+ +Y +++ Q IA+YYGL++ QV Sbjct: 127 LEAELLVNIKEHVLVPEHRVLTNEEKKTLLERYTVKETQLT-----QPIAKYYGLKRAQV 181 Query: 185 VKITYKGGMTDSLVTYRCV 203 VKI VTYR V Sbjct: 182 VKIIRPSETAGRYVTYRYV 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4817 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56098 (292 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16098 71 3e-14 >Contig16098 Length = 339 Score = 70.9 bits (172), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 45/106 (42%), Positives = 60/106 (56%), Gaps = 1/106 (0%) Query: 187 GDRVKYWTTINEPNLLAEMAYLWGRYPPAHCSA-PFGNCSSGNSDTEPLFVLHNMLLSHA 245 GDRVK WTT+NEP+ ++ + G P CS NC G+S EP H++LL+HA Sbjct: 1 GDRVKQWTTLNEPHSVSNNGFAVGSQAPGRCSYWQNRNCLGGDSAIEPYLATHHLLLAHA 60 Query: 246 QAANIYRHKYQLKQGGFIGIICNTLMCEPLRDIELDREAAKRALAF 291 A +Y+ KYQ Q G IGI NT P + + D+ AA R+L F Sbjct: 61 AAVKVYKDKYQAFQKGLIGITLNTYWFVPASETKEDKHAALRSLDF 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5168 (309 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7609 (207 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58630 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31142 (241 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28776 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8600 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11290 104 5e-25 >Contig11290 Length = 316 Score = 104 bits (260), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 53/119 (44%), Positives = 69/119 (57%), Gaps = 2/119 (1%) Query: 9 TPSLLPTWITEEELGVYADKFQESGFTGGLNYYRAMDLSWELLAPWQGSKITIPSKLXXX 68 P LP W+TEE+L KF +SGFTGGLNYYRA++L+WEL PW G +I +P K Sbjct: 198 APVTLPAWLTEEDLNYIVSKFSKSGFTGGLNYYRALNLTWELTGPWTGLQIKVPVKFIVG 257 Query: 69 XXXXXXXXXXTKEYIEGNTFKTLVPD-HEVVILDG-HHFIQEEKPQQVSAEILSFLAKF 125 + YI FK VP EVV+++G HFI +EKP +VS + F+ KF Sbjct: 258 ELDVTYNIPGVQAYIHKGGFKRDVPFLQEVVVMEGAAHFIAQEKPDEVSQHVYDFIKKF 316 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30366260 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38410 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38280 (66 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22466264 (71 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3456 (704 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16602 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3176 134 1e-33 >Contig3176 Length = 234 Score = 134 bits (336), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 72/196 (36%), Positives = 98/196 (50%), Gaps = 7/196 (3%) Query: 1 MRVRVPLQKKGLKYEYSQEDLRNKSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDE 60 MR R+ L K + YE+ QE +KS LLL+ NPVHKK+PVLIH KP+CESLIIV+YIDE Sbjct: 18 MRARIALNLKSVDYEFLQETFGSKSELLLQSNPVHKKVPVLIHGDKPVCESLIIVEYIDE 77 Query: 61 VWKDKSPLLPSDPYQRAQARFWADYVDKKLYELGGKIW-----SXXXXXXXXXXXXFIXX 115 VW +LPSDPY RA ARFWA Y+ +K Y I Sbjct: 78 VWASGPSILPSDPYDRATARFWAAYISEKWYPSMKGIGLAQGEEAKKAAIEQVTEGLALL 137 Query: 116 XXXXXXXXXXXPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSI--EAECPKLIAWTKRC 173 +FGG++IG++D+A F W E + + + P L+ W + Sbjct: 138 EEAFEKSSKGNVFFGGDEIGYLDIAFGCFLGWLRVNEKLHGIKLLDQTKTPGLVKWADKF 197 Query: 174 MEKESVSSFLEDPHKV 189 +V + + K+ Sbjct: 198 CAHAAVKDVMPETDKL 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16594 (127 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16600 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3176 149 5e-38 >Contig3176 Length = 234 Score = 149 bits (375), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 81/213 (38%), Positives = 118/213 (55%), Gaps = 8/213 (3%) Query: 1 MGD-EIILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLKNKSPLLLEMNPVHKQIPVLIH 59 MG+ ++ +L PS F MR R+AL K + YE+ +E +KS LLL+ NPVHK++PVLIH Sbjct: 1 MGESDVKVLGMAPSPFVMRARIALNLKSVDYEFLQETFGSKSELLLQSNPVHKKVPVLIH 60 Query: 60 NGKPICESLIIVQYIDEVWHDKSPLLPSDPYQRAQARFWADYVDKKLYGLGRKVWSTKGE 119 KP+CESLIIV+YIDEVW +LPSDPY RA ARFWA Y+ +K Y + + +GE Sbjct: 61 GDKPVCESLIIVEYIDEVWASGPSILPSDPYDRATARFWAAYISEKWYPSMKGIGLAQGE 120 Query: 120 EQETAKKEFIXXXXXXXXXXXXXP-----YFGGEKIGFVDVALVTFSCWFYAYESFGNFS 174 E + A E + +FGG++IG++D+A F W E Sbjct: 121 EAKKAAIEQVTEGLALLEEAFEKSSKGNVFFGGDEIGYLDIAFGCFLGWLRVNEKLHGIK 180 Query: 175 I--EAECPKLIAWTKRCKEKESVSSSLEDPHKV 205 + + + P L+ W + +V + + K+ Sbjct: 181 LLDQTKTPGLVKWADKFCAHAAVKDVMPETDKL 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32041 (333 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32071 233 2e-63 >Contig32071 Length = 299 Score = 233 bits (595), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 112/163 (68%), Positives = 125/163 (76%), Gaps = 7/163 (4%) Query: 12 LSLPPGFRFYPTDEELLVQYLCRKVAGQGFSLEIIGEIDLYKFDPWVLPSKAIFGEKEWY 71 L LPPGFRF+PTDEEL+ YLCRK A Q ++ II EIDLYKFDPW LP A++GEKEWY Sbjct: 14 LELPPGFRFHPTDEELVNHYLCRKCASQPLAVPIIREIDLYKFDPWQLPEMALYGEKEWY 73 Query: 72 FFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITTEGRKVGIKKALVFYIGKAPKGTKTN 131 FFSPRDRKYPNGSRPNR AG+GYWKATG DK I + + +GIKKALVFY GKAPKG KTN Sbjct: 74 FFSPRDRKYPNGSRPNRAAGTGYWKATGADKHI-GKPKALGIKKALVFYAGKAPKGIKTN 132 Query: 132 WIMHEYRLLENSR------KNGSSKLDDWVLCRIYKKNSNSSK 168 WIMHEYRL R KN + +LDDWVLCRIY K + K Sbjct: 133 WIMHEYRLANVDRSAAAAKKNQNLRLDDWVLCRIYNKKGSIEK 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17327 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23769 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29224 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6166264 (381 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 157 4e-40 >Contig31581 Length = 128 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGM 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 137 IQKESTLHLVLRLRGGM 153 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 213 IQKESTLHLVLRLRGGM 229 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 289 IQKESTLHLVLRLRGGM 305 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 156 bits (395), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 76/77 (98%) Query: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 365 IQKESTLHLVLRLRGGF 381 IQKESTLHLVLRLRGG Sbjct: 61 IQKESTLHLVLRLRGGI 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61962 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31581 157 2e-40 >Contig31581 Length = 128 Score = 157 bits (396), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGM 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 157 bits (396), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 137 IQKESTLHLVLRLRGGM 153 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGI 77 Score = 110 bits (274), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 54/63 (85%), Positives = 56/63 (88%) Query: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPNXQRLIFAGKQLGKGPNLADYT 212 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP+ QRLIFAGKQL G LADY Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 213 FQR 215 Q+ Sbjct: 61 IQK 63 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1532 (101 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31298 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21553 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62168 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28069 110 4e-27 >Contig28069 Length = 447 Score = 110 bits (275), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 53/84 (63%), Positives = 64/84 (76%) Query: 4 LRIKRVPTVVSNYQKEDSDDGARQVGGCGRNCLKQRCIQGAKLPLYAYKKVKDVVXEKAS 63 LRIKRVPTVVSNYQK+++++GAR+V GCGRNCL Q CI GAKLPLYA+KK + Sbjct: 3 LRIKRVPTVVSNYQKDEAEEGARRVEGCGRNCLNQCCIPGAKLPLYAFKKRNVNNGDTGV 62 Query: 64 SGDENKEQPVPFLDSLVRXEWEDR 87 G + +E PV FLDSL+ EWEDR Sbjct: 63 PGHDKREPPVAFLDSLLLGEWEDR 86 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3966261 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9954 80 3e-17 >Contig9954 Length = 252 Score = 80.1 bits (196), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 39/61 (63%), Positives = 45/61 (73%) Query: 26 VKDMRYRGVRKRPWGRFAAEIRDPWKKTRVWLGTFDSPEEXXXXXXXXXXTLRGPKAKTN 85 VK++ +RGVRKRPWGR+AAEIRDP KK+RVWLGTFD+ EE RG KAKTN Sbjct: 20 VKEVHFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTAEEAARAYDAAAIEFRGAKAKTN 79 Query: 86 F 86 F Sbjct: 80 F 80 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34911 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32166256 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33366264 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22466260 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12028 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31982 59 2e-11 >Contig31982 Length = 239 Score = 58.9 bits (141), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 3/78 (3%) Query: 1 RVSHLSLSLSPFSRKILSLEFMSDNGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKRTG 60 + S+ S +P ++ + + G +PKFGEWD NDPASA+GFT IFNK R+EK G Sbjct: 148 KASYESSHGTPARSRLKPRDESPEKGAAVPKFGEWDENDPASADGFTHIFNKVREEK-AG 206 Query: 61 GQPESPAN--VENNVKQG 76 P +P++ ++ KQG Sbjct: 207 KAPGTPSHPSYQDARKQG 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26023 (341 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8291 600 e-173 >Contig8291 Length = 342 Score = 600 bits (1546), Expect = e-173, Method: Compositional matrix adjust. Identities = 283/342 (82%), Positives = 315/342 (92%), Gaps = 1/342 (0%) Query: 1 MSETKSKFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVVDSYKL 60 M++ KSKFL+VYSVLKSELL DPAF+FT+DSR+WVERMLDYNVPGGKLNRGLSV+DSY+L Sbjct: 1 MADLKSKFLKVYSVLKSELLEDPAFDFTNDSRRWVERMLDYNVPGGKLNRGLSVIDSYQL 60 Query: 61 LQ-GRQLTDDEVFLACVLGWCIEWLQAYFLVLDDIMDNSHTRRGQPCWFRVPKVGMIAAN 119 LQ GR+LT+DE+FLA LGWCIEWLQA+FLV DD+MD SHTRRGQPCWFR+PKVGMIA N Sbjct: 61 LQQGRELTEDEIFLASALGWCIEWLQAFFLVHDDLMDGSHTRRGQPCWFRLPKVGMIAVN 120 Query: 120 DGVILRNQIPRILKNHFKGKPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSL 179 DGV+LRN IPRIL+ HF+ KPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSL Sbjct: 121 DGVVLRNHIPRILRKHFREKPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSL 180 Query: 180 PLHRRIVQYKTAYYSFYLPVACALLIAGENLDNHTSVKDILVQMGIYFQVQDDYLDCFGD 239 +HRRIVQYKTAYYSFYL VACALL++GE L+ H VK+ILV+MGIYFQVQDDYLDCFGD Sbjct: 181 SIHRRIVQYKTAYYSFYLSVACALLMSGEELEKHIDVKNILVEMGIYFQVQDDYLDCFGD 240 Query: 240 PQVIGKIGTDIEDFKCSWLVVKALEICNEEQKKTLYGNYGKADPANVAKVKALYKDLDLQ 299 P+ IGKIGTDIEDFKCSWLVVKALE+CNEEQKK L+ NYGK DP NVAKVKALYK+LD++ Sbjct: 241 PETIGKIGTDIEDFKCSWLVVKALELCNEEQKKVLHENYGKPDPENVAKVKALYKELDIE 300 Query: 300 GVFLEYESKSYETLVSSIEAHPSKAVQAVLKSFLGKIYKRQK 341 GVF +YESKS++ L S IE HPSKAVQAVLKSFLGKIYKRQK Sbjct: 301 GVFADYESKSHKKLTSWIEGHPSKAVQAVLKSFLGKIYKRQK 342 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13283 (420 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18341 147 5e-37 >Contig18341 Length = 266 Score = 147 bits (370), Expect = 5e-37, Method: Compositional matrix adjust. Identities = 86/138 (62%), Positives = 89/138 (64%), Gaps = 8/138 (5%) Query: 135 MDRTVNLPKGYGYVEFKTRSDAEKAQLYMDGAQIDGNVVRAKFTLPQRQKISSPPKAVAT 194 MDRTVNLPKG+GYVEFK R+DAEKAQLYMDGAQIDGNVVRAKFTLPQRQK+SSPPK VAT Sbjct: 1 MDRTVNLPKGFGYVEFKIRADAEKAQLYMDGAQIDGNVVRAKFTLPQRQKVSSPPKPVAT 60 Query: 195 ASKRDGPKTDNVGADVEKDGPKRQREAXXXXXXXXXXXXXXXXXXXXXXXXXXQLDSPQR 254 A KRD KTD V AD KD PKR REA LDSP R Sbjct: 61 APKRDTVKTDGVSAD--KDAPKRPREASPRRRGALSPRRRSPVSRRGESLRRA-LDSPPR 117 Query: 255 RRGESPIRRRVESPYRRG 272 R SP R PY RG Sbjct: 118 RHAASPAR-----PYCRG 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47614 (135 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26880 213 9e-58 >Contig26880 Length = 135 Score = 213 bits (543), Expect = 9e-58, Method: Compositional matrix adjust. Identities = 103/135 (76%), Positives = 114/135 (84%) Query: 1 MVKFLKPNKAVVLLQGRFAGRKAVIVRSFDDGTRDRPYGHCLVAGIAKYPKKVIRKDSAK 60 MVKFLKPNKAV+ LQGR+AGRKAVIVR+FD+GTRDRPYGHCLVAGI KYP KVIRKDSAK Sbjct: 1 MVKFLKPNKAVINLQGRYAGRKAVIVRAFDEGTRDRPYGHCLVAGIKKYPSKVIRKDSAK 60 Query: 61 KTAKKSRVKAFIKLVNYNHIMPTRYTLDVDLKDVVSPDVLQSRDXXXXXXXXXXXXXXXR 120 KTAKKSRVKAF+KLVNY H+MPTRYTLDVDLKDVV+ + LQ++D R Sbjct: 61 KTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDVVNVESLQTKDKKVTALKEVKKRFEER 120 Query: 121 FKTGKNRWFFSKLRF 135 FKTGKNRWFF+KLRF Sbjct: 121 FKTGKNRWFFTKLRF 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3994 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49951 (135 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2632 (397 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41386 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8266259 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9034 62 6e-12 >Contig9034 Length = 386 Score = 62.0 bits (149), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 33/60 (55%) Query: 5 QQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETXXXXXXXXXXXXXLMCGPRARTNFP 64 + +YRG+RQR WG W +EIR P R+WLGTF T + G +A+ NFP Sbjct: 111 KNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFP 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26753 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9025 179 3e-47 >Contig9025 Length = 213 Score = 179 bits (454), Expect = 3e-47, Method: Compositional matrix adjust. Identities = 94/209 (44%), Positives = 130/209 (62%), Gaps = 1/209 (0%) Query: 3 MKVYGPVRAACPQRVLACLVEKGVEFEVVHVDLDSGEQKRPDFLLRQPFGQVPVVEDGDF 62 +KV+G V + C +RV+A L EK ++FE+V +DL +GE K+ F+ PFG+VP EDGD Sbjct: 4 VKVHGNVLSVCTRRVIAALYEKDIKFELVPIDLGTGEHKKEPFISLNPFGEVPAFEDGDL 63 Query: 63 RLFESRAIVRYIAAKYAEQGPDLLGKSLEEKAVVDQWLEVEAHNFNELVYTLVMQLVILP 122 +LFESRAI +YI +YA++G L+ + ++ A++ EVE F+ L + VI P Sbjct: 64 KLFESRAITQYIVHEYADKGTPLVFQDSKKMAMIAVGCEVEGQKFDPAASKLTFEQVIKP 123 Query: 123 RMGERGDLALAHTCEQKLEKVFDVYEQRLSKSRYLAGDSFTLADLSHLPAIRYLVKEAGM 182 + D A+ E KL V DVYE RL++S+YLAG+ FTLADL H+P I YL+ Sbjct: 124 MLKMPTDAAVVEEYEAKLAVVLDVYEIRLAQSKYLAGERFTLADLHHIPTIHYLMGTQS- 182 Query: 183 AHLVTERKSVSAWWEDISNRAAWKKVMEL 211 L R VSAW DI+ R AWKKV+ L Sbjct: 183 KKLFVSRPHVSAWVADITARPAWKKVIAL 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1046 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35992 (146 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42224 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11566260 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15008 282 4e-78 >Contig15008 Length = 219 Score = 282 bits (721), Expect = 4e-78, Method: Compositional matrix adjust. Identities = 147/221 (66%), Positives = 166/221 (75%), Gaps = 2/221 (0%) Query: 1 MATASPMASQLKSSFTSPTTSRALPVASPKGXXXXXXXXXXXXXXXXXXXIKAIQSEKPT 60 MA+ASPMASQLKS+FTSP T+R + SPKG IKA+QS+K Sbjct: 1 MASASPMASQLKSNFTSPITTRPA-LLSPKGLSASPLKLFPSKRLSSFS-IKAVQSDKQN 58 Query: 61 YQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPVLRGIEVGLAHGFLLVGP 120 +QVIQPINGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVSP+LRGIEVGLAHGFLLVGP Sbjct: 59 FQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGP 118 Query: 121 FVKTGPLRDTXXXXXXXXXXXXXXXXXLSICLTMYGIASFKEGEPSIAPSLTLTGRTKEP 180 FVKTGPLR+T L++CLT+YGI+SFKEGEPS AP+LTLTGR KEP Sbjct: 119 FVKTGPLRNTPYAGGAGSLAAAGLVVILTLCLTIYGISSFKEGEPSSAPALTLTGRKKEP 178 Query: 181 DQLQSADGWAKXXXXXXXXXISGVTWAYFLLYVLNLPYFVK 221 DQLQ+A+GW+K ISGVTWAYFLLYV+NLPYF K Sbjct: 179 DQLQTAEGWSKFTGGFFFGGISGVTWAYFLLYVVNLPYFFK 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51555 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5235 302 2e-84 >Contig5235 Length = 166 Score = 302 bits (773), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 150/166 (90%), Positives = 154/166 (92%) Query: 1 MALVTTAEVCDANPQLIVSGELRALQPVFQIYGRRPVFSGPIVTLKVFEDNVLIREFLEE 60 MALVTTAEVCDA+ QLI SG+LR L+P FQIYGRR VFSG IVTLKVFEDNVL+R FLEE Sbjct: 1 MALVTTAEVCDAHSQLIGSGDLRVLEPAFQIYGRRQVFSGQIVTLKVFEDNVLVRGFLEE 60 Query: 61 KGNGRVLVVDGGGSMRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALNS 120 KGNGRVLVVDGGGS RCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRAL S Sbjct: 61 KGNGRVLVVDGGGSKRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALAS 120 Query: 121 HPMKANKKGIGEKHVPIAIAGTRISDGEWLYADTDGILISRTELSV 166 HPMKANKKGIGEK VPI IAGTRI DGEWLYADTDGILISRTELSV Sbjct: 121 HPMKANKKGIGEKQVPITIAGTRICDGEWLYADTDGILISRTELSV 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15866261 (471 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30962 (92 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55987 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44108 (255 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12883 (435 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35768 (529 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24758 84 6e-18 >Contig24758 Length = 354 Score = 84.0 bits (206), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 83/266 (31%), Positives = 123/266 (46%), Gaps = 33/266 (12%) Query: 78 KDEDLAFVAGATGRVGSRTVRELLKLGFRVRAGVRTAQKAEALIQSVKQMKLDVESASEG 137 KD FVAGATG+ G R + LL+ GF VRAGV A+ L + + K+ S Sbjct: 100 KDPGTVFVAGATGQAGVRIAQTLLREGFSVRAGVPELGAAQELARVASKYKIISNEES-- 157 Query: 138 TQPVEKLEIVECDLEKRDQIGPALGNASVVICCIGASEKEVFDITGP-YRIDYMATKNLI 196 ++L VE + + I A+GNAS V+ IG +E GP + +I Sbjct: 158 ----KRLNAVESVFQDAESIAKAIGNASKVVVTIGPAEN------GPTTEVTPFDALQVI 207 Query: 197 DAATVAKVNHFILL---TSLG--TNKV--GFPAAILNLFWGV-LIWKRKAEEALFASGLP 248 AA +A V H ++ S+G TN V G + NLF L+ + + + + Sbjct: 208 QAAQLAGVGHVAIIYDGNSVGSSTNNVLDGISSFFNNLFSQTQLLTVAEFLQKVIEMDVS 267 Query: 249 YTIVRPGGME--RPTDAYKETHNITLSQEDTLFGG----QVSNLQVAELIAFMAKNRVSS 302 YT ++ E P +Y NI +S E GG +V+ Q+A L+A + N + Sbjct: 268 YTFIKTSLTEDFSPESSY----NIVMSAEGG--GGANDYKVAKSQIAALVADVFSNTSMA 321 Query: 303 YCKVVEVIAETTAPLTPFGELLAKIP 328 KVVEV + +AP+ P +L IP Sbjct: 322 ENKVVEVYTDPSAPMRPVDQLFGTIP 347 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3449 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9656 161 6e-42 >Contig9656 Length = 171 Score = 161 bits (407), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 77/85 (90%), Positives = 84/85 (98%) Query: 1 MASAEIEYRCFVGGLAWATDDQSLERAFSQFGEILESKIINDRETGRSRGFGFVTFSSEQ 60 MASAEIE+RCFVGGLAWATD+++LERAFSQ+GEI+ESKIINDRETGRSRGFGFVTF SEQ Sbjct: 1 MASAEIEFRCFVGGLAWATDNEALERAFSQYGEIIESKIINDRETGRSRGFGFVTFGSEQ 60 Query: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 +MRDAIEGMNGQNLDGRNITVNEAQ Sbjct: 61 AMRDAIEGMNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5103 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55060 (75 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4026 (401 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19941 74 4e-15 >Contig19941 Length = 329 Score = 73.9 bits (180), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 40/78 (51%), Positives = 47/78 (60%), Gaps = 1/78 (1%) Query: 245 GPQPPQQQTARKQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSH 304 GP+P K R W+ ELH FV A+ LGGS+ ATPK I LM+V+GLT VKSH Sbjct: 88 GPEPLSSAPPTKARMRWTQELHEAFVEAVDHLGGSERATPKGILNLMKVEGLTIYHVKSH 147 Query: 305 LQKYRLHTRRMPTTSAAP 322 LQKYR R P +S P Sbjct: 148 LQKYRT-ARYKPESSEGP 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15886 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11110 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3966262 (146 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9932 (171 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24889 158 5e-41 >Contig24889 Length = 300 Score = 158 bits (400), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 77/124 (62%), Positives = 90/124 (72%) Query: 1 MRWSGVRIDDWWRNEQFWVIGGVSAHLFAVFQGLLKVLAGIDTDFTVTSKAGDDEDFSEL 60 M+W V I DWWRNEQFWVIGG S+H FA+ QGLLKVL G++T+FTVTSKA DD +FS+L Sbjct: 177 MQWGHVGIHDWWRNEQFWVIGGASSHFFALIQGLLKVLGGVNTNFTVTSKAADDGEFSDL 236 Query: 61 YAFKWXXXXXXXXXXXXXXXXGVVAGVSNAINNGYESWGPLFGKLFFAFWVIVHLYPFLK 120 Y FKW GVV GVS+AINNGY++WGP FG LF A WVI+HLYP K Sbjct: 237 YLFKWTSLLIPPMSLLIINIIGVVLGVSDAINNGYQTWGPPFGTLFPATWVILHLYPSPK 296 Query: 121 GLLG 124 GL+G Sbjct: 297 GLVG 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38163 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25034 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17321 (233 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16732 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6285 323 1e-90 >Contig6285 Length = 393 Score = 323 bits (828), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 158/174 (90%), Positives = 160/174 (91%) Query: 1 PVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPT 60 PVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY KDPT Sbjct: 217 PVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPT 276 Query: 61 KVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKI 120 KVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKI Sbjct: 277 KVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKI 336 Query: 121 VKENFDFRPGMIAINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 174 VKE FDFRPGMI+INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+K Sbjct: 337 VKETFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDK 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52514 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16735 (391 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6285 752 0.0 >Contig6285 Length = 393 Score = 752 bits (1941), Expect = 0.0, Method: Compositional matrix adjust. Identities = 361/390 (92%), Positives = 372/390 (95%) Query: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTK 60 METFLFTSESVNEGHPDKLCDQISDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTK Sbjct: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLTQDPDSKVACETCTKTNMVMVFGEITTK 60 Query: 61 ADIDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA 120 A++DYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGH +KRPEEIGA Sbjct: 61 ANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFSKRPEEIGA 120 Query: 121 GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCSWLRPDGKTQVTVEYHNEN 180 GDQGHMFGYATDETPELMPL+HVLATKLGA+LTEVRKNGTC+WLRPDGKTQVT+EY N+ Sbjct: 121 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTIEYFNDK 180 Query: 181 GAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 GAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI Sbjct: 181 GAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 Query: 241 GGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 GGPHGDAGLTGRKIIIDTY KDPTKVDRSGAYIVRQAAKSIVANGLAR Sbjct: 241 GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 Query: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNG 360 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKE FDFRPGMI+INLDLKRGGNG Sbjct: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKETFDFRPGMISINLDLKRGGNG 360 Query: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390 RFLKTAAYGHFGRDDPDFTWEVVKPLKW+K Sbjct: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWDK 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39734 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53432 (272 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8371 165 8e-43 >Contig8371 Length = 374 Score = 165 bits (417), Expect = 8e-43, Method: Compositional matrix adjust. Identities = 73/114 (64%), Positives = 83/114 (72%) Query: 3 RAPCCEKMGLKKGPWTPEEDQILVNYIHLYGHGNWRALPKQAGLLRCGKSCRLRWTNYLR 62 + PCC K+GLK+GPWTPEED++L NYI G G WR LPKQAGLLRCGKSCRLRW NYLR Sbjct: 35 KTPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKQAGLLRCGKSCRLRWMNYLR 94 Query: 63 PDIKRGNFTSXXXXXXXXXXXRLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRL 116 P +KRG LGNRWS IA ++PGRTDNEIKN W+THL K+L Sbjct: 95 PSVKRGQIAPDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLSKKL 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33417 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2739 (256 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53911 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29068 (340 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv766258 (399 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31509 682 0.0 >Contig31509 Length = 399 Score = 682 bits (1761), Expect = 0.0, Method: Compositional matrix adjust. Identities = 334/399 (83%), Positives = 365/399 (91%) Query: 1 MQALSRRLGHQSFNQSPAISSLKSIYPLSDHYYGADHPRLGSTLAPKGVGHLVRKGTGGR 60 MQA S+R+G Q QS +ISSLKSIYPLSDHYYGAD P+ GSTLA KGVGHLVRKGTGGR Sbjct: 1 MQAASKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTLATKGVGHLVRKGTGGR 60 Query: 61 SSVSGIVAVVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKY 120 SSVSGIVA VFG+TGFLGRY+VQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKY Sbjct: 61 SSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKY 120 Query: 121 NPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHHMAEQLAMISKEHGGIMRFIQV 180 NPRDE+SIKAVM+KANVV+NLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQV Sbjct: 121 NPRDEDSIKAVMSKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQV 180 Query: 181 SCLGASPSSPSRMLMAKAAAEEAVLRELPEATIMRPAVMIGTEDRILNRWAQFAKKYGFL 240 SCLGAS SSPSR L KAAAEEAVL ELPEATI+RPAVM+GTEDRILNRWA FAKKYGFL Sbjct: 181 SCLGASSSSPSRFLRTKAAAEEAVLSELPEATILRPAVMVGTEDRILNRWAFFAKKYGFL 240 Query: 241 PLYGDGSTKFQPVYVIDVAAAIMAALKDDGTSMGKVYELGGPEIFTMHELAAVMYDTIRE 300 PL GDGSTKFQPVYV+DVA AI+AALKDDGTSMGKVYELGGPEIFTMH+LA +M+DTIRE Sbjct: 241 PLIGDGSTKFQPVYVVDVAGAIVAALKDDGTSMGKVYELGGPEIFTMHQLAELMFDTIRE 300 Query: 301 WPRYVKVPFPIAKAMTLPREILLNKVPFPLPTPGLFNLDLINAFTSDTVVSENALTFDDL 360 WPRYVKVP PIAKAM PREILLNKVPFPLP P +FN D I A +DT+VSENAL+F+DL Sbjct: 301 WPRYVKVPLPIAKAMGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALSFNDL 360 Query: 361 GIVPHKLKGYPIEFLLSYRKGGPQFGSTISERVDPEAFP 399 G+VPHKLKGYPIEFL+ +RKGGP +GST+SERV P+A+P Sbjct: 361 GLVPHKLKGYPIEFLIQFRKGGPNYGSTVSERVSPDAWP 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15462 (143 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7592 (363 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7726 102 9e-24 >Contig7726 Length = 297 Score = 102 bits (254), Expect = 9e-24, Method: Compositional matrix adjust. Identities = 78/268 (29%), Positives = 124/268 (46%), Gaps = 20/268 (7%) Query: 80 KAKLADGGSIALRLLREGSCKD--SNSCLPVIKQLGRVRHENLIPLRAFYQGKRGEKLLI 137 +A+ DG +A++ L S ++ + ++ H N+ L Y + G+ LL+ Sbjct: 7 RAQFDDGKVLAVKKLDSSVLPSELSEEFTEIVSSISQLHHPNVTELVG-YCSEHGQHLLV 65 Query: 138 YDYLPNRSLHDLLHETRAGKPVLNWARRHKIALGIARGLAFLHTVEAP-ITHGNVRSKNV 196 Y++ N SLHD LH + L W R KIALG AR L +LH V +P I H N++S N+ Sbjct: 66 YEFHKNGSLHDFLHLSDEYNKPLTWNSRVKIALGTARALEYLHEVCSPSIIHKNIKSTNI 125 Query: 197 LIDEFFVARLTEFGLDKVMVPAVADEMVALAKTDGYKAPELQKMKKCNSRTDVYAFXXXX 256 L+D L++ GL +P AD+ + GY APE+ + ++DVY F Sbjct: 126 LLDVELNPHLSDAGL-ASSIPN-ADQALDHNAGSGYSAPEVAMSGQYTLKSDVYGF---- 179 Query: 257 XXXXXXXXXXXNGRSGDFVDLPSMVKVAVLEETTMEVFDVEVLKGIRSPMEEGLVQALKL 316 +GR F +L + +++ T ++ D++ L + P +GL L Sbjct: 180 ---GVVMLELLSGRKA-FDNLKPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSL 235 Query: 317 AMG------CCAPVASVRPTMDEVVKQL 338 + C P RP M EVV+ L Sbjct: 236 SRFADVIALCVQPEPEFRPPMSEVVQAL 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1185 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31347 338 4e-95 >Contig31347 Length = 459 Score = 338 bits (868), Expect = 4e-95, Method: Compositional matrix adjust. Identities = 171/274 (62%), Positives = 200/274 (72%), Gaps = 1/274 (0%) Query: 1 MTTDNIAGVTTVNPKVDIFAQARDCLLPMGLTSENVAKRYGVTRQEQDQXXXXXXXXXXX 60 MT + +A +VNPKV +F QA++CLLPMG+TSENVA R+GV+R+EQDQ Sbjct: 165 MTANPMAWEGSVNPKVKMFEQAQNCLLPMGITSENVAHRFGVSRKEQDQAAVDSHRKAAA 224 Query: 61 XXXXGKFKEEIIPVSTKIVDPKTGEVKPVIISVDDGIRPDTNMKSLAKLKPAFAKDGSTT 120 GKFK+EIIPV+TKIVDPK+GE KPV ISVDDGIR +T + LAKLKP F KDGSTT Sbjct: 225 ATATGKFKDEIIPVATKIVDPKSGEEKPVTISVDDGIR-NTTLADLAKLKPVFKKDGSTT 283 Query: 121 AGNASQVSDGAGGALLMKRSLAMKRGLPILGLFRSYXXXXXXXXXXXXXXXXXIPIAAKN 180 AGN+SQVSDGAG LLMKRS+A ++GLPILG+FRS+ IP A K Sbjct: 284 AGNSSQVSDGAGAVLLMKRSVAEQKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKA 343 Query: 181 AGLEVADIDLFEINEAFASQYVYCCKKLDLDPKKVNVNXXXXXXXXXXXXXXXRCVSTLL 240 AGLE+ DIDLFEINEAFASQY+YC KL LDP+K+NVN R V+TLL Sbjct: 344 AGLELDDIDLFEINEAFASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLL 403 Query: 241 YEMKRRGKDCRYGVISMCIGSGMGAAAVFERGDS 274 +EMKRRGKDCR+GVISMCIG+GMGAAAVFERGDS Sbjct: 404 HEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDS 437 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4128 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26626 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47090 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14166258 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2618 218 5e-59 >Contig2618 Length = 161 Score = 218 bits (555), Expect = 5e-59, Method: Compositional matrix adjust. Identities = 108/159 (67%), Positives = 121/159 (76%), Gaps = 1/159 (0%) Query: 4 AEKSVMVVGIDHSEHSLYAFEWTLDHFFAPFPG-TAPFKLVIVHAKPSPATAIGLGGPGA 62 A K VMV+G D SE YA EWTLDH F P G TAPFKL+IVHAKPS ++ +G GP Sbjct: 3 AGKQVMVIGADDSEEGHYALEWTLDHLFKPLGGDTAPFKLIIVHAKPSVSSVVGFVGPAG 62 Query: 63 IDVLPYVEADLKKTADRVVEKAREICSSKSXXXXXXXXXXXXARNVMCEAVEKHHASILV 122 +VLP V+ADLKK A RV E+A+E C+SKS ARNV+CEAVE+HHASILV Sbjct: 63 AEVLPIVDADLKKMAARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHHASILV 122 Query: 123 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTKH 161 VGSHGYGAIKRA+LGSVSDYCAHH HCTVMIVKKPKTKH Sbjct: 123 VGSHGYGAIKRALLGSVSDYCAHHVHCTVMIVKKPKTKH 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32818 (296 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12866 262 4e-72 >Contig12866 Length = 268 Score = 262 bits (670), Expect = 4e-72, Method: Compositional matrix adjust. Identities = 134/188 (71%), Positives = 147/188 (78%), Gaps = 2/188 (1%) Query: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEESRDAED 60 MSSR+SRT+YVGNLPGDIR REVEDLF KYGPI IDLKIPPRPPGYAFVE+E+ RDA+D Sbjct: 1 MSSRSSRTIYVGNLPGDIRMREVEDLFLKYGPIVDIDLKIPPRPPGYAFVEYEDPRDADD 60 Query: 61 AIRGRDGYDFDGHRLRVELAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYRVLVTGLPS 120 AI GRDGYDFDG RLRVELA +YRVLVTGLP Sbjct: 61 AIYGRDGYDFDGFRLRVELAHGGRHSSSHRSSSYSRSSSSRGASRRS--DYRVLVTGLPP 118 Query: 121 SASWQDLKDHMRRAGDVCFSQVFHDGGGTVGIVDYTNYDDMKFAIRKLDDSEFRNAFSRA 180 +ASWQDLKDHMRRAGDVCFSQVF D GG GIVDYTNY+DMK+AIRKLDDSEFRNAF+R+ Sbjct: 119 AASWQDLKDHMRRAGDVCFSQVFRDRGGMTGIVDYTNYEDMKYAIRKLDDSEFRNAFARS 178 Query: 181 YVRVKEYD 188 Y+RV+EYD Sbjct: 179 YIRVREYD 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50497 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44727 (719 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52321 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9025 298 5e-83 >Contig9025 Length = 213 Score = 298 bits (763), Expect = 5e-83, Method: Compositional matrix adjust. Identities = 142/213 (66%), Positives = 168/213 (78%) Query: 1 MAVLKVHGSPFSTATMRVVAALYEKGLEFEFVTIDMKAGQHKSEAFLALNPFGQVPAFED 60 MA +KVHG+ S T RV+AALYEK ++FE V ID+ G+HK E F++LNPFG+VPAFED Sbjct: 1 MAPVKVHGNVLSVCTRRVIAALYEKDIKFELVPIDLGTGEHKKEPFISLNPFGEVPAFED 60 Query: 61 GDLKLFESRAIAQYIAHEYASNGTQLICPDSKKMAIMSVWMEVEAHQYDPHAAKLCFELC 120 GDLKLFESRAI QYI HEYA GT L+ DSKKMA+++V EVE ++DP A+KL FE Sbjct: 61 GDLKLFESRAITQYIVHEYADKGTPLVFQDSKKMAMIAVGCEVEGQKFDPAASKLTFEQV 120 Query: 121 IKPMLGLTTDPAAVEDLEAKLGKVLDVYEARLTQSKYLGGDCLGLADLHHLPTLHYLLGS 180 IKPML + TD A VE+ EAKL VLDVYE RL QSKYL G+ LADLHH+PT+HYL+G+ Sbjct: 121 IKPMLKMPTDAAVVEEYEAKLAVVLDVYEIRLAQSKYLAGERFTLADLHHIPTIHYLMGT 180 Query: 181 SAKKLFDSRPHVCAWVADITARPAWAKVIAMQK 213 +KKLF SRPHV AWVADITARPAW KVIA+QK Sbjct: 181 QSKKLFVSRPHVSAWVADITARPAWKKVIALQK 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52325 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9025 295 4e-82 >Contig9025 Length = 213 Score = 295 bits (755), Expect = 4e-82, Method: Compositional matrix adjust. Identities = 141/213 (66%), Positives = 166/213 (77%) Query: 1 MAVLKVHGSPFSTAVMRVVAALYEKGLEFEFVTIDMKAGQHKSEAFLALNPFGQVPAFED 60 MA +KVHG+ S RV+AALYEK ++FE V ID+ G+HK E F++LNPFG+VPAFED Sbjct: 1 MAPVKVHGNVLSVCTRRVIAALYEKDIKFELVPIDLGTGEHKKEPFISLNPFGEVPAFED 60 Query: 61 GDLKLFESRAITQYIAHEYASNGTQLICPDSKKMAIMSVWIEVEAHQYDPHAGKLGYELF 120 GDLKLFESRAITQYI HEYA GT L+ DSKKMA+++V EVE ++DP A KL +E Sbjct: 61 GDLKLFESRAITQYIVHEYADKGTPLVFQDSKKMAMIAVGCEVEGQKFDPAASKLTFEQV 120 Query: 121 YKPMFGQTTDPAAVEDLEAKLGKVLDVYEARLTQSKYLGGDCFGLADLHHLPTLHYLLGS 180 KPM TD A VE+ EAKL VLDVYE RL QSKYL G+ F LADLHH+PT+HYL+G+ Sbjct: 121 IKPMLKMPTDAAVVEEYEAKLAVVLDVYEIRLAQSKYLAGERFTLADLHHIPTIHYLMGT 180 Query: 181 SAKKLFDSRPHVSAWVADITARPAWAKVIAMQK 213 +KKLF SRPHVSAWVADITARPAW KVIA+QK Sbjct: 181 QSKKLFVSRPHVSAWVADITARPAWKKVIALQK 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52425 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9025 115 1e-28 >Contig9025 Length = 213 Score = 115 bits (288), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 55/93 (59%), Positives = 68/93 (73%) Query: 1 MAIMSVWIEVEAHQYDPHAGKLGYELFYKPMFGQTTDPAAVEDLEAKLGKVLDVYEARLT 60 MA+++V EVE ++DP A KL +E KPM TD A VE+ EAKL VLDVYE RL Sbjct: 94 MAMIAVGCEVEGQKFDPAASKLTFEQVIKPMLKMPTDAAVVEEYEAKLAVVLDVYEIRLA 153 Query: 61 QSKYLGGDCFGLADLHHLPTLHYLLGSSAKKLF 93 QSKYL G+ F LADLHH+PT+HYL+G+ +KKLF Sbjct: 154 QSKYLAGERFTLADLHHIPTIHYLMGTQSKKLF 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3118 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35742 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3466264 (447 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27182 877 0.0 >Contig27182 Length = 447 Score = 877 bits (2266), Expect = 0.0, Method: Compositional matrix adjust. Identities = 420/436 (96%), Positives = 431/436 (98%) Query: 1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEPKRPSDKPLRLPLQD 240 VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD++ EPKRPSDKPLRLPLQD Sbjct: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETG++KPGMVVTFGPTGLTTEVKSVEMHHE+L EALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRGFVASNSKDDPAKEAANF SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 AEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 AEI+TKIDRRSGKELEKEPKFLKNGDAG+VKMIPTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKNVEKKDPSG 436 VAVGVIK+VEKK+P+G Sbjct: 421 VAVGVIKSVEKKEPTG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52609 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15287 74 1e-15 >Contig15287 Length = 147 Score = 74.3 bits (181), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 31/80 (38%), Positives = 58/80 (72%) Query: 28 QDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTIN 87 +D LP A +++I+K+ LP + ++A+DA+D + EC EFI+ I+SE+++ C +E+++TI Sbjct: 12 EDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCSREEKRTIA 71 Query: 88 GDDLLWAMATLGFEDYIEPL 107 + +L A+ LGF +Y+E + Sbjct: 72 PEHVLKALQVLGFSEYVEEV 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58040 (329 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28823 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17253 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2618 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49849 (132 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53255 (468 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7882 111 2e-26 >Contig7882 Length = 413 Score = 111 bits (278), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 97/352 (27%), Positives = 155/352 (44%), Gaps = 37/352 (10%) Query: 36 PLVIEKSKGAYVWDINGKKYLDSLAGLWCTALGGSEPRLVAAAIAQLNTLPFY-HSFWNR 94 P+V + KG+ + D G +YLD L+ G P+++ A Q L +F+N Sbjct: 56 PVVFSQGKGSCIQDPEGNRYLDFLSAYSAVNQGHCHPKIMKALQEQAQRLTLSSRAFYN- 114 Query: 95 TTKPSLDLAKELLNTFTATKMGKAFFTNSGSEANDTQVKLV--WYYNNALGRPNKKKFIA 152 + E L + M N+G+EA +T +K+ W + ++ ++ Sbjct: 115 ---DRFPIFAEYLTSMFGYDM--VLPMNTGAEAVETALKVARKWGHEKKKIPKDEAIIVS 169 Query: 153 RAKSYHGSTLISASLSGLPALHQKFDLPAPFVLHTDCPHYWRYHLPGESEEEFSTRLANN 212 +HG TL S+S + F P LPG + +F A Sbjct: 170 CCGCFHGRTLAVISMSCDNEATRGF---GPL-------------LPGHLKVDFGD--AVG 211 Query: 213 LENLILKEGPETIAAFIAEPVMGAGGVIPPPATYFDKIQPILKKYDILFIADEVICAFGR 272 LE + KE + IA F+ EP+ G GVI PP Y ++ + KY+IL IADE+ R Sbjct: 212 LEK-VFKENGDRIAGFLFEPIQGEAGVIIPPDGYLKTVRDLCSKYNILMIADEIQSGLAR 270 Query: 273 LGTMFGCDKYGMKPDLVSMAKALSSAYMPIGAVLVSPEISDVIDSQSNKLGVFSHGFTYS 332 G M D ++PD+V + KAL +P+ AVL ++ I HG T+ Sbjct: 271 SGKMLAVDWEEVRPDVVILGKALGGGVIPVSAVLADKDVMLCIRPG-------EHGSTFG 323 Query: 333 GHPVSCAVALEALKIYKERNIAEVVQRISPKFQNGLKAFSDS--PIIGEIRG 382 G+P++ AVA+ AL + ++ +AE + + +N L I E+RG Sbjct: 324 GNPLASAVAVAALDVIRDEKLAERSAEMGQELRNQLVKIQQQFPNYIKEVRG 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29047 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16648 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7270 144 1e-36 >Contig7270 Length = 365 Score = 144 bits (364), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 90/275 (32%), Positives = 148/275 (53%), Gaps = 28/275 (10%) Query: 2 LINHGVPESLMTGMIEACRGFFDLTEEEKREFQGTHVLSPIRCG---TSFNARVDQILFW 58 +++HGV L++ M R FF L EEK F +S + G S + + + + W Sbjct: 74 IVDHGVDAELISEMTGLAREFFALPSEEKLRFD----MSGGKKGGFIVSSHLQGEAVQDW 129 Query: 59 RDFLKVFVHPQFHS-----PSKPAGFSEVCLEYTQRMRKVAGELLKGISKSLGLEEWYID 113 R+ + F +P H P KP + EV +Y+ + +A +LL +S+++GL+ + Sbjct: 130 REIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGLDTEALT 189 Query: 114 KT-MNMDSGLQILTVNLYPPCPQPEYAMGMPPHSDHSFLTILIQNGIGGLQVQHKG--QW 170 K ++MD Q + VN YP CPQP+ +G+ H+D +T+L+Q+ +GGLQ W Sbjct: 190 KACVDMD---QKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDGKTW 246 Query: 171 FDVNPIPNSILVNTGDHLEVLSNGKYKSVLHRAVVNNKTTRISLALSNGPSLDTVVEPI- 229 V P+ + +VN GDH +LSNG++K+ H+AVVN+ ++R+S+A P+ + +V P+ Sbjct: 247 ITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQEAIVYPLS 306 Query: 230 ------PELSHPLKYVGMAYKEY---LELQQGNKL 255 P L P+ Y M K+ LEL + KL Sbjct: 307 VREGEKPILEAPITYTEMYKKKMSKDLELARLKKL 341 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59773 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65016 (376 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65135 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37390 (344 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15940 (287 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31992 241 9e-66 >Contig31992 Length = 566 Score = 241 bits (615), Expect = 9e-66, Method: Compositional matrix adjust. Identities = 122/260 (46%), Positives = 160/260 (61%), Gaps = 12/260 (4%) Query: 25 IQGQEGTLWWHAHSSWLRATVYGALIIHPKPGSSYPFTKPKRETPILLGEWWDANPIDVV 84 I GQEGTLWWHAH SWLRATV+GALIIHPK G S+PF KP +E PI+LG+W+ N +D+ Sbjct: 115 ITGQEGTLWWHAHISWLRATVHGALIIHPKAGQSFPFPKPAKEVPIILGDWYSGNVVDIE 174 Query: 85 RQATRTGAAPNVSDAYTINGQPGDLYNCSSKDTVIVPIDSGETNLLRVINSGLNQELFFT 144 ++ G APN+S+AYTING PGDLY+CS T + + G+T LLR+IN+ LN +LFF Sbjct: 175 QEGLSKGIAPNLSNAYTINGLPGDLYDCSQNQTYQLSVVRGKTYLLRLINAALNTQLFFK 234 Query: 145 VANHKFTVVSADASYTKPFTTSVIMLGPGQTTDVLITGDXXXXXXXXXXXXXXXXXG-AP 203 +ANH TVV+ DASYT P+ T V+++ PGQTTD+L+ + Sbjct: 235 IANHNMTVVAIDASYTTPYDTDVVVIAPGQTTDILVKFNQLNGSYYMAATPYASADDTVG 294 Query: 204 FDNTTTTAILEYKSAPCPAKKGVSTTPVFPSLPAFNDTATVTAFSKSFR----SPAKVEV 259 FDN+TT I+ YK S+TP+ P +P +DT F + P V V Sbjct: 295 FDNSTTRGIIVYKGY-------TSSTPIMPPMPNPHDTPLAHKFFTNLTGLPGGPHWVPV 347 Query: 260 PTDIDESLFFTVGLGLNRCP 279 P +DE +F TVG+ L CP Sbjct: 348 PRKVDEHMFVTVGVNLAMCP 367 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14542 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47266 (334 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20467 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7976 316 3e-88 >Contig7976 Length = 241 Score = 316 bits (809), Expect = 3e-88, Method: Compositional matrix adjust. Identities = 160/247 (64%), Positives = 191/247 (77%), Gaps = 8/247 (3%) Query: 6 FSSISLALFLFCLCLQGTNGDYGGWEGGHATFYXXXXXXXXXXXXXXYGNLYSQGYGTNT 65 +S+ + + F + NG YGGW HATFY YGNLYSQGYGTNT Sbjct: 1 MASLGILVIGFLSLVSSVNGYYGGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT 60 Query: 66 AALSTALFNSGLSCGACYEMKCNDDPKWCLPGTLTVTATNFCPPNLALSNTNGGWCNPPL 125 AALSTALFN+GL+CGACY+++C +DP+WCLPG++ VTATNFCPP GGWC+PP Sbjct: 61 AALSTALFNNGLTCGACYQIRCVNDPQWCLPGSIIVTATNFCPP--------GGWCDPPQ 112 Query: 126 QHFDLAEPAFLQIAQYRAGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDV 185 QHFDL++P FL+IAQY+AG+VPVS+RRV C ++GGIRFT+NGHSYFNLVL+TNV GAGDV Sbjct: 113 QHFDLSQPVFLRIAQYKAGVVPVSYRRVRCRRRGGIRFTVNGHSYFNLVLVTNVGGAGDV 172 Query: 186 RAVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGWQFGQ 245 ++V+IKGS+T WQ MSRNWGQNWQSNSYLNGQ+LSF VT SDGR + S NVAP W FGQ Sbjct: 173 QSVAIKGSRTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSYNVAPPNWSFGQ 232 Query: 246 TYEGAQF 252 TY G QF Sbjct: 233 TYTGRQF 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19966262 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44844 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16608 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6266260 (394 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226742903 311 1e-86 >226742903 Length = 195 Score = 311 bits (798), Expect = 1e-86, Method: Compositional matrix adjust. Identities = 156/174 (89%), Positives = 156/174 (89%) Query: 57 EIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVY 116 EIVDLCLDRIRKLA NCTGLQGFLVFNAV VDYGKKSKLGFTVY Sbjct: 19 EIVDLCLDRIRKLAYNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY 78 Query: 117 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 176 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS Sbjct: 79 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 138 Query: 177 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 230 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL Sbjct: 139 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57366 (82 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57874 (41 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26175 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5939 68 2e-13 >Contig5939 Length = 292 Score = 68.2 bits (165), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 53/171 (30%), Positives = 77/171 (45%), Gaps = 34/171 (19%) Query: 43 PQIASVGSCCLVGAISNGVLYVANLGDSRAVLGRRASEGRKNPVVAERLSTDHNXXXXXX 102 PQ +VGS +V ++ + V+N GDSRAVL R + A LS+DH Sbjct: 105 PQCDAVGSTAVVAVVTPEKIVVSNCGDSRAVLCRSGA--------AVPLSSDHKPDRPDE 156 Query: 103 XXXXXALNPDDSHVVVYTRGVWRIKGIIQVSRSIGDVYLKKPEFNRDPIFQQFGNPVPLK 162 A V+Y G R+ G++ +SR+IGD YLK Sbjct: 157 LVRIEAAGGR----VIYWDGA-RVLGVLAMSRAIGDNYLK-------------------- 191 Query: 163 RPVMTAEPSILIRKLLPQDSFLIFASDGLWEQLSDEAAVEIVFKNPRAGIA 213 P + +EP + + +D LI ASDGLW+ +S++ A +V RA A Sbjct: 192 -PYVISEPEVTVTDRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQTA 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54859 (102 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15066257 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28021 (72 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23352 127 5e-32 >Contig23352 Length = 437 Score = 127 bits (318), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 57/70 (81%), Positives = 68/70 (97%) Query: 2 DTVGKRLVNSKEGPPSFEQPKMTLEKLLEYGSMLVQEQENVKRVQLADKYLNEAALGDAN 61 D++GK+LVNSKEGPP+FEQPKMT+EKLLEYG+MLVQEQENVKRVQLADKYL+EAALGDAN Sbjct: 367 DSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYLSEAALGDAN 426 Query: 62 EDAIKSGSFF 71 DA+ +G+F+ Sbjct: 427 SDAMNTGTFY 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53324 (304 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42089 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46990835 199 6e-53 >46990835 Length = 192 Score = 199 bits (505), Expect = 6e-53, Method: Compositional matrix adjust. Identities = 95/143 (66%), Positives = 116/143 (81%) Query: 32 YAIVEELAGMGAAVYTCSRTESKLNNLLRDWNAKGFDVRGSVCDVSDRAQREQLIEKVSS 91 YAIVEELAG+GA V+TC+RTE+ LN+ L W KGF V GSVCDV + QRE+LI KVSS Sbjct: 14 YAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVSKTQREELINKVSS 73 Query: 92 GFNGKLNILINNVGTNFSKPTIEYTAADFSALMATNIESGYHLCQLAYPLLKASGAGSIV 151 F+GKLNILINNVG N K T+EYTA D+S LM+TN+ES YHLCQL++PLLKASG+ +IV Sbjct: 74 LFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAYHLCQLSHPLLKASGSANIV 133 Query: 152 FISSVAGVVSTGTGSIYAATKAA 174 +SS+AGVVS G+IY+ATK + Sbjct: 134 LLSSIAGVVSLNIGTIYSATKVS 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2342 (645 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5971 342 1e-95 >Contig5971 Length = 318 Score = 342 bits (876), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 166/295 (56%), Positives = 221/295 (74%), Gaps = 1/295 (0%) Query: 325 KCLRDAKMDKSTIHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXX 384 K + DA ++K I ++VLVGGSTRIPKVQQLL+D+F+GKE K +NPDE Sbjct: 2 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 61 Query: 385 ILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGV 444 ILSGEG E+ +D ET GGVMT LIPRNT IPTKK QVF+TY D Q V Sbjct: 62 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 121 Query: 445 LIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQK 504 IQV+EGER+ T+D LGKF+L+GIPPAPRG PQI V F++DANGILNV AEDK TG+ Sbjct: 122 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRAEDKGTGKS 181 Query: 505 NKITITNDKGRLSKEEIENMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKD-EK 563 KITITNDKGRLS+EEI+ MV+EAE++ ED++ K++++A+N+LE Y YNM+N + D +K Sbjct: 182 EKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDK 241 Query: 564 ISAKLPPADKKKIEDAVEQAIQWLDSNQLAEADEFEDKMKELESICNPIIAKMYQ 618 ++ KL +K+KIE A ++A++WLD NQ AE +++++K+KE+E++CNPII+ +YQ Sbjct: 242 LADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISAVYQ 296 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47089 (109 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26466257 (396 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35733 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32826 173 3e-45 >Contig32826 Length = 455 Score = 173 bits (438), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 91/246 (36%), Positives = 144/246 (58%), Gaps = 21/246 (8%) Query: 6 ELEPEVIKYMSKICPIKPVGPLYKNPKVPNAAVRGDFMKADD-CIEWLDSKPPSSVVYIS 64 +LEP +I PI GPL + ++ N+ +G+F D C++WLD + P SV+Y++ Sbjct: 222 DLEPAAFTLAPEILPI---GPLLASSRLENS--QGNFWPQDSTCLDWLDQQKPRSVIYVA 276 Query: 65 FGSVVYLKQDQVDEIAYGLLNSGVQFLWVMKPPHKDAGLELLVLPEGFLEKAGDKGKMVQ 124 FGS+ Q Q E+A L SG FLWV++P D + PEG+ E+ G +G MV Sbjct: 277 FGSLTVFDQTQFQELALALELSGRPFLWVVRPDTTDGASD--PYPEGYQERVGSRGLMVG 334 Query: 125 WSPQEQVLAHPSVACFVTHCGWNSSMEALSSGMPVVAFPQWGDQVTDAKYLVDVFKVGVR 184 W+PQ++VL+HPS+ACF++HCGWNS++E LSSG+P + +P + DQ+ + Y+ D++KVG+R Sbjct: 335 WAPQQKVLSHPSIACFISHCGWNSTLEGLSSGLPFLCWPYFADQLLNESYICDIWKVGLR 394 Query: 185 MCRGEAENKLITRDE----VEKCLIEATTGEKAAELKQNXXXXXXXXXXXXXXGGSSDRN 240 + E+ +IT E VE+ L + +A++LK+ GG S Sbjct: 395 FDKNES--GIITEGEIKTKVEQLLSDENFTARASKLKE-------VAMNNIKEGGQSYET 445 Query: 241 LQEFVD 246 + F++ Sbjct: 446 FKNFIE 451 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv460 (357 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10738 281 9e-78 >Contig10738 Length = 362 Score = 281 bits (720), Expect = 9e-78, Method: Compositional matrix adjust. Identities = 145/344 (42%), Positives = 198/344 (57%), Gaps = 2/344 (0%) Query: 11 IGWAARDPSGVLSPYTYTLRNTGPEDVLIKVTYCGICHTDLHQIKNDLGMSHYPMXXXXX 70 GWAARD SG LSP+ ++ R+TG EDV KV YCGICHTDLH IKN+ G+S YPM Sbjct: 14 FGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNEWGISLYPMVPGHE 73 Query: 71 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCQSDIEQYCSKKIWSYNDVYTDGKP 130 C S++E YC K I +Y +Y D Sbjct: 74 IVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKMILTYGSIYADRTV 133 Query: 131 TQGGFAESMIVDQKFVLKIPDGMAPEQAAPLLCAGVTVYSPLSHFXXXXXXXXXXXXXXX 190 T GG++++M+ +++++++ P+ + + APLLCAG+TVYSPL +F Sbjct: 134 TYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGLAEPGKHVGIVGLG 193 Query: 191 XXXXXXVKIAKAMGHHVTVISSSDRKREEAMDHLGADDYLVSSDSTRMQEAADSLDYIID 250 VK AKA G VTVIS+S K++EA+ LGAD ++VS D +MQ A +LD IID Sbjct: 194 GLGHVGVKFAKAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQQMQAAIGTLDGIID 253 Query: 251 TVPVFHPLEPYXXXXXXXXXXXXMGVINTPLQF-VTPMVMLGRKIITGSFIGSMKETEEM 309 TV HP+ P +GV PL V P++M GRK + GS IG MKET+EM Sbjct: 254 TVSAAHPIVPLLGLLKPHGKLILVGVPEKPLDLHVFPLIM-GRKSVAGSGIGGMKETQEM 312 Query: 310 LEFCKENGLTSMIEMVKMDYVNTALERLEKNDVRYRFVVDVAGS 353 ++F ++ +T+ +E++ MDYVNTA+ERL KNDVRYRFV+DV + Sbjct: 313 IDFAAKHNITADVEVISMDYVNTAMERLAKNDVRYRFVIDVGNT 356 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16133 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10738 154 7e-40 >Contig10738 Length = 362 Score = 154 bits (390), Expect = 7e-40, Method: Compositional matrix adjust. Identities = 82/198 (41%), Positives = 110/198 (55%) Query: 4 EQAAPLLCAGVTAYSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDR 63 + APLLCAG+T YSP AKA G VTVIS+S Sbjct: 159 DAGAPLLCAGITVYSPLKYFGLAEPGKHVGIVGLGGLGHVGVKFAKAFGAKVTVISTSPS 218 Query: 64 KREEAMDHLGADDYLISSDSTRMQKAADSLDYIIDTVPVFHPLEPYXXXXXXXXXXXXXX 123 K++EA+ LGAD +++S D +MQ A +LD IIDTV HP+ P Sbjct: 219 KKDEALKQLGADSFVVSRDPQQMQAAIGTLDGIIDTVSAAHPIVPLLGLLKPHGKLILVG 278 Query: 124 XXNTPLQFANPMVMLGRKSITGSFIGSMKETEEVLEFCKEKGVTSMIEMVKMDYVNTAFE 183 PL +++GRKS+ GS IG MKET+E+++F + +T+ +E++ MDYVNTA E Sbjct: 279 VPEKPLDLHVFPLIMGRKSVAGSGIGGMKETQEMIDFAAKHNITADVEVISMDYVNTAME 338 Query: 184 RLEKNDVRYRFVVDVAGS 201 RL KNDVRYRFV+DV + Sbjct: 339 RLAKNDVRYRFVIDVGNT 356 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36401 (297 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12845 122 9e-30 >Contig12845 Length = 233 Score = 122 bits (305), Expect = 9e-30, Method: Compositional matrix adjust. Identities = 57/132 (43%), Positives = 80/132 (60%), Gaps = 3/132 (2%) Query: 13 VKRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPSDTEFEGGIYHGRIQLPAEYPF 72 +KR+ +E + + P ++ P +I EW + + G T F GG Y+G+I+ P EYPF Sbjct: 7 IKRLQKEYRALCKEPVSHIVARPHPNDILEWHYVLEGSEGTPFAGGYYYGKIKFPPEYPF 66 Query: 73 QPPSFMLLTPNGRFETQTKICLSISNHHPEHWQPSWSVRTALVALIAF-MPTSPNGALGS 131 +PP + TPNGRF TQ KICLS+S+ HPE W P WSV + L L++F M TSP GS Sbjct: 67 KPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP--TTGS 124 Query: 132 LDYKKEERHALA 143 ++ E+ LA Sbjct: 125 VNTTVAEKKRLA 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55895 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23874 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65458 (352 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18083 139 7e-35 >Contig18083 Length = 316 Score = 139 bits (350), Expect = 7e-35, Method: Compositional matrix adjust. Identities = 82/285 (28%), Positives = 144/285 (50%), Gaps = 22/285 (7%) Query: 63 ETTEKELQKLKSALSSWGCFQATGHGISTSFLDEIRQVTKEFFEQPIEEKKKISKGVEEF 122 + E+ K+ A +WG F HG+ + I + +++FF P+EEKKK+S+ Sbjct: 8 KAVEELAAKIGEACRTWGFFTVINHGVPSDIRRRIMEASRKFFALPLEEKKKVSREAHNT 67 Query: 123 EGYGADPTPEEGQYLDWSDRVFLDVY---------------PEDLRKYKFWPESPNSFRD 167 G+ D ++ + DW + D Y PE + Y WPE+ + FR+ Sbjct: 68 AGFHNDEHSKD--FKDWKE--VYDFYVNDGMLMPASHEPDDPEIVPWYTPWPENLSKFRE 123 Query: 168 VLENYTIKMKIVTEMISKAMAKSLNLEEKCFLNQFGERGALQARFNYYSRCLRPDIVLGL 227 E Y + + + + ++ SL L L+ + E A AR NYY+ C +PD+VLG Sbjct: 124 TCEEYGRACEKLFFNLLELVSLSLGLP-PTRLHGYFENQASFARLNYYAPCPKPDLVLGT 182 Query: 228 KPHADGSGYTILLQNEVDGLQILK--DDCWLTIPTISNALLVLMGDQMEIMSNGIFKSPV 285 H D S T+L Q +V+GL +L+ D W+ + + ++ ++ +GD +++ SN +++S Sbjct: 183 GGHRDPSALTVLAQEDVEGLDVLRKSDGAWVRVKPVPDSFVINVGDVLQVWSNDLYESVE 242 Query: 286 HRVLASSERERISVAVFYTPESGKLIGPEEGLIDEERPRLFKKVK 330 HR + +E ER S+ +F+ P + P + L+DE P + + K Sbjct: 243 HRAMVHAETERYSIPIFFHPSHDITMKPLDELVDERSPAKYPEYK 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40831 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14292 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55193 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43469 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16124 184 7e-49 >Contig16124 Length = 144 Score = 184 bits (466), Expect = 7e-49, Method: Compositional matrix adjust. Identities = 95/144 (65%), Positives = 103/144 (71%) Query: 1 MASLATLAAVQPINIKGLAGSSISGTKLSVKPARRSLRVGNSRAGAVVAKYGDKSVYFDL 60 MASLATLAAVQP I GL GSS++GTKL VKP R+S+R N R GAVVAKYGDKS+YFDL Sbjct: 1 MASLATLAAVQPAAINGLGGSSLTGTKLVVKPTRQSIRTKNIRNGAVVAKYGDKSIYFDL 60 Query: 61 EDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRXXXXXXXXXXXXXXXAYVSAT 120 EDLGNTTG+WD+YGSDAPSPYNPLQSKFFETFAAPFTKR AY+SAT Sbjct: 61 EDLGNTTGKWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGASTIAYLSAT 120 Query: 121 ASDDYXXXXXXXXXXXXXXXRGKI 144 ASDD RGKI Sbjct: 121 ASDDILPIKKGPQLPPKLGPRGKI 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14967 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41031 (66 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5457 (325 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36508 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7991 345 5e-97 >Contig7991 Length = 241 Score = 345 bits (884), Expect = 5e-97, Method: Compositional matrix adjust. Identities = 174/243 (71%), Positives = 201/243 (82%), Gaps = 5/243 (2%) Query: 1 MAALGISSAAIGFNTIT-IFRTKSAPRRLRT-KISCVGWDPEGLFGSPNTGHIARLEFKR 58 MAAL +S IG T + + PRR R +ISC+GWDPEG+ G P TGH+AR+EFKR Sbjct: 1 MAALTLS---IGIATTSSALLKRPMPRRPRAARISCIGWDPEGVLGPPQTGHLARIEFKR 57 Query: 59 RLEKDADAREAFQRHVLEEKERRQALRQSRVIPDTPEELIEYFLDTEAQEFEFEIARMRH 118 RLEKDADARE F+R V+EEKERR+ +R+SRV PDT EELIEYFL+TEA+E EFEI+R+R Sbjct: 58 RLEKDADAREEFERQVIEEKERRRTVRESRVAPDTAEELIEYFLNTEAREIEFEISRLRP 117 Query: 119 RLDKDFFSHLQSELGQLRFSVSKTEEMEDRLIELEALQKALLEGTEAYDKMQADLITAKE 178 RLDK+FFSHLQ ELGQLRF+VSKT+++EDRLIELEALQKAL EGTEAYDKMQ DLI AK Sbjct: 118 RLDKEFFSHLQYELGQLRFAVSKTQDIEDRLIELEALQKALQEGTEAYDKMQTDLIKAKL 177 Query: 179 SLTKILTSKDVKATLLEMVEKNELNRSLLALLDENIASAQSSEQKQAVAFMEKLRAAVLK 238 SLTK+L+SKDVK+TLLEMVE NELNRS L LLDENIA+A QKQA FMEK+R AVLK Sbjct: 178 SLTKVLSSKDVKSTLLEMVEHNELNRSFLTLLDENIANAHKGNQKQAAEFMEKVRGAVLK 237 Query: 239 YIT 241 YIT Sbjct: 238 YIT 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60213 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5349 285 5e-79 >Contig5349 Length = 177 Score = 285 bits (729), Expect = 5e-79, Method: Compositional matrix adjust. Identities = 136/177 (76%), Positives = 152/177 (85%) Query: 56 VKENHSRKRMRSGLCSASGSKACREKVRRDRLNDRFLELGSILEPGRPPKMDKAVILSDA 115 +KE RKR R+G S SGSKACREK+RRDRLNDRF EL SILEPGRPPK DK IL DA Sbjct: 1 MKETGLRKRARTGSNSVSGSKACREKMRRDRLNDRFAELSSILEPGRPPKTDKVAILGDA 60 Query: 116 LRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIVQQIKALSSQA 175 +RM+TQLR E Q+LK+S +LQE INELKAEKNELRDEKQRLK EK+NI +QIKAL +Q Sbjct: 61 VRMVTQLRGEAQQLKESSANLQETINELKAEKNELRDEKQRLKAEKDNIERQIKALGTQP 120 Query: 176 GFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQFMPPAAVDTSQDHVLRPPVA 232 FLPHP+AIP PF+APGQVVG K+MPF+GYPG+SMWQFMPPAAVDTSQDHVLRPPVA Sbjct: 121 SFLPHPAAIPTPFSAPGQVVGGKMMPFVGYPGMSMWQFMPPAAVDTSQDHVLRPPVA 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49587 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18989 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26166 (320 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13617 65 2e-12 >Contig13617 Length = 359 Score = 64.7 bits (156), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 41/135 (30%), Positives = 71/135 (52%), Gaps = 11/135 (8%) Query: 141 VYWFICFNSPSPGPKITDPSVLKKQARELVRNWPSELLNIIDLTPDDTIIRTPLVDRWLW 200 + W+ F+ +PG + P+ K++ ++ W +++++ T +D I+R + DR Sbjct: 1 MQWY-AFHKEAPG-GVDSPNGKKERLLKIFEGWCDNVIDLLLATEEDAILRRDIYDRT-- 56 Query: 201 PAISPPASSGGVVLVGDAWHPMTPNLGQGACCALEDAVVLAKKLSDALRLGPES-----V 255 P ++ G V L+GD+ H M PN+GQG C A+ED LA +L A + ES + Sbjct: 57 PILT--WGKGHVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPIDI 114 Query: 256 EGALRLYGSERWPRI 270 +LR Y + R R+ Sbjct: 115 NSSLRSYENSRRLRV 129 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18629 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19941 79 5e-17 >Contig19941 Length = 329 Score = 79.0 bits (193), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 36/55 (65%), Positives = 41/55 (74%) Query: 5 RMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVK 59 RMRWT LH FV AV+ LGG ERATPK +L LM V+ LT+ HVKSHLQ YRT + Sbjct: 101 RMRWTQELHEAFVEAVDHLGGSERATPKGILNLMKVEGLTIYHVKSHLQKYRTAR 155 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6759 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 294 9e-82 >Contig2543 Length = 199 Score = 294 bits (752), Expect = 9e-82, Method: Compositional matrix adjust. Identities = 135/199 (67%), Positives = 165/199 (82%), Gaps = 1/199 (0%) Query: 1 MARPSNKNIQAKLVLVGDMGTGKTSLVLRFVKGQFFEHQEPTIGAAFFTQLLSLNEATVK 60 MAR NKNIQAKLVL+GDMGTGKTSLVLRFV G+F E+QE TIGAAFFTQ+LSLNEAT+K Sbjct: 1 MARTGNKNIQAKLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIK 60 Query: 61 FDIWDTAGQERYHNLAPMYYRGXXXXXXXYDISNVDTFVRAKKWVQELQKQGNKNLVMAL 120 FDIWDTAGQERYH+LAPMYYRG YDI+++D+F+RAKKWV E+Q+Q N L+M L Sbjct: 61 FDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFLRAKKWVLEVQRQANPTLIMFL 120 Query: 121 VANKCDLESKREVNTQEGEKLSEENGMFFIETSAKTSLNINELFYEIAKRLAIAQPSQPS 180 NK DLE KR+V ++EGE+ ++ENG+ F+ETSAKT+ N+NELFYEIAK+LA A PS+ S Sbjct: 121 AGNKADLEDKRKVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKLAKASPSRQS 180 Query: 181 GMNLH-ETENSGRRLFCCS 198 G+ LH + + RR+FCCS Sbjct: 181 GIKLHSRSPQNSRRMFCCS 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6345 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51913 (408 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7966262 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48818 (46 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60961 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56337 (311 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10827 211 1e-56 >Contig10827 Length = 320 Score = 211 bits (537), Expect = 1e-56, Method: Compositional matrix adjust. Identities = 112/230 (48%), Positives = 146/230 (63%), Gaps = 41/230 (17%) Query: 90 KNKEEAETQRMTHIAVERNRRRQMNEHLAILRSLMPESYVQRGDQASIVGGAIEFVKELE 149 KN+EE E QRMTHIAVERNRR+QMNE+L++LRS+MPESYVQRGDQASI+GGAI FVKELE Sbjct: 115 KNEEEIENQRMTHIAVERNRRKQMNEYLSVLRSIMPESYVQRGDQASIIGGAINFVKELE 174 Query: 150 HLLQSLEARKHKMLQGVRENVDDXXXXXXXXTGTGITANKFMPPPFSQFFVYPQYTWSQM 209 +Q L +K PFS+FF +PQY+ Sbjct: 175 QEVQFLGVQKPNNC-----------------------------APFSEFFTFPQYSTRST 205 Query: 210 PNKYTS------------KSKAAVADIEVTLIETHANLRILSHKSPRLLSKMVTGFQTLY 257 + ++ +S ADIEVT++E+HA+L++ S + P+ L K+V+G ++ Sbjct: 206 SDHESTVAAMAELPLLECRSSNIAADIEVTMVESHASLKVRSKRLPKQLLKIVSGLHDMH 265 Query: 258 LTILHLNVTTVDPLVLYSISAKVEEGCQLTSVDDIAGAVHHMLRIIEEEA 307 LT+LHLNV T D +VLYS+S KVE+ C LTSVD+IA AVH ML I+EEA Sbjct: 266 LTVLHLNVVTADDIVLYSLSLKVEDECMLTSVDEIATAVHEMLARIQEEA 315 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26640 (292 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31648 426 e-121 >Contig31648 Length = 296 Score = 426 bits (1096), Expect = e-121, Method: Compositional matrix adjust. Identities = 219/298 (73%), Positives = 238/298 (79%), Gaps = 11/298 (3%) Query: 1 MLSLSSISPLKTSPCRTHFPL---PS---HHRFCRFGVRSSYAEAGVKGDSKSATIDVEA 54 L ++S L +S FP P+ HHR V+ Y E VK D SATIDV A Sbjct: 4 FLHFPAVSTLPSSFPGAFFPARPKPTSLFHHR-----VKCRYGEVNVKTDFNSATIDVVA 58 Query: 55 DVKSERVVVLGGNGFVGSAICKAAVSKGIEVTXXXXXXXXXXXXXWVDQVNWVTGDVFYV 114 DVK ERVVVLGG GFVGSAICKAAVS+GIEV W+DQVNWV GDVFYV Sbjct: 59 DVKPERVVVLGGTGFVGSAICKAAVSRGIEVVGVSRSGRPTYSGAWIDQVNWVPGDVFYV 118 Query: 115 NWDEVLVGATAVVSTLGGFGSEEQMKRINGEANVLAVGAAKDYGVPKFILISVHDYNLPQ 174 NWDEVL+GATAVVST+GGFGSEEQM+RINGEANV+AV AAKDYGVPKFILISVHDYNLP Sbjct: 119 NWDEVLIGATAVVSTIGGFGSEEQMQRINGEANVVAVNAAKDYGVPKFILISVHDYNLPP 178 Query: 175 FLLDSGYFTGKRKAESEVLSKYPNSGVVLRPGFIYGKRRVDGFEIPLDLIGEPLEKILRA 234 FLL SGYFTGKRKAESEVLSKYPNSG+VLRPGFIYGKRRVDGFEIPLD IGEPLE+ ++A Sbjct: 179 FLLSSGYFTGKRKAESEVLSKYPNSGIVLRPGFIYGKRRVDGFEIPLDFIGEPLERFIKA 238 Query: 235 TENLTRPLSALPASDLILAPPVSVDDVALAAVNAITDDDFFGIFTIEQIKEAAAKVSV 292 TEN T+PLS+LPASDL+LAPPVSVDDVALAA+N I DDDFFGIFTI QIKEAA KV V Sbjct: 239 TENFTKPLSSLPASDLLLAPPVSVDDVALAAINGIRDDDFFGIFTIAQIKEAAEKVRV 296 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47699 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31834 77 2e-16 >Contig31834 Length = 181 Score = 77.0 bits (188), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 46/121 (38%), Positives = 65/121 (53%), Gaps = 17/121 (14%) Query: 1 MARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGRFSVKSDVYSFGVLILEIISGKRNNGFH 60 +ARIF + + NT+R+VGT GYM PE + GR SVK+DVYSFGVLILEII G++ N Sbjct: 10 LARIFTHTELEANTSRIVGTLGYMPPE-TIEGRVSVKTDVYSFGVLILEIIRGRKINRLC 68 Query: 61 ESDQAEDLLSYLMNGCRLGNFGGMAHPWNLWTRRQGILSQEMKSLGASIWAYYVFKKIRM 120 D +L+ Y W LW ++ L + +LG S + + I + Sbjct: 69 NDDGLLNLVGY---------------AWELW-KKNAALELKDPTLGDSCNGNQLLRCIHI 112 Query: 121 T 121 + Sbjct: 113 S 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6362 (325 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3451 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11077 145 7e-37 >Contig11077 Length = 317 Score = 145 bits (366), Expect = 7e-37, Method: Compositional matrix adjust. Identities = 88/222 (39%), Positives = 118/222 (53%), Gaps = 11/222 (4%) Query: 57 LLTADHH--HFSIFKRRFGKSYASQEEHDYRFKVFKANLRRARRHQQLDPSATHGVTQFS 114 +L + HH F+ F R+GK Y S EE R+++F N + R + S T V +F+ Sbjct: 8 VLGSSHHVLSFARFAHRYGKKYESVEEMKLRYEIFLENKKLIRSTNRKGLSYTLAVNRFA 67 Query: 115 DLTPAEFRGTYLGLRPLKLPHDAQKAPILPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWS 174 D + EF LG + L LPE +W++ G VT VK+QG CGSCW+ Sbjct: 68 DWSWEEFARHRLGAAQ-NCSATTKGNHKLTDAVLPESKNWKEEGIVTPVKDQGHCGSCWT 126 Query: 175 FSTTGALEGANFLATGNLVSLSEQQLVECDHECDPEEMGSCDSGCNGGLMNTAFEYTLKA 234 FSTTGALE A A G +SLSEQQLV+C + + ++GCNGGL + AFEY Sbjct: 127 FSTTGALEAAYVQAFGKQISLSEQQLVDCAGDFN-------NNGCNGGLPSQAFEYIKYN 179 Query: 235 GGLMKEEDYPYTGTDRGSCKFDKTKIAASVSHFQCISLDEDQ 276 GGL E YPY G D G+CKF + V I+L ++ Sbjct: 180 GGLDTEAAYPYVGVD-GACKFSSENVGVQVVDSVNITLGAEE 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55742 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51028 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55459 (83 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7783 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28441 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51002 (53 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14207 (366 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12391 426 e-121 >Contig12391 Length = 343 Score = 426 bits (1095), Expect = e-121, Method: Compositional matrix adjust. Identities = 217/300 (72%), Positives = 243/300 (81%), Gaps = 3/300 (1%) Query: 1 MGHFSSMFNGWARSFSIKKASSSG-NCGGREAVEVMAKEAKKNDLILHXXXXXXXXXXXX 59 M SSMF+G ARS S+KK ++ G R A E MAKEAKKND+IL Sbjct: 1 MEQLSSMFSGLARSLSLKKGKNNDEKSGARGAAEAMAKEAKKNDMILRSSGIVYVDGSNN 60 Query: 60 XXXLYSKRGEKGVNQDCFIVWEEFGGQEDMLFCGVFDGHGPWGHYVAKRVRESMPSSLLC 119 ++SKRGEKGVNQDC VWE FG QEDM+FCG+FDGHGPWGH+VAK++RE+MP SLLC Sbjct: 61 FASVFSKRGEKGVNQDCCFVWEGFGFQEDMMFCGIFDGHGPWGHFVAKQIRETMPPSLLC 120 Query: 120 NWQETLAEASLDPDFDLQAEKKLHRFNIWKHSYLKTCAAIDQELEHHRRIDSFNSGTTAL 179 +WQETLA+ S+DPD DL +KK HRFN+WK SY+KTCAAID EL HRRIDSF SGTTAL Sbjct: 121 SWQETLAQTSIDPDPDL--DKKCHRFNVWKDSYIKTCAAIDHELGQHRRIDSFYSGTTAL 178 Query: 180 TIVRQGESIFVANVGDSRAVLATMSDDGNLEPVQLTIDFKPNLPQEAERIIQCKGRVFCL 239 +IVRQGE IF+ANVGDSRAVLAT DDG+L PVQLT+DFKP+LPQEAERIIQ GRVFCL Sbjct: 179 SIVRQGELIFIANVGDSRAVLATTLDDGSLVPVQLTVDFKPSLPQEAERIIQSNGRVFCL 238 Query: 240 GDEPGVHRVWLPHEESPGLAMSRAFGDYCVKDFGLISVPEVTQRNITSRDQFVVLATDGV 299 DEPGV RVW P E+PGLAMSRAFGDYCVKDFGLISVPEV+QRNITSRDQFVVLATDGV Sbjct: 239 DDEPGVQRVWQPDGETPGLAMSRAFGDYCVKDFGLISVPEVSQRNITSRDQFVVLATDGV 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36090 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13281 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55978 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22927 63 5e-12 >Contig22927 Length = 304 Score = 62.8 bits (151), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 26/39 (66%), Positives = 34/39 (87%) Query: 1 MIYASVYPEKFEGDKGLKLMQLARLSPEDMKVVNNMRLL 39 MI A++YPEKF+G+KGL LM+LA+L P+DM VNNM+LL Sbjct: 249 MILAAIYPEKFQGEKGLNLMKLAKLPPDDMNAVNNMKLL 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13517 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53479 (125 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42126 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55360 (387 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11347 (296 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27426 (254 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41990 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12139 (355 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10738 326 4e-91 >Contig10738 Length = 362 Score = 326 bits (835), Expect = 4e-91, Method: Compositional matrix adjust. Identities = 168/347 (48%), Positives = 214/347 (61%), Gaps = 2/347 (0%) Query: 9 NCLAWAARDPSGLLSPYKFSRRALGSDDVSLNITHCGVCYADVIWTRNKLGDSKYPVVPG 68 WAARD SG LSP+ FSRR+ G +DV + +CG+C+ D+ +N+ G S YP+VPG Sbjct: 12 KAFGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNEWGISLYPMVPG 71 Query: 69 HEIAGIVKEVGSNVCRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCARGSVFTFNXXXXX 128 HEI G V EVGS V + K GD VGVG V +C CE CN LE +C + + T+ Sbjct: 72 HEIVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPK-MILTYGSIYAD 130 Query: 129 XXXXXXXYSSHIVVHERYCFKIPDNYPLASAAPLLCAGITVYTPMMRHKMNQPXXXXXXX 188 YS +V +ERY + P+N PL + APLLCAGITVY+P+ + +P Sbjct: 131 RTVTYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGLAEPGKHVGIV 190 Query: 189 XXXXXXXXAVKFGKAFGLRVTVFSTSISKKEEALNLLGADKFVVSSDEQQMMALSRSLDF 248 VKF KAFG +VTV STS SKK+EAL LGAD FVVS D QQM A +LD Sbjct: 191 GLGGLGHVGVKFAKAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQQMQAAIGTLDG 250 Query: 249 IIDTASGDHPFDPYLSLLKTAGVLVLVGFPSE-VKFSPGSIVMGMRTVSGSATGGTKDTQ 307 IIDT S HP P L LLK G L+LVG P + + ++MG ++V+GS GG K+TQ Sbjct: 251 IIDTVSAAHPIVPLLGLLKPHGKLILVGVPEKPLDLHVFPLIMGRKSVAGSGIGGMKETQ 310 Query: 308 EMLDFCAAHGIHPEIEVIPIQYANEALERLIKKDVKYRFVIDIENSL 354 EM+DF A H I ++EVI + Y N A+ERL K DV+YRFVID+ N+L Sbjct: 311 EMIDFAAKHNITADVEVISMDYVNTAMERLAKNDVRYRFVIDVGNTL 357 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54200 (165 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 51912285 169 2e-44 >51912285 Length = 154 Score = 169 bits (428), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 78/149 (52%), Positives = 108/149 (72%), Gaps = 1/149 (0%) Query: 11 VDFSACSKKALKWALDNVVRDGDHLIILSVLPEGHYEEGEMQLWETTGSPLIPLSEFSDP 70 +DFS SK AL+WA+ N+ GD L I+ + P E QLW +GSPLIPL+EF +P Sbjct: 1 MDFSKSSKNALEWAIANLADKGDTLYIIHIKPNS-LGESRSQLWAQSGSPLIPLTEFREP 59 Query: 71 IISKKYGVKPDAETLDIVNCVARQKDIVVVMKVYWGDAREKICEAIDNIPLSCLVIGNRG 130 I K YGV+ D E LD ++ V+RQK+++VV K+YWGDAREK+ +A++++ L LV+G+RG Sbjct: 60 QIMKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRG 119 Query: 131 LGKIKRAILGSVSNYVVNNGSCPVTVVKN 159 L IKR +LGSVSN+V+ N S PVT+VK+ Sbjct: 120 LSTIKRIVLGSVSNFVLTNASIPVTIVKD 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15082 (369 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7890 372 e-105 >Contig7890 Length = 208 Score = 372 bits (956), Expect = e-105, Method: Compositional matrix adjust. Identities = 178/211 (84%), Positives = 191/211 (90%), Gaps = 3/211 (1%) Query: 1 MAVKKLCESYSKSFRGEVQRWGCMKQTGVSLRYMMEFGSRPTEKNLLISAQFLHKELPIR 60 MAVKK ES+SKS EVQRWGCMKQTGVSLRYMMEFGSRPT++N +ISAQFLHKELPIR Sbjct: 1 MAVKKASESFSKSLIDEVQRWGCMKQTGVSLRYMMEFGSRPTQRNFIISAQFLHKELPIR 60 Query: 61 IARRAIELESLPYGLSEKPAVLEVRDWYLDSFRDLRAFPEIKDKNDELEFTQMIKMIKVR 120 IARRAIELESLPYGLSEKPAVL+VRDWYLDSFRDLR FP+IKD DE +FTQMIK IKVR Sbjct: 61 IARRAIELESLPYGLSEKPAVLKVRDWYLDSFRDLRTFPDIKDAKDEKDFTQMIKAIKVR 120 Query: 121 HNNVVPTMALGVQQLKKGINVKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP 180 HNNVVP MALGVQQLKK K++YEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP Sbjct: 121 HNNVVPMMALGVQQLKKE---KVLYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP 177 Query: 181 APDCVGYIHTKMSPVEVARSASEDARSICLR 211 P CVGYI TKMSP+EVAR+A+EDAR +CLR Sbjct: 178 PPHCVGYIDTKMSPMEVARNATEDARXMCLR 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4183 (299 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666 (612 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8613 918 0.0 >Contig8613 Length = 612 Score = 918 bits (2373), Expect = 0.0, Method: Compositional matrix adjust. Identities = 452/617 (73%), Positives = 495/617 (80%), Gaps = 13/617 (2%) Query: 2 RGRADGSQRRRLLPSLCVVAIFLVFLYVYHGSIFGSQKALEYGSRSLRKXXXXXXXXXXX 61 RGRADG ++RL+ S+ V+ I LY+Y S LEYGS+ +RK Sbjct: 3 RGRADGIPKKRLVTSVLVLVIICGLLYLY--SKKNGSSGLEYGSK-IRKFGSTYLGAD-- 57 Query: 62 XSKLDESSSKFGQEDGEDDVMPKSIPVCDDRHSELIPCLDRNLIYQMRLKLDLSLMEHYE 121 +DES K G ED ED V+ KSIPVCDDRHSELIPCLDRNLIY+ RLKLDLS+MEHYE Sbjct: 58 -EDVDESPPKLG-EDEEDGVILKSIPVCDDRHSELIPCLDRNLIYETRLKLDLSVMEHYE 115 Query: 122 RHCPLPERRYNCLIPPPAGYKIPIKWPKSRDEVWKANIPHTHLAHEKSDQNWMVVKGEKI 181 RHCP+PERRYNCLIPPP GYKIPIKWPKSRDEVWKANIPHTHLA EKSDQ WMVVKGEKI Sbjct: 116 RHCPVPERRYNCLIPPPPGYKIPIKWPKSRDEVWKANIPHTHLATEKSDQKWMVVKGEKI 175 Query: 182 VFPGGGTHFHYGADKYIXXXXXXXXXXXXXXXXGGRIRTVFDVGCGVASFGAYLLSSDII 241 FPGGGTHFHYGADKYI GG +RTV DVGCGVASFG YLLSSDII Sbjct: 176 GFPGGGTHFHYGADKYIASMANMLNFPNNILNNGGSLRTVLDVGCGVASFGGYLLSSDII 235 Query: 242 TMSLAPNDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRDGIX 301 MSLAPNDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRDGI Sbjct: 236 AMSLAPNDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRDGIL 295 Query: 302 XXXXXXXXXPGGYFAYSSPEAYAQDEEDLRIWREMSALVERMCWRIASKRNQTVIWQKPL 361 PGGYFAYSSPEAYAQDEEDL+IW+ MSALVERMCW+IASKRNQTVIW KPL Sbjct: 296 LLELDRVLRPGGYFAYSSPEAYAQDEEDLKIWKAMSALVERMCWKIASKRNQTVIWVKPL 355 Query: 362 TNDCYMERAPGTQPPLCRSDDDPDAVWGVPMEACITPYSDHDHKSRGSEXXXXXXXXXXX 421 TNDCYMER PGTQPPLCRSDDDPDAV+ V MEACITPYS+ +H++RGS Sbjct: 356 TNDCYMERPPGTQPPLCRSDDDPDAVYNVKMEACITPYSEQNHRARGSGLAPWPARLTTP 415 Query: 422 XXXXXDFGYSKDIFEKDTEVWMQRVESYWNLLSPKITSDTLRNLMDMKANLGSFAAALKG 481 DFGYS DIFEKD EVW QRVE+YWNLLSPKI+SDT+RN+MDMKANLGSFA ALK Sbjct: 416 PPRLGDFGYSSDIFEKDMEVWQQRVENYWNLLSPKISSDTIRNVMDMKANLGSFAGALKN 475 Query: 482 KDVWVMNVVPEDGPNTLKLIYDRGLIGTIHNWCEAFSTYPRTYDLLHAWTVFSDIEKKGC 541 KDVWVMNVVPEDGPNTLK+IYDRGLIG++HNWCEA+STYPRTYDLLHAWTVFSDIE+K C Sbjct: 476 KDVWVMNVVPEDGPNTLKIIYDRGLIGSVHNWCEAYSTYPRTYDLLHAWTVFSDIERKEC 535 Query: 542 SAEDLLIEMDRILRPTGFVIIRDKPSVIEFVKKYLTALHWEAVSN-ERDG-----DELVF 595 S DLLIEMDRILRP GF+I+RDK V+EF+ KY+ ALHWEAV+ + +G D++VF Sbjct: 536 SGVDLLIEMDRILRPKGFIIVRDKRKVVEFINKYMKALHWEAVATADAEGGSELDDDVVF 595 Query: 596 LIQKKIWLTSESLRDTE 612 +IQKKIW TSES R+ E Sbjct: 596 IIQKKIWRTSESFRNVE 612 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2678 (232 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27400 175 8e-46 >Contig27400 Length = 266 Score = 175 bits (443), Expect = 8e-46, Method: Compositional matrix adjust. Identities = 78/107 (72%), Positives = 85/107 (79%) Query: 1 MLKEYLEGTEPTSFMYPSAVDQFKKQFAYLEEHYGNGATVAPPERQHASLPRPCVLYSDN 60 MLKEYLEG+EPT FMYPSAVD FKKQF YLEEHYGNG T PER HASLPR CV YSDN Sbjct: 121 MLKEYLEGSEPTGFMYPSAVDHFKKQFTYLEEHYGNGTTAVAPERTHASLPRACVSYSDN 180 Query: 61 SLHNSAEVADDLSKCCIKEVEKPHMDRSCGIPMARLPLQVPQSTQGG 107 + +S +V DDLS+CCIKEVEKP DRS GIP RLP+QVP + QG Sbjct: 181 PVQHSTDVTDDLSRCCIKEVEKPQTDRSSGIPTTRLPIQVPHTIQGA 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30866258 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34340 (171 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48218 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 176 2e-46 >Contig7384 Length = 326 Score = 176 bits (447), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 95/204 (46%), Positives = 130/204 (63%), Gaps = 5/204 (2%) Query: 15 LFMISFLMVCLGVRS--QLTTDFYNESCPNLLTIVRKAVKNAIKTETRMAASLVRLHFHD 72 L ++ +M G S QL +FY+ SCPN+ +IV +AV A+ +RL HD Sbjct: 8 LLLVLVMMFSQGKESEGQLVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHD 67 Query: 73 CFVNGCDGSVLL--DGSDGEKSALPNLN-SVRGFDVVDTIKSSVESACPGVVSCADILAI 129 CFV GCD S+++ D EK+ NL+ + GFD V K +VE+ CPGVVSCADILA+ Sbjct: 68 CFVEGCDASIIIASPNGDAEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAV 127 Query: 130 AARDSVLLSGGNTWKVFLGRRDGLVANQTGANNGLPFPTDSLDTITQKFANVGLNQTDVV 189 AARD V+L+GG ++ V LGRRDGL++ + LP PT +L+ +T FA L+ TDV+ Sbjct: 128 AARDCVVLAGGPSFPVELGRRDGLISKASRVAGNLPEPTFNLNQLTTMFAKHNLSLTDVI 187 Query: 190 SLSGAHTIGLARCTTFSSRLFNFS 213 +LSGAHT+G + C FS RL+NFS Sbjct: 188 ALSGAHTLGFSHCNRFSDRLYNFS 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31136 (506 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8715 133 8e-33 >Contig8715 Length = 275 Score = 133 bits (334), Expect = 8e-33, Method: Compositional matrix adjust. Identities = 65/172 (37%), Positives = 98/172 (56%), Gaps = 1/172 (0%) Query: 297 NVKGWHAYFWIAFIPFILLLLVGTKLEHVTTQLAHEVAEKHVAIEGDLVVRPSDDHFWFH 356 N G +Y W+ F+P +++L+VGTKL+ + T++ +++E+ + G +V P D FWF+ Sbjct: 3 NTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLKLSERGEVVRGTPLVEPGDHLFWFN 62 Query: 357 RPXXXXXXXXXXXXXNSFELAFFFWIWVQYGFDSCIMGQLGFIIPRLFIGAFVQFLCSYS 416 P N+F LAFF W W ++G SC +L ++ R+ +G +Q LCSY Sbjct: 63 NPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLKSCFHEKLEDVVLRISMGVIIQILCSYV 122 Query: 417 TLPLYAIVAQMGSSFKRSIFEEHIQHGLVEWAHKAKLKTGFKKNANGPSQVG 468 TLPLYA+V QMGS+ K IF + + L +W H A K KNA+ S G Sbjct: 123 TLPLYALVTQMGSTMKPVIFNDRVATALKKW-HIAAKKHVKHKNASPASAPG 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23527 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43002 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26030 254 1e-69 >Contig26030 Length = 246 Score = 254 bits (648), Expect = 1e-69, Method: Compositional matrix adjust. Identities = 119/190 (62%), Positives = 162/190 (85%) Query: 21 LASQTAFSVSEVEALFELFKSISSSVIDDGLINKEEFQLALFKNRKKENLFANRIFDLFD 80 LA +T F+V+E+EAL+ELFK +SSS+IDDG I+KEE QLALF+ + ENLF +R+FDLFD Sbjct: 57 LADETRFTVNELEALYELFKKLSSSIIDDGSIHKEELQLALFQTPQGENLFLDRVFDLFD 116 Query: 81 VKRKGVIDFGDFVRSLNVFHPNAPQEDKIDFSFKLYDLDSTGFIERQEVKQMLIALLCES 140 K+ GVI+F +FV +LN+FHP AP +DKIDF+F+LYDL TGFIER+EVKQM+IA+L ES Sbjct: 117 EKKNGVIEFDEFVHALNIFHPYAPIDDKIDFAFRLYDLRQTGFIEREEVKQMVIAILMES 176 Query: 141 EMKLADETIEIILDKTFLEADVNQDGRIDKSEWQNFVSRNPSLLKIMTLPYLRDITTTFP 200 ++KL D+ +E I++KTF +AD ++DG+I+K EW+ FV R+PSLLK MTLPYL+DITT FP Sbjct: 177 DVKLPDDILEEIIEKTFADADADKDGKINKEEWKVFVLRHPSLLKNMTLPYLKDITTVFP 236 Query: 201 SFVFNSEVDE 210 S++F++EV++ Sbjct: 237 SYIFHTEVED 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20760 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10840 150 2e-38 >Contig10840 Length = 440 Score = 150 bits (379), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 62/94 (65%), Positives = 79/94 (84%) Query: 22 PTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSSFVRQLN 81 P PFLTKTY LVDDP+ + ++SW E GS+F+VW P EFA+++LP YFKHNNFSSFVRQLN Sbjct: 12 PAPFLTKTYDLVDDPSSNHMVSWTESGSSFVVWDPTEFAKEMLPMYFKHNNFSSFVRQLN 71 Query: 82 TYGFRKVVPDRWEFANDYFRKGEKALLRDIQRRK 115 TYGFRK+ P++WEFAN+ F +G + LL++I RRK Sbjct: 72 TYGFRKIDPEQWEFANEEFLRGGRHLLKNIHRRK 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54217 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9875 130 2e-32 >Contig9875 Length = 275 Score = 130 bits (327), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 77/213 (36%), Positives = 126/213 (59%), Gaps = 2/213 (0%) Query: 55 TRFSTVVAVAAEDINTDDSSPQESKSSVRPCELYVCNLPRSCGISELLSMFKPHGTVQSI 114 +RF VAV++E ++ + ++S P +L+V NLP S ++L +F+ G V+ + Sbjct: 59 SRFVRNVAVSSEFEQDEEVLSDDGEASPEP-KLFVGNLPFSVDSAQLAGIFESAGNVEMV 117 Query: 115 EVCRNAETGVSRGSGYVTMSSMREAKAAIAALDGFDVGGREMRVRFSTDMNFRRRNSEAL 174 EV + TG SRG G+VTMS+++EA++A L+G+++ GR +RV + +S Sbjct: 118 EVIYDKTTGRSRGFGFVTMSNVQEAESAARQLNGYELDGRALRVNYGPPPPRTEDSSFRG 177 Query: 175 NSAPMRNLIFESPYKLYVGNLAWAIKPEDLRNHFSQFGTVVSARVVHDRKAGKHRAYGFL 234 P ++S +LYVGNLAW + L N FS+ G V+ A+VV DR +G+ R +GF+ Sbjct: 178 ARGPRGGGGYDSNNRLYVGNLAWGVDNLALENLFSEQGKVLEAKVVFDRDSGRSRGFGFV 237 Query: 235 SFSSAAECEAAM-FLNGKEFRGRSLVVSAGMKR 266 ++ +A E +A+ L+G + GRS+ VSA R Sbjct: 238 TYDTADEMNSAIESLDGVDLNGRSIRVSAAEPR 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65232 (85 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30500 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53533 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44029 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54977 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22842 384 e-109 >Contig22842 Length = 209 Score = 384 bits (987), Expect = e-109, Method: Compositional matrix adjust. Identities = 183/209 (87%), Positives = 200/209 (95%) Query: 1 MDWGNVTAEDLIDALREVDWSTPPRPLSEFFSRFTLPRSYSKWSSRLKCNFYYYRTNYFI 60 MDWGNVTAED+IDALREVDWS+PPRPLSEFFSRFT+PRS SKW+SRLKCN YYYRTNYF+ Sbjct: 1 MDWGNVTAEDVIDALREVDWSSPPRPLSEFFSRFTIPRSSSKWNSRLKCNLYYYRTNYFL 60 Query: 61 MIVFILGMGFLRRPIAIVAAFLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP 120 +IV +LG+ FLR P+A++AA LTALSIAFLNDSFAGTFSEKV+RTVRQFSPHLAAKMRPP Sbjct: 61 LIVLVLGLAFLRSPLALIAAVLTALSIAFLNDSFAGTFSEKVSRTVRQFSPHLAAKMRPP 120 Query: 121 LTPVIRGRPSAKRSILICGRPRWVFVLIFSSVSFILWFVSCSILTVLWALAIGLLATILH 180 LTPVIRGRPSAKR+I ICGRPRWVFV+IFSSVSFILWFVSC +LTVLWALA GLLAT+LH Sbjct: 121 LTPVIRGRPSAKRAIFICGRPRWVFVMIFSSVSFILWFVSCGLLTVLWALAFGLLATLLH 180 Query: 181 ASFRTPNLKARLNTFREEFRAVWRNYSEL 209 ASFRTPNLKARLNT+REEFRAVWRNYSEL Sbjct: 181 ASFRTPNLKARLNTYREEFRAVWRNYSEL 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4195 (462 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38834 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19271 (485 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8012 319 7e-89 >Contig8012 Length = 211 Score = 319 bits (817), Expect = 7e-89, Method: Compositional matrix adjust. Identities = 158/215 (73%), Positives = 176/215 (81%), Gaps = 10/215 (4%) Query: 256 VSSPHLIPCFNPSAYGKDRPSLVHQGSLSSTEDISKVPGSRVKGIACGGRHSAVITDAGQ 315 VSSPH+IPC PSA GKDR S++ QGS KVPGS VK IACGGRHSAVITDAG Sbjct: 1 VSSPHVIPCIEPSASGKDRSSVISQGS--------KVPGSYVKEIACGGRHSAVITDAGA 52 Query: 316 LLTFGWGLHGQCGLGNTHDQLRPACVSALSGVKVTGIAAGLWHTLCFSAEGQVYAFGGNQ 375 LLTFGWGL+GQCG GNT DQLRP+ V +LS KV IAAGLWHTLC S +G+VYAFGGNQ Sbjct: 53 LLTFGWGLYGQCGQGNTIDQLRPSYVKSLSETKVKNIAAGLWHTLCVSVDGRVYAFGGNQ 112 Query: 376 FGQLGTGADQAE--TLPKLLDASNLENKRAKIVSCGARHSVVLTEGGEIFSWGWNKYGQL 433 FGQLGTGAD+ E TLPK+LD+ L +K AK+ SCGARHSV+LTE G++FSWGWNKYGQL Sbjct: 113 FGQLGTGADEGELQTLPKILDSPGLGSKHAKVASCGARHSVILTEDGQLFSWGWNKYGQL 172 Query: 434 GLGDCIDRNIPSPVSIGGCQLKNVACGWWHTLLLA 468 GLGD +DRNIPS VSI GC LKN+ACGWWHTLLLA Sbjct: 173 GLGDAVDRNIPSQVSIEGCLLKNIACGWWHTLLLA 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv866 (218 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv941 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29853 309 2e-86 >Contig29853 Length = 183 Score = 309 bits (791), Expect = 2e-86, Method: Compositional matrix adjust. Identities = 150/183 (81%), Positives = 160/183 (87%), Gaps = 2/183 (1%) Query: 1 MVKYSREPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLAKAKRYLEDVLVHKQAIPF 60 MVKYSREP+NPTKSCKA+G LRVHFKNTRETAHAIRK+ LAKAKRYLEDVL HKQAIPF Sbjct: 1 MVKYSREPNNPTKSCKAQGEGLRVHFKNTRETAHAIRKMHLAKAKRYLEDVLAHKQAIPF 60 Query: 61 TRFCRGVGRTAQAKNRHSNGQGRWPVKSAKFILDLLKNAESNADLKGLDVDSLYISHIQV 120 RFCRGVGRTAQAKNR SNGQGRWPVKSA FILDLLKNAESNA++KGLDVDSLY+SHIQV Sbjct: 61 RRFCRGVGRTAQAKNRQSNGQGRWPVKSANFILDLLKNAESNAEVKGLDVDSLYVSHIQV 120 Query: 121 NQAQKQRRRTYRAHGRINPYMSSPCHIELILSXXXXXXXXXXXTQLATGKSKK--SLRGG 178 NQAQKQRRRTYRAHGRINPYMSSPCHIELILS TQLA KS+K +L+ G Sbjct: 121 NQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEAVKKEPDTQLAPRKSRKGQALQSG 180 Query: 179 AST 181 AS+ Sbjct: 181 ASS 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41557 (397 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60295 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8707 255 4e-70 >Contig8707 Length = 249 Score = 255 bits (652), Expect = 4e-70, Method: Compositional matrix adjust. Identities = 141/256 (55%), Positives = 170/256 (66%), Gaps = 18/256 (7%) Query: 1 MSTSGHTIEVTSLSPKVTEKDVYDFFAFSGAIERVEMVRSADECACTAYVTFKDAYAVET 60 M G+T EVTSLSPK TE+DVY+FF GA+E VE++RS E A TAYVTF+DA+A++T Sbjct: 1 MYPGGYTAEVTSLSPKATEEDVYNFFGHCGAVEHVEIIRSG-EYASTAYVTFRDAFALQT 59 Query: 61 AVLLSGATIVDQRVCITRWGHYEDEFDLWNRPTWKLEDETSSTHAPETNRSYPDAGEAVT 120 A+LLSGA IVDQ VCIT WG Y DE D WN T+ + +S+T+ S P GEAVT Sbjct: 60 AILLSGARIVDQCVCITSWGSYIDESDAWNGSTYPEGNTSSTTYHSSQFVSTP--GEAVT 117 Query: 121 MAQEVVKTMLAKGYILGKDALSKAKTFDESHQLSATAVATVAELSQRIGLTDKFCAGVEA 180 VVKT+ +KGY+LGKDAL+KAK FDESHQLSATA A V ELS RIGLT+K AG E Sbjct: 118 ----VVKTLASKGYVLGKDALTKAKAFDESHQLSATAAAKVCELSDRIGLTEKIHAGREV 173 Query: 181 AKSVDQRYHVSEITKXXXXXXXXXXXXXXXXX-----------XXXXYFSKGALWVSDAL 229 K+VD+++HVS+ITK YF+KGALW SD L Sbjct: 174 VKTVDEKFHVSDITKSAATVTGTAVVVAATYTGEAAVAAGSAVVNSSYFAKGALWFSDVL 233 Query: 230 SRAAKAAGDLGSHGVN 245 +RA+KAA DLGSHG N Sbjct: 234 TRASKAAADLGSHGGN 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5032 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47772 (170 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48554 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11635 183 1e-48 >Contig11635 Length = 418 Score = 183 bits (465), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 90/158 (56%), Positives = 107/158 (67%), Gaps = 5/158 (3%) Query: 1 MLLGASDGYSGDIIMQVTVAFNHFGRGLIQRMPRCRWGFFHVVNNDYTHWNMYAVGGSAH 60 MLLG SD Y+ D MQ+T+AFNHFG GL+QRMPRCR G+FHVVNNDYTHW MYA+GGSA Sbjct: 266 MLLGHSDSYTNDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAD 325 Query: 61 PTIVSQGNRYVAAPLMDPKHDAKEVTKRDHATKAEWSKWTWRSEGDLMVNGAFFVQSGVP 120 PTI SQGNR+ A + +KEVTK + A ++EW W WRSEGDLM+NGAFF SG Sbjct: 326 PTINSQGNRFAAPDI----RSSKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFTASGAG 381 Query: 121 FKKKPFSRYDMIKAKPGKFVPRLTRYSGALTCWRTSPC 158 + AKP V +T SGAL+C + S C Sbjct: 382 ASSSYARAS-SLGAKPSSLVGAITTASGALSCRKGSRC 418 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55522 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54745 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56146 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48121754 221 4e-60 >48121754 Length = 106 Score = 221 bits (564), Expect = 4e-60, Method: Compositional matrix adjust. Identities = 104/106 (98%), Positives = 106/106 (100%) Query: 1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFS 60 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQF+ Sbjct: 1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 Query: 61 EEYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 E+YPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13930 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22768 (294 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50063 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14039 (240 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55440 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30686 (268 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20504 66 8e-13 >Contig20504 Length = 232 Score = 65.9 bits (159), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 38/123 (30%), Positives = 61/123 (49%), Gaps = 5/123 (4%) Query: 146 KNVETNLKQ-----GDLRGSATVHELTWGXXXXXXXXXXXXXYVLGSDVIYSEGAVADLL 200 +NVE N + D GS EL+WG Y++G+DV+Y E + LL Sbjct: 2 RNVERNTSRITQMNSDSFGSIQAAELSWGNDDHVRAVEPPFDYIIGTDVVYKENLLEPLL 61 Query: 201 ATLMQLCGAQTTIVLAGELRNDSILEYFLEAAMKDFMVGRVDQTQWHPDYCSPRVVIYIL 260 T+ L G +TTI++ E+R+ S+ E L+ ++F V V ++ Y P + +YI+ Sbjct: 62 QTIHALSGPKTTILMGYEIRSTSVHEQMLQMWKRNFEVKTVPNSKMDSTYQHPDIQLYIM 121 Query: 261 VKK 263 K Sbjct: 122 TLK 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6463 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50297 (114 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13463 (308 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11703 530 e-153 >Contig11703 Length = 308 Score = 530 bits (1366), Expect = e-153, Method: Compositional matrix adjust. Identities = 253/308 (82%), Positives = 278/308 (90%) Query: 1 MAEKSKILIIGGTGYIGKFVVQASAKSGHPTFALVRESTIADPVKGKLIQEFKNSGVTLL 60 MAEKSKILIIGGTGYIGKFVV+ASAK+GHPTFALVREST+ DP K LI++FKN GVTLL Sbjct: 1 MAEKSKILIIGGTGYIGKFVVEASAKAGHPTFALVRESTVKDPAKANLIEKFKNLGVTLL 60 Query: 61 HGDLYDHDSLVKAIKQVDVVISTVGFMQLADQVKIIAAIKEAGNVKRFLPSEFGNDVDRV 120 +GDLYDH+SLVKAIKQVDVVISTVGFMQ ADQ KIIAAIKEAGN+KRF PSEFGNDVDRV Sbjct: 61 YGDLYDHESLVKAIKQVDVVISTVGFMQTADQTKIIAAIKEAGNIKRFFPSEFGNDVDRV 120 Query: 121 NAVEPAKSAFAAKVQMRRAIEAEGIPYTFVVANCFAGYFLPTLVQPGVSAPPRDKVIILG 180 +AVEPAKS F KVQ+RRAIEAEGIPYT+V +NCFAGYFLP+L QPG ++PPRDKV ILG Sbjct: 121 HAVEPAKSTFDLKVQIRRAIEAEGIPYTYVSSNCFAGYFLPSLAQPGATSPPRDKVTILG 180 Query: 181 DGNPKACFNREDDIGTYTIKAVDDPRTLNKILYIKPPNSTLSFNELVSLWESKIGKTLEK 240 DGNPKA FN+EDDIGTYTI+AVDDPRTLNKILY+KPP + SFNELV+LWE KIGK LEK Sbjct: 181 DGNPKAVFNKEDDIGTYTIRAVDDPRTLNKILYLKPPQNIYSFNELVALWEKKIGKVLEK 240 Query: 241 VYVPEEQVLKDIQEAPMPINVFLSIQHSVFVNGDQTNFEIEPSFGVEASELYPDVKYCTV 300 VYVPE+++LKDI EAP+PINV L+I HSVFV GD TNFEIEPSFGVEA ELYPDVKY TV Sbjct: 241 VYVPEDKILKDIAEAPIPINVILAINHSVFVKGDHTNFEIEPSFGVEAYELYPDVKYTTV 300 Query: 301 DEYLSAFV 308 DEYL FV Sbjct: 301 DEYLDQFV 308 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19474 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25553 (148 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3492 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42846 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46739 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10721 199 4e-53 >Contig10721 Length = 178 Score = 199 bits (505), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 6/158 (3%) Query: 2 PPDPVAVLRGHRASVTDVCFHPSNSILFTGSSDGELRIWDTVQHRTVSSAWVHSAAHGVV 61 PPDPVAVLRGHRASV D+ FHPS +LFTGSSDGELRIWDT+QHRTVSSA VH+AAHG+ Sbjct: 8 PPDPVAVLRGHRASVMDLSFHPSQPLLFTGSSDGELRIWDTIQHRTVSSAGVHNAAHGIA 67 Query: 62 CVAASPLIGDNKLVSQGRDGTVKYWDIEEGGLSRSPSLTIKTNAYHFCKLSLMKKPCACA 121 V+ + N+++SQGRDGTVK WDIE GGL R+PS+TIKTN+YHFCKLSL+K+P +C+ Sbjct: 68 SVSCTA----NRVISQGRDGTVKCWDIEGGGLPRTPSVTIKTNSYHFCKLSLVKRPQSCS 123 Query: 122 RQAEGPK--NYHDMDVKDTVDAEMLNDSSGKAQESLTE 157 + +G K + D V+ T D + L+DS + +L E Sbjct: 124 TRVDGVKCQDGEDRRVRGTTDEDTLDDSRDNVEGNLPE 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7682 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4842 367 e-103 >Contig4842 Length = 401 Score = 367 bits (941), Expect = e-103, Method: Compositional matrix adjust. Identities = 173/197 (87%), Positives = 186/197 (94%), Gaps = 1/197 (0%) Query: 25 VQDPELVVEEVHKRINASRRNLGFLSCGTGNPIDDCWRCDPDWEKNRQGLADCSIGFGRH 84 V+DPELV++EV + INASRRNLG+LSCGTGNPIDDCWRCDP+WEKNRQ LADC+IGFG+H Sbjct: 24 VKDPELVMQEVQESINASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGKH 83 Query: 85 AIGGRDGEIYVVTDSGDDDPVNPKPGTLRYAVIQKEPLWIIFQRDMVIKLKEELIMNSFK 144 AIGGRDG+IYVVTDSGD PVNPKPGTLRY VIQ EPLWIIFQRDM IKL EEL+MNSFK Sbjct: 84 AIGGRDGKIYVVTDSGDH-PVNPKPGTLRYGVIQNEPLWIIFQRDMTIKLNEELMMNSFK 142 Query: 145 TIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNANVRDSPDHYGWRTISDGDG 204 TIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNA VRDSP+H+GWRT+SDGDG Sbjct: 143 TIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHFGWRTLSDGDG 202 Query: 205 VSIFGGSHVWVDHCSLS 221 VSIFGGSHVWVDH SLS Sbjct: 203 VSIFGGSHVWVDHNSLS 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30030 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36678 (134 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38964 (223 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60290 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50787 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20523 417 e-118 >Contig20523 Length = 311 Score = 417 bits (1072), Expect = e-118, Method: Compositional matrix adjust. Identities = 202/255 (79%), Positives = 220/255 (86%) Query: 24 QTEETKSADVNGPRXXXXXXXXXXXXXXXYIIGITFAVTDISYLLSSTNDAGGYAIAEVF 83 TEETK+AD NGP+ YI+GITFAVT+I YLL N+AGGYAIAE+F Sbjct: 56 MTEETKNADTNGPKGIISSIVISIIVGWGYILGITFAVTNIPYLLDENNEAGGYAIAEIF 115 Query: 84 YQAFKSRYGSGVGGIICLGVVAVAIFFCGMGSVTSNSRMAYAFSRDGAMPFSPLWHKVNS 143 Y AFKSRYGSGVGGI+CLGVVAVAIFFCGM SVTSNSRM YAFSRDGAMP SP WHKVN Sbjct: 116 YLAFKSRYGSGVGGIVCLGVVAVAIFFCGMSSVTSNSRMVYAFSRDGAMPLSPFWHKVNK 175 Query: 144 QEVPINAVWLSAAISFCMALTSLGSLVAFQAMVSIATIGLYIAYALPIFFRVTLARKSFI 203 EVP+NAVWLSA ISFCMALTSLGSLVAF AMVSIATIGLYIAYALPIFFRVT+ARKSF+ Sbjct: 176 HEVPVNAVWLSAFISFCMALTSLGSLVAFNAMVSIATIGLYIAYALPIFFRVTMARKSFV 235 Query: 204 PGPFNLGRYGILVGWVAVLWVITISVLFSLPVAYPITTETLNYTPVAVGGLLFLAVASWI 263 PGPFNLGRYG++VGW++VLWV TISVLFSLPVAYPIT ETLNYTPVAVGGLL + V +WI Sbjct: 236 PGPFNLGRYGVVVGWISVLWVATISVLFSLPVAYPITIETLNYTPVAVGGLLIITVLAWI 295 Query: 264 ISARHWFKGPITNID 278 +SARHWFKGPITNI+ Sbjct: 296 LSARHWFKGPITNIE 310 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57061 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30481 208 3e-56 >Contig30481 Length = 160 Score = 208 bits (530), Expect = 3e-56, Method: Compositional matrix adjust. Identities = 103/160 (64%), Positives = 115/160 (71%), Gaps = 2/160 (1%) Query: 1 MSIAPSLPRLHSSFICCXXXXXXXXXX--XXHKFARNQRSPASYPRIRALDLDQNTXXXX 58 MS APSLPRL S F+ C HKF+ NQRSP SYP IRA+DLDQNT Sbjct: 1 MSQAPSLPRLRSPFLSCPLKLSTSPSSFCASHKFSGNQRSPKSYPCIRAIDLDQNTVVAI 60 Query: 59 XXXXXXXXXXXXXPIFYETQIDNAAKRENTQPCFPCDGSGAQRCRFCMGTGNVTVVLGGD 118 P+FYE+QID+AAKR+NTQPCFPC+G+GAQ+CRFC G+G VTV LGG Sbjct: 61 SVGLVSVAVGIGIPVFYESQIDSAAKRDNTQPCFPCNGTGAQKCRFCTGSGTVTVELGGG 120 Query: 119 EKEVSRCINCDGAGSLTCTTCQGSGIQPRYLDRREFKDDD 158 EKEVS CINC+G GS TCTTCQGSGIQPRYLDRREFKDDD Sbjct: 121 EKEVSNCINCEGVGSFTCTTCQGSGIQPRYLDRREFKDDD 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31139 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 50891356 111 7e-27 >50891356 Length = 73 Score = 111 bits (278), Expect = 7e-27, Method: Compositional matrix adjust. Identities = 51/72 (70%), Positives = 60/72 (83%) Query: 127 NMPLQLCEERDAKGLYKLARAGKIKGFTGIDDPYEPPLNCEIEIQQKDGVCPSPNDMAGD 186 ++PL +CE RD KGLYKLARAGKIK FTG+DDPYEPPL CEI +QQK G C SP +MA Sbjct: 1 DVPLHVCENRDPKGLYKLARAGKIKSFTGVDDPYEPPLKCEIVLQQKGGDCVSPGEMAET 60 Query: 187 VVTYLEEKGFLQ 198 V++YLEEKG+LQ Sbjct: 61 VISYLEEKGYLQ 72 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41033 (703 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10804 370 e-104 >Contig10804 Length = 576 Score = 370 bits (949), Expect = e-104, Method: Compositional matrix adjust. Identities = 238/570 (41%), Positives = 304/570 (53%), Gaps = 74/570 (12%) Query: 15 LLELAANNDVGRFKQSIEREPSGVDEIGQWYGRQKGSKQMVLEYRTPLMVAATYGSIDVM 74 L+EL+A++++ F+ +E + VDE G WYGR+ GSKQM E RTPLM+AA +GS V+ Sbjct: 27 LVELSASDNLDAFRTEVEEKGFHVDEAGFWYGRRIGSKQMGFEERTPLMIAAMFGSTKVL 86 Query: 75 KLILSLSDSDVNRFCGLDKSTALHCAASGGSVNAVDVVKLLLLVGADPNSLDANGHRPVD 134 K I+ DVNR CG D+ TALHCAA+GGS +++VVKLLL AD N ++A G+ PVD Sbjct: 87 KYIIESGMVDVNRSCGSDRVTALHCAAAGGSTASLEVVKLLLDASADANCVNAYGNSPVD 146 Query: 135 VLVVPPKLQD----VKATLEELLATNGSSVERXXXXXXXXXXXXXXXXXXXXXXXXXXXX 190 ++ P L+ + +E L + S +E Sbjct: 147 LIA--PALKSPCSSRRKAMEMLFRGDKSVME-------------------------SDQI 179 Query: 191 XXXXXXXXXVKLNDLPISCASEKKEYPVDPSLPDIKNSIYATDEFRMFSFKVRPCSRAYS 250 V +P S+KKEYP+D SLPDI N IY TDEFRMF+FKV+PCSRAYS Sbjct: 180 AIEEGDQRKVSSPQMPKE-GSDKKEYPIDISLPDINNGIYGTDEFRMFTFKVKPCSRAYS 238 Query: 251 HDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQY 310 HDWTECPFVHPGENARRRDP+K+ YSCVPCP+FRKG+C++GD CEYAHGVFE WLHPAQY Sbjct: 239 HDWTECPFVHPGENARRRDPKKYPYSCVPCPEFRKGSCQKGDACEYAHGVFESWLHPAQY 298 Query: 311 RTRLCKDGTNCNRRVCFFAHTTEELRPLYMSTGXXXXXXXXXXXXXXXMDFATAMNLIXX 370 RTRLCKD T C R+VCFFAH EELRP+Y STG M + + L Sbjct: 299 RTRLCKDETGCTRKVCFFAHRPEELRPVYASTGSAMPSPRSMSVSAADMATLSPLAL--- 355 Query: 371 XXXXXXXXXXXXXXXXXXXXANGVSHSSMGWAQPNV----PTLHLPGXXXXXXXXXXXXX 426 A S + G Q V PTL LPG Sbjct: 356 --GSSAMSMPITSTPPMSPLAAASSPKNGGLWQNKVSLTPPTLQLPG-----SRLKSACS 408 Query: 427 ARDIPAEDINLMLD-------FDIQQHQLLNELSCLSQPCVNSNSLNRSGRSKTLTPSNL 479 ARD+ E L LD QQ QL +E+S LS +S +R G L P+NL Sbjct: 409 ARDLELEMELLGLDSHSSQQHQQHQQQQLWDEISRLS----SSPPYSRLGE---LKPTNL 461 Query: 480 DELFSAESSSPRYSDQALASAVYSPTHKSAVLNQFQQQQSMLSPINTNFSPKNVDHPLLQ 539 ++ F + S QA + +PTH+ Q + S TN S V P Sbjct: 462 EDAFGSFDPSLLSQLQAHSQKPSTPTHR-------QNMNQLRSSYPTNLSSSPVRKP--- 511 Query: 540 ASFASSGRMSPRSMEPISPMSSRASMFAQR 569 +S G SP ++ + M+SR++ FAQ+ Sbjct: 512 ---SSFGLDSPSALA-AAVMNSRSAAFAQQ 537 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20370 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9656 107 1e-25 >Contig9656 Length = 171 Score = 107 bits (266), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 43/80 (53%), Positives = 67/80 (83%) Query: 6 EYRCFIGGLSWSTSDRSLKEAFEKFGHLVEAKVVVDKFSGRSRGFGFVSFDDKQAMEDAI 65 E+RCF+GGL+W+T + +L+ AF ++G ++E+K++ D+ +GRSRGFGFV+F +QAM DAI Sbjct: 7 EFRCFVGGLAWATDNEALERAFSQYGEIIESKIINDRETGRSRGFGFVTFGSEQAMRDAI 66 Query: 66 KEMHGMDLDGRSITVDKAQP 85 + M+G +LDGR+ITV++AQ Sbjct: 67 EGMNGQNLDGRNITVNEAQS 86 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6854 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38339 (284 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6580 155 8e-40 >Contig6580 Length = 269 Score = 155 bits (391), Expect = 8e-40, Method: Compositional matrix adjust. Identities = 86/162 (53%), Positives = 96/162 (59%), Gaps = 21/162 (12%) Query: 5 KAVFGEKEWYFFSPRDRKYPNGLRPNRAAASGYWKATGTDKTIXXXXXXXXXXXXXXXXX 64 KA FGE+EWYFFSPRDRKYPNG RPNRAA SGYWKATGTDK + Sbjct: 63 KATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPV-----LSSIGNHKVGVK 117 Query: 65 XALVFYQGRPPKGIKTNWIMHEYRLAQPPNPAIN--KPPLKLRDA-----SMRLDNWVLC 117 ALVFY G+PPKG KTNWIMHEYRL IN K DA S+RLD+WVLC Sbjct: 118 KALVFYGGKPPKGTKTNWIMHEYRLVNNTTTTINMSSSTTKPSDAANKKPSLRLDDWVLC 177 Query: 118 RIYKKSNAVPPATAAAIDDDR-----EQEDSFMEESLKSHPN 154 RIYKK+ +ID D E +S MEE + HP+ Sbjct: 178 RIYKKNK----GPVMSIDGDHFLHKAEDSNSSMEEGMFLHPS 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4686 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30228 (378 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10309 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1885 (65 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48941 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11916 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv601 (88 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60434 (83 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3886 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26266265 (155 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59040 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2297 (309 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23174 (207 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21324 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27037 205 4e-55 >Contig27037 Length = 227 Score = 205 bits (522), Expect = 4e-55, Method: Compositional matrix adjust. Identities = 126/229 (55%), Positives = 141/229 (61%), Gaps = 39/229 (17%) Query: 1 MTSGFGESTSRPPQSPSFSSN-----------------------------------KWQQ 25 M SGFGESTS PPQS S S N +W Sbjct: 1 MASGFGESTSVPPQSVSCSGNNANDVGDFECNICFELAQDPIITRCGHLFCWPCLYRWLH 60 Query: 26 IQSHSQECPVCKALVEEEKLVPLYGRGKTSTDPRSKSIPGINIPNRPTGQRPETAPPPDA 85 S+SQECP CKAL+EEEKLVPLYGRGKT TDPRSKS PGINIPNRP+GQRP TAPPP+ Sbjct: 61 HHSNSQECPFCKALIEEEKLVPLYGRGKTQTDPRSKSYPGINIPNRPSGQRPPTAPPPNT 120 Query: 86 NHFMQHXXXXXXXXXXXAPMATARFGNFTLSAAFGGLFPSLFNLQVHGFPDATMYGPAAG 145 N F + PMAT R GNFTL+ AFGGL PSL N+Q HGFPDAT+YG +G Sbjct: 121 NQFANY---GFGFMGGFVPMATQRIGNFTLATAFGGLLPSLLNVQYHGFPDATVYGTTSG 177 Query: 146 FPYGFSNSFHGGHAHGFPQHPPTQGQQADYYLKMLFLMIGVFVIIALIW 194 FP+ NSFHGGH HGF Q Q Q AD + K FL IGVFVI+A+I+ Sbjct: 178 FPFAPFNSFHGGHGHGFVQPENHQWQPADVW-KYFFLFIGVFVIMAVIF 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33977 (329 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2967 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11077 111 2e-26 >Contig11077 Length = 317 Score = 111 bits (277), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 64/149 (42%), Positives = 91/149 (61%), Gaps = 12/149 (8%) Query: 4 AFEFIINNGGIDSEEDYPYKASDGRCDQYRKNARVVTIDGYEDVPENDEKSLEKAVAN-Q 62 AFE+I NGG+D+E YPY DG C +N V +D ++ E+ L+ AVA + Sbjct: 172 AFEYIKYNGGLDTEAAYPYVGVDGACKFSSENVGVQVVDSV-NITLGAEEELKHAVAFVR 230 Query: 63 PVSVAIEAGGREFQLYQSGIFTG-RCGTA---LDHGVTAVGYGTENGVDYWIVKNSWGAS 118 PVSVA + + F+ Y+SG++T CG++ ++H V AVGYG E+GV +W++KNSWG S Sbjct: 231 PVSVAFQVV-QSFRFYKSGVYTSDTCGSSSMDVNHAVLAVGYGVEDGVPFWLIKNSWGQS 289 Query: 119 WGEEGYIRMERDLATSATGKCGIAMEASY 147 WG+ GY +ME CG+A ASY Sbjct: 290 WGDNGYFKMEY-----GKNMCGVATCASY 313 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29255 (175 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13466 93 3e-21 >Contig13466 Length = 361 Score = 92.8 bits (229), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 43/110 (39%), Positives = 67/110 (60%), Gaps = 1/110 (0%) Query: 1 MGTFGYVAPEYASTGMLNERSDVYSFGILLMEIISGRNPVDYSRPPGEVNLVEWLKAMVT 60 +GTFGY APEYA TG L ++SDVYSFG++L+E+++GR PVD++ P G+ +LV W ++ Sbjct: 241 LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS 300 Query: 61 NRNAEGVLDPKIPEKPSSXXXXXXXXXXXXCVDPNAQKRPKMGHVIHMLE 110 + +DPK+ + P+ CV ++ RP M V+ L+ Sbjct: 301 EDKVKQCVDPKLKDYPAK-GVAKLAAVAALCVQYESEFRPNMSIVVKALQ 349 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41793 (323 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28510 217 2e-58 >Contig28510 Length = 152 Score = 217 bits (553), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 109/136 (80%), Positives = 116/136 (85%) Query: 20 WMFNVVTSVGIIMVNKALMATYGFSXXXXXXXXXXXXXXXMTTVLRWLGYIQGSHLPVSE 79 WMFNVVTSVGII+VNKALMATYGFS MT VLRWLGYIQ SHLPVSE Sbjct: 17 WMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTVVLRWLGYIQPSHLPVSE 76 Query: 80 LLRFVLFANLSIVGMNVSLMWNSVGFYQIAKLSMIPVSCVLEVVLDKMRYSRDTKLSISL 139 LL+F++FAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSC+LEVVLDK+RYSRDTKLSI + Sbjct: 77 LLKFMVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIGI 136 Query: 140 VLLGVAVCTVTDVSVN 155 VLLGV VCTVTDVSVN Sbjct: 137 VLLGVGVCTVTDVSVN 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34301 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52996 (329 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24909 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv786 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18392 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8144 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33397 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9536 330 1e-92 >Contig9536 Length = 425 Score = 330 bits (845), Expect = 1e-92, Method: Compositional matrix adjust. Identities = 157/206 (76%), Positives = 179/206 (86%) Query: 11 RLMVVSDLDLTMVDHYDSENHSLLRFNALWEANYRHNSLLVFSTGRSPAIYKQLRKEKPL 70 RLM+VSDLD TMVDH+D+EN SLLRFN+LWEANYRH+SLLVFSTGRSP +YK+LRKEKP+ Sbjct: 9 RLMIVSDLDHTMVDHHDTENLSLLRFNSLWEANYRHDSLLVFSTGRSPTLYKELRKEKPM 68 Query: 71 LSPDITVMSVGTEIAYGESMVPDNDWVEFLNQNWDRNMVIEETRKFPELIPQSETEQRPH 130 L+PDIT+MSVGTEI YG +MVPD+ WVE LN+ WDRN+V EE KF EL Q+ETEQRPH Sbjct: 69 LTPDITIMSVGTEITYGNTMVPDDGWVEVLNKKWDRNIVKEEASKFSELKLQAETEQRPH 128 Query: 131 KVSFYIEKDKAGEVIKALSESLEKNGLDFKIIYSGGIALDVLPHGAGKGQALAYLLKRLK 190 KVSFY+EK KA EV KALSE K LD KIIYSGG+ LD+LP GAGKGQALAYLLK+LK Sbjct: 129 KVSFYVEKAKAQEVTKALSEVFVKRRLDVKIIYSGGMDLDILPQGAGKGQALAYLLKKLK 188 Query: 191 TEGKVPDNTLVCGDSGNDAELFSVPE 216 +EG+ P NTLVCGDSGNDAELFS+PE Sbjct: 189 SEGRPPVNTLVCGDSGNDAELFSIPE 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11866256 (301 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31700 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19490 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12925 59 7e-11 >Contig12925 Length = 218 Score = 58.9 bits (141), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 32/107 (29%), Positives = 58/107 (54%), Gaps = 1/107 (0%) Query: 89 PEKRSSPEWKKWMVVITLSIILPSYRHKWGPLVFLRSKXXXXXXXXXXXXXXXXXLGEDV 148 P S W+ WM+ + S+I+P +RHKWGPL+ L+ + + E V Sbjct: 74 PSVEYSKSWRGWMIGMVFSVIIPFWRHKWGPLLQLKKEVDMVVNNVEAVVEVVEKVAEKV 133 Query: 149 EKIAEALENKIPDQEAKLKEAVETIDRLAKDVVKETEEAKRLIQKVE 195 E++A+ + + +P + K + A E ++ +A++V K+ A +LI+K E Sbjct: 134 EEVADEIGDHLP-ADGKFRAASEVVESIAREVAKDAHLADQLIEKAE 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58465 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42823 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31784 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2940 94 1e-21 >Contig2940 Length = 312 Score = 94.4 bits (233), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 69/192 (35%), Positives = 89/192 (46%), Gaps = 24/192 (12%) Query: 18 EFSPDHDSFDDFLQDQESRYLEDGQSSNAESVELQLAV---DEAIARSLM--EEDFVDVS 72 E D D+FD D D + SVE AV DEA AR+L E+ + Sbjct: 134 EVDSDEDAFDLHAHD-------DAGEDDNPSVEYGPAVSSSDEAYARALQDAEDREMAAR 186 Query: 73 ISEPSGTAEGDTEVTENAEVRSVETSVAAVNQDNINPDDMTYEELQTLGESIGVESKGLS 132 + SG + DTE + E I+PD+++YEEL LGE +G E++GLS Sbjct: 187 LMALSGINDQDTEEHGGNSQDTWEE---------IDPDELSYEELLALGEVVGTENRGLS 237 Query: 133 VKQIASLQHXXXXXXXXXXXXXRIHKECVICCVQFKHNEELITLPCKHDYHKDCIAKWLE 192 IASL ++ CVIC + F+ E L L CKH YH +CI WL Sbjct: 238 ADTIASLPSVSYKTGSSQNGS---NESCVICRLDFEDGENLTILSCKHSYHSECINNWLT 294 Query: 193 IKKNCPVCQREV 204 I K CPVC EV Sbjct: 295 INKICPVCSAEV 306 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47125 (406 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12395 446 e-127 >Contig12395 Length = 323 Score = 446 bits (1146), Expect = e-127, Method: Compositional matrix adjust. Identities = 220/272 (80%), Positives = 232/272 (85%), Gaps = 10/272 (3%) Query: 107 MLADQMITRIEYVHSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDSTTNRHIP 166 MLADQMITRIE+ HSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRD+TTNRHIP Sbjct: 1 MLADQMITRIEFAHSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDATTNRHIP 60 Query: 167 YRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYD 226 YRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKA TKKQKYD Sbjct: 61 YRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKADTKKQKYD 120 Query: 227 KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLFTREGYEFDY 286 KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLF+REGYEFDY Sbjct: 121 KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLFSREGYEFDY 180 Query: 287 IFDWTILKYQQTQKSRNQPQLXXXXXXXXXXXXXXDVDRHQ--GGINASYSAEATERIRS 344 +FDWTI+KYQQ+QK+ + VD HQ GG +A Y AE T+RIRS Sbjct: 181 VFDWTIIKYQQSQKTGSP-----VPGGSNSHAMPVRVDSHQVAGGSSAPYPAEVTDRIRS 235 Query: 345 SNAAASSGIRMQFKS--TGKNLSSESPAEKNF 374 SN S G RMQFKS TG+NLS +P EKN Sbjct: 236 SNPTGSGG-RMQFKSPTTGRNLSYGNPLEKNI 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46792 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29781 (248 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55918 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38343 (264 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9578 (145 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17894 (228 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60577 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12672 149 1e-38 >Contig12672 Length = 318 Score = 149 bits (375), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 70/95 (73%), Positives = 84/95 (88%) Query: 1 MIVDVRDVADALLITYEKPEAEGRYICTAHMIKVRDLVEKLRSIYPNYNYPKNFTEVEEV 60 MIVDVRDVA+A+++ YEKPEAEGRYICTAH IK DLVE+L+SIYPNY+YPKNF EVEE Sbjct: 224 MIVDVRDVAEAVIMVYEKPEAEGRYICTAHNIKTTDLVEELKSIYPNYSYPKNFVEVEEQ 283 Query: 61 ENLSSEKLQKLGWSYRPLEESLVDSIKSYKEAGIL 95 LSSEKLQ+LG S+RPL+E+L S++SYKEAG+L Sbjct: 284 PRLSSEKLQRLGLSFRPLKETLTGSVESYKEAGLL 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60664 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15500 (509 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31992 127 3e-31 >Contig31992 Length = 566 Score = 127 bits (320), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 121/488 (24%), Positives = 208/488 (42%), Gaps = 50/488 (10%) Query: 21 SSTGPDIYSVTNDNLIINVYNSLTEPFLLSWSGVQQRRNSYEDG-VYGTTCPIPPGRNFT 79 S GP IY+ D LII+V N + W G+ Q +++ DG Y T CPIPPG+++T Sbjct: 51 SYPGPTIYAREGDTLIIHVLNQSPYNITIHWHGIYQLLSAWADGPAYVTQCPIPPGQSYT 110 Query: 80 YILQVKDQIGSFFYFPSLDFHKAAGGFGGIRILSRPRIPVPFPDPAGDITVLIGDWYKAN 139 Y + Q G+ ++ + + +A G + I + PFP PA ++ +++GDWY N Sbjct: 111 YKFNITGQEGTLWWHAHISWLRATV-HGALIIHPKAGQSFPFPKPAKEVPIILGDWYSGN 169 Query: 140 HTTLKAI-LDRGKKLHFPDGILINGRGPNGV---------SFTVEQGKTYRFRISNVGLQ 189 ++ L +G + + ING P + +V +GKTY R+ N L Sbjct: 170 VVDIEQEGLSKGIAPNLSNAYTINGL-PGDLYDCSQNQTYQLSVVRGKTYLLRLINAALN 228 Query: 190 NSLNFRIQDHKMVLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTADQPAQDFYIVVSTRFT 249 L F+I +H M +V ++ ++T + + GQ+ +LV +Q +Y+ + + Sbjct: 229 TQLFFKIANHNMTVVAIDASYTTPYDTDVVVIAPGQTTDILVKFNQLNGSYYMAATPYAS 288 Query: 250 SQVL------TTTGILRYSNSAXXXXXXXXXXXTIQIDWSLNQARSIRTNLTA--SGPR- 300 + TT GI+ Y D L A TNLT GP Sbjct: 289 ADDTVGFDNSTTRGIIVYKGYTSSTPIMPPMPN--PHDTPL--AHKFFTNLTGLPGGPHW 344 Query: 301 -PNPQGSYHYGMINTSRTIRLA----SSAGQVNGKQRYAVNSVSYV-PGDTPLKVADFFK 354 P P+ + + + + + G N + ++N+ S++ P +T + A F Sbjct: 345 VPVPRKVDEHMFVTVGVNLAMCPENTTCQGLFNNRFSASMNNESFMAPTNTSMLEAHFNN 404 Query: 355 IGGVFRVGSISDNP-----TGGGVYLDTSVMGA---------DFRAFVEIVFENPEDII- 399 + GV+ ++ P T + LD S++ A F + V++VF+N + Sbjct: 405 VNGVYTRDFPNEPPVKFDYTDTNLSLDLSLIFAPKSTKVKTLKFNSTVQLVFQNTAFLAI 464 Query: 400 --QSWHIDGYSFFVVGMDGGLWTA-NSRNQYNLRDAVARSTTQVYPKSWTAIYVALDNVG 456 H+ G+ F V+ G + N ++N + R+T V W I +N G Sbjct: 465 ENHPMHLHGFDFHVLAQGFGNYDPINDPKKFNFVNPQVRNTIGVPVGGWAVIRFRANNPG 524 Query: 457 MWNVRSEF 464 +W V Sbjct: 525 IWYVHCHL 532 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6236 (488 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13694 (385 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10810 217 2e-58 >Contig10810 Length = 250 Score = 217 bits (553), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 125/266 (46%), Positives = 156/266 (58%), Gaps = 26/266 (9%) Query: 88 PKCSASDPDQLKSAREDIKELLKSKFCHPLLVRLGWHDAGTYNKNIEEWPLRGGANGSLR 147 P S + AR ++ L+ K C PL++R+ WH AGTY+ + GG G++R Sbjct: 6 PTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKT----GGPFGTMR 61 Query: 148 FEIELKHGANAGLVNAVKLLQPIKDKYSGVTYADLFQLASATAVEEAGGPKIPMKYGRVD 207 E HGAN GL AV+LL+PIK ++ ++YAD +QLA AVE GGP +P GR D Sbjct: 62 CPAEQSHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRKD 121 Query: 208 ASGPEQCPEEGRLPDAGPPSPADHLRDVFYR-MGLNDKEIVALSGAHTLGRSRPERSGWG 266 A P P EGRLPDA DHLRDVF + MGL+DK+IVALSG HTLGR ERSG+ Sbjct: 122 APEP---PPEGRLPDA--TKGCDHLRDVFGKTMGLSDKDIVALSGGHTLGRCHKERSGFE 176 Query: 267 KPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKEKIDEELLVLPTDAILFEDPSFKVY 326 P WT L FDNSYF + E LL+LP+D L +DP F+ Sbjct: 177 GP----------------WTPNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPL 220 Query: 327 AEKYAVDQEAFFKDYAEAHAKLSNLG 352 EKYA D++AFF DYAEAH +LS LG Sbjct: 221 VEKYAADEDAFFADYAEAHMRLSELG 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27803 (218 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26371 (192 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65980 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13409 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7270 127 2e-31 >Contig7270 Length = 365 Score = 127 bits (318), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 63/198 (31%), Positives = 108/198 (54%), Gaps = 6/198 (3%) Query: 14 TLPQSYIRPEPERPRLSQVSECKHVPIIDLGK----DVNRAQLIQHIADACRLYGFFQVI 69 TL Q ++R E ERP+++ +PII L + R ++ + I AC +G FQ++ Sbjct: 16 TLQQKFVRDEDERPKVAYNDFSNEIPIISLAGIDEVEGRRGEICKKIVAACEDWGIFQIV 75 Query: 70 NHGVAAEMMEKMLEVADEFYRLPVEEKMKLYSDDPTKTMRLSTSFNVNKEKVHNWRDYLR 129 +HGV AE++ +M +A EF+ LP EEK++ + K S ++ E V +WR+ + Sbjct: 76 DHGVDAELISEMTGLAREFFALPSEEKLR-FDMSGGKKGGFIVSSHLQGEAVQDWREIVT 134 Query: 130 LHCYPLDQYT-PEWPSNPPSFKEIVSSYCKEVRELGFRLQEMISESLGLEKDHIKNVFGE 188 YP+ WP P +++E+ Y E+ L +L ++SE++GL+ + + + Sbjct: 135 YFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGLDTEALTKACVD 194 Query: 189 QGQHMAVNYYPPCPQPEL 206 Q + VN+YP CPQP+L Sbjct: 195 MDQKVVVNFYPKCPQPDL 212 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48365 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51286 (314 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4658 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 86 7e-19 >Contig2543 Length = 199 Score = 85.5 bits (210), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 60/177 (33%), Positives = 93/177 (52%), Gaps = 15/177 (8%) Query: 8 KCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANV-AVDGSIVNLGLWDTAGQED 66 K V +GD GKT +++ + + KF T+ F V +++ + + +WDTAGQE Sbjct: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 Query: 67 YSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFA-PNVPIVLVGTKLDLRED 125 Y L P+ YRGA V+ + + S S+ KKW+ E++R A P + + L G K DL ED Sbjct: 72 YHSLAPMYYRGAAAAVVVYDITSMDSFLRA-KKWVLEVQRQANPTLIMFLAGNKADL-ED 129 Query: 126 KGYLADHMGSNVITSAQGEELRKQIGAAAYIECSSKTQQNVKAVF-DTAIKVVLQPP 181 K + S +GE+ K+ G ++E S+KT QNV +F + A K+ P Sbjct: 130 K---------RKVGSEEGEQYAKENG-LVFLETSAKTAQNVNELFYEIAKKLAKASP 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50350 (390 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54245 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19053 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5588 301 6e-84 >Contig5588 Length = 223 Score = 301 bits (771), Expect = 6e-84, Method: Compositional matrix adjust. Identities = 151/230 (65%), Positives = 178/230 (77%), Gaps = 7/230 (3%) Query: 1 MVGANLKAEAMALMDRRTELEAQMNAIIQRLCQPGGPGISGSLVDSEGFPRSDIDIPTVR 60 MV NLK E M LM++RT LEA++NAII+RL QPGGPGISG+L+DSEGFPR DIDIP VR Sbjct: 1 MVRTNLKGETMGLMEKRTALEAEINAIIERLTQPGGPGISGNLLDSEGFPREDIDIPAVR 60 Query: 61 AERQRLAELRNDYKDITEKINENIQLLHSARLAPRSSLHKDLDNDEGSNNQGXXXXXXXX 120 AER+RLAELRND+K++TEK+N NI++LHSARL P+ S KD S+ Q Sbjct: 61 AERRRLAELRNDHKEVTEKLNRNIEVLHSARLTPKQSSLKD------SDGQSASVVNVVA 114 Query: 121 XXXXHNVLPRDTLTAMDVDATVSLPFAVVDEIAEASPAAEDGLQLGDRIVKFGNVEAGDN 180 NV T T MDVD VS+PFA+VDEIA+ SPAAEDGLQLGD+IVKFG+VE GDN Sbjct: 115 SASSTNVHTGSTNT-MDVDVIVSVPFALVDEIADESPAAEDGLQLGDQIVKFGSVENGDN 173 Query: 181 LLPRLASEAQTNHGHAIPVIVMRQGALINLTMTPRTWQGRGLLGCHFQML 230 LL +LASEAQ N G IPVI++RQGA +NLTMTPRTWQGRGLLGCH ++L Sbjct: 174 LLQKLASEAQANQGRGIPVILVRQGAQVNLTMTPRTWQGRGLLGCHLRIL 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv480 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27208 (343 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6991 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55033 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18352 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22683 110 1e-26 >Contig22683 Length = 265 Score = 110 bits (274), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 61/113 (53%), Positives = 77/113 (68%), Gaps = 3/113 (2%) Query: 21 REQDLEGLDMQTGSFTLKQIKAATKNFDFANKIG-GGFGPVYKGLLSDGTIVAVKQLSSI 79 ++ D EG D+ F L+ I AT F ANK+G GGFGPVYKG L G +AVK+LSS Sbjct: 92 KDDDTEGFDVPF--FDLESILVATDYFSNANKLGQGGFGPVYKGKLPGGQEIAVKRLSSC 149 Query: 80 SRQGNREFLNEIAMISCLQHPNLVKLHGFCVEGDQLLLVYEYMENNSLAGALF 132 S QG EF NE+ +I+ LQH NLV+L G+CVEG++ +LVYEYM N SL +F Sbjct: 150 SGQGLEEFKNEVLLIAKLQHRNLVQLLGYCVEGEEKMLVYEYMANKSLDSFIF 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22152 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24737 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1254 72 2e-15 >Contig1254 Length = 121 Score = 72.0 bits (175), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 33/48 (68%), Positives = 40/48 (83%) Query: 38 VQLVLANPGQVVIDKLHASKFADDIGEDKIFLTVGDAVVTCSPKLAEE 85 +QLVLANPG +VIDK+HAS + IGED+IFLTV +AV +CSPKL EE Sbjct: 73 IQLVLANPGPLVIDKIHASHVSTLIGEDRIFLTVAEAVSSCSPKLVEE 120 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48772 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22322 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14022 (487 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28888 466 e-133 >Contig28888 Length = 401 Score = 466 bits (1200), Expect = e-133, Method: Compositional matrix adjust. Identities = 226/382 (59%), Positives = 286/382 (74%), Gaps = 8/382 (2%) Query: 20 ITFFVFMCCVGNGNARITSAFVRSEFPSVDIPLDNKVFAVPKGYNAPQQVHITQGDYDGK 79 + V C G ITS++VR++ S+D+PLD+ VF VP GYN PQQVHITQGD++GK Sbjct: 23 MLLIVLEVCDGG----ITSSYVRNDDLSLDMPLDSDVFQVPPGYNVPQQVHITQGDHEGK 78 Query: 80 AVIVSWVTTDEPGPSKVKYGTSEKT-YDYTAEGTTTNYTFYKYQSGYIHHCLVDGLEFDT 138 VIVSWVT DEPG S V Y T +A+ T Y ++ Y SGYIHHC +D LEFDT Sbjct: 79 GVIVSWVTPDEPGSSTVIYWAENNTSLKKSAQATVLTYKYFNYTSGYIHHCTIDNLEFDT 138 Query: 139 KYYYKIGSGNSSREFWFQTPPEIDPDAPYIFGIIGDLGQTYNSLSTLEHYMH--SEGQTV 196 KYYY++G+GN++R FWF TPP + PD Y FG+IGDLGQT++S TL HY ++GQT+ Sbjct: 139 KYYYEVGTGNTARRFWFVTPPRVGPDVAYTFGLIGDLGQTHDSNDTLTHYELNPAKGQTL 198 Query: 197 LFLGDLSYADRYQYNDVGVRWDTWGRFVEQSAAYQPWIWSAGNHEIEYMPYMGEVLPFKS 256 LF+GDLSYAD Y ++D RWDTWGRFVE++ AYQPWIW+AGNHEI+++P +GE PFK Sbjct: 199 LFVGDLSYADDYPFHDNN-RWDTWGRFVERNVAYQPWIWTAGNHEIDFVPELGESTPFKP 257 Query: 257 YLYRFPTPYAASKSSSPLWYAIRRASAHIIVLSSYSPFVTYTPQWLWLAEEFKRVNREKT 316 Y R+ PY AS S+SPLWY+I+RASA+IIVLSSYS + YTPQ+ WL +E +VNR +T Sbjct: 258 YTNRYFVPYEASGSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEKELPKVNRTET 317 Query: 317 PWLIVLMHVPIYNSNEAHFMEGESMRAAFESWFILNKVDIVFAGHVHAYERSYRISNIHY 376 PWLIVLMH P+Y+S H+MEGES R +E WF+ +VD+VFAGHVHAYERS RISN+ Y Sbjct: 318 PWLIVLMHSPLYSSYVHHYMEGESFRVMYEEWFVEYEVDVVFAGHVHAYERSERISNVAY 377 Query: 377 SVSSGDPYPVPDESAPVYITVG 398 ++S+G P+ D SAPVYIT+G Sbjct: 378 NISNGLCTPLSDRSAPVYITIG 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40064 (275 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6587 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29202 (156 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21497 277 6e-77 >Contig21497 Length = 261 Score = 277 bits (708), Expect = 6e-77, Method: Compositional matrix adjust. Identities = 134/156 (85%), Positives = 145/156 (92%), Gaps = 2/156 (1%) Query: 1 MTVIDEHLIPASTAGESTVFYYKMKGDYYRYLAEFKTGNERKEAADQSLKAYQTASTTAE 60 M VIDEHLIP+ TA ESTVF+YKMKGDYYRYLAEFKTG++RKE ADQS+KAYQ AS+ AE Sbjct: 104 MRVIDEHLIPSCTAFESTVFFYKMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAE 163 Query: 61 SDLSPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLSEESYKDSTLI 120 +DL PTHPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAISELDTLSEESYKDSTLI Sbjct: 164 TDLPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLI 223 Query: 121 MQLLRDNLTLWTSDIPED-GED-QKMESSAKAGGDD 154 MQLLRDNLTLWTSDIPED GED QK++ SAK GG+D Sbjct: 224 MQLLRDNLTLWTSDIPEDGGEDIQKVDGSAKPGGED 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26595 (393 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14765 280 2e-77 >Contig14765 Length = 173 Score = 280 bits (717), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 128/172 (74%), Positives = 148/172 (86%) Query: 222 PELMGEDVQLVMLGSGNPEDEEWMRVMESTYRDKFRGWVGFNVPISHRITASCDILLMPS 281 P+LM +DVQ VMLGSG+P E+WMR E+TY+DKFRGWVGFNVP+SHRITA CDILLMPS Sbjct: 2 PQLMEDDVQFVMLGSGDPVCEDWMRATEATYKDKFRGWVGFNVPVSHRITAGCDILLMPS 61 Query: 282 RFEPCGLNQLYAMRYGAVPVVHGTGGLRDTVENFNPYAXXXXXXXXXWTFSPLSKDTMLA 341 RFEPCGLNQLYAMRYG VPVVH TGGLRDTV NFNPYA WTFSPL+K++MLA Sbjct: 62 RFEPCGLNQLYAMRYGTVPVVHSTGGLRDTVVNFNPYAQGGKGDGTGWTFSPLTKESMLA 121 Query: 342 ALRVAIRTYREHKPSWERLMKRGMEKDYTWDKAALEYEQVFKWAFIDPPYVS 393 AL++A RT+RE+KPSWE LMKRGME+D+TW+ AA++YE+VF WAFIDPPYV Sbjct: 122 ALKLACRTFREYKPSWEGLMKRGMERDFTWESAAIKYERVFGWAFIDPPYVK 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11509 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15466256 (322 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12672 240 2e-65 >Contig12672 Length = 318 Score = 240 bits (613), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 133/318 (41%), Positives = 204/318 (64%), Gaps = 14/318 (4%) Query: 4 GVVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPKKTEHLLSLDGAKERLHLFKANL 63 G CVTGA G++ASW+VKLLL + + ++RDP++ K HL LD A E L LFKA+L Sbjct: 6 GRYCVTGAGGFLASWVVKLLLSKDSIIHGTLRDPSNDKHA-HLKKLDKASENLKLFKADL 64 Query: 64 LEEGSFDSIVEGCVGVFHTASPF-FHAVTDPQAELIDPAVKGTLNVLGSCAKASSVKRVV 122 L+ S + ++GC GVFH ASP + V +P+ ELI+PAVKGTLNVL +C +A VKRVV Sbjct: 65 LDYESLHTAIQGCDGVFHVASPVPYDPVPNPEVELIEPAVKGTLNVLKACLEAK-VKRVV 123 Query: 123 VTSSIAAVAYNRNPR-TPDVVVDETWFTDPDFCKGLQLWYVVSKTLAEDAAWKFAKEKGI 181 SS A++ N P+ + V++ET ++D ++C+ + WY +SKT AE A ++A+ G+ Sbjct: 124 FVSSAASLVMN--PKWSQGQVLNETCWSDKEYCRSTKNWYCLSKTEAEYEALEYARINGL 181 Query: 182 DMVTINPAMVIGPLLQPTLNTSAAAILNLINGG-QTFPNASFGWVNVKDVAEAHIQAFEV 240 D+VT+ P +++GP+LQ T+N S ++ L+ G ++ N V+V+DVAEA I +E Sbjct: 182 DLVTVCPTLIMGPILQSTVNASTLVLIKLLKEGYESLENKPRMIVDVRDVAEAVIMVYEK 241 Query: 241 PSASGRYCLVERVVHYSELVKILKELFPDFQLPEKC--ADDKPFVPTFQVSKEKAKSLGI 298 P A GRY + ++LV+ LK ++P++ P+ +++P ++S EK + LG+ Sbjct: 242 PEAEGRYICTAHNIKTTDLVEELKSIYPNYSYPKNFVEVEEQP-----RLSSEKLQRLGL 296 Query: 299 EFIPLEVSLKETVESLKE 316 F PL+ +L +VES KE Sbjct: 297 SFRPLKETLTGSVESYKE 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6269 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18443 116 3e-28 >Contig18443 Length = 118 Score = 116 bits (290), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 68/120 (56%), Positives = 78/120 (65%), Gaps = 4/120 (3%) Query: 1 MSKRELSSTLRNLKFMQRANQXXXXXXXXXXXXXXDNFFSPNTVKRKCVVIMEGDPHPGA 60 M+KRELSSTLRNLKFMQRA Q +F P+ RKCVVI+EGDP P A Sbjct: 1 MAKRELSSTLRNLKFMQRATQREVKKEEDVKPAV--DFAFPSRQIRKCVVIVEGDPQPEA 58 Query: 61 TKGRMSFQNFNPAIDKLNDA-ANPCQPAVSATCSNNQSEK-NCRENRSSLDGEESMNVDK 118 +GRMSFQ+FNPAIDKLN NP QPA +AT S+ SEK + REN SS+D N DK Sbjct: 59 VRGRMSFQSFNPAIDKLNQVPENPGQPAAAATSSSIHSEKVSFRENGSSMDEAGCSNTDK 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9181 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40140 (391 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21658 124 2e-30 >Contig21658 Length = 352 Score = 124 bits (312), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 107/352 (30%), Positives = 164/352 (46%), Gaps = 47/352 (13%) Query: 39 VEMPPWSEVPAAKDDRNLLQKAEIKFLNQVQ-GPESVAFDPLGRGPYTGVADGRI--LFW 95 + +PP S +P N+LQK IK + V PE V D G YT DG I L Sbjct: 35 LHLPPPSHLP----QNNILQKV-IKLGDGVLLEPEDVDVDKEGT-LYTATRDGWIKRLHK 88 Query: 96 NGEAWSDFAYTSPNRSELCDPKPSPLSYLKNEHICGRPLGLRFNKRTGDLYIADSYLGLM 155 NG +W ++ + + LG+ F K GDL D+ GL+ Sbjct: 89 NG-SWENWKKVNTDTV----------------------LGITFTKD-GDLVACDTDQGLL 124 Query: 156 KVGPEGGLATSLVTEADGVPLRFTNDLDIDDAGNIYFTDSSSKYQRRNFMQLVFSSEDSG 215 K+ G T L + +G +RF +D+ G++YF+ +S+K+ + + ++ G Sbjct: 125 KITEAG--VTVLTSHVNGSKIRFADDVIEGPDGSLYFSVASTKFGPHDGYLDMLEAKPHG 182 Query: 216 RLLKYDPLTKETTVLLRGLQFPNGVSLSKDGSFLVLCEGSPGRLVKYWLKGDKAGTSEVF 275 +LLKYDP + ET++LL L F NGV++SKD +LV+CE KYWL+G G +E+F Sbjct: 183 QLLKYDPSSGETSILLDHLGFANGVAVSKDQDYLVVCE-----TWKYWLEGKNKGKTEIF 237 Query: 276 A-ILPGYPDNVRTNEKGEFWVA-IHCRRTMYSYLCGLYPKLRMFLLKLPIPTRYQYLLHI 333 LPG PDN+ G FW+A + R + ++ L +R L Sbjct: 238 VENLPGGPDNINLAPDGSFWIALLQLTREGFEFV-----HTSKAAKHLVAASRKLTELVS 292 Query: 334 GGRLHAVVVKYSPEGKLVKILEDSEGKXXXXXXXXXXXXGKLWMGSVLMPFV 385 G R A+ V + +GK++K L D +G L++GS+ F+ Sbjct: 293 GMRTEAMAVNVAADGKIIKKLMDPDGSVISFVTNALEFEDHLYLGSLNTNFI 344 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57391 (672 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66241 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19280 217 8e-59 >Contig19280 Length = 169 Score = 217 bits (553), Expect = 8e-59, Method: Compositional matrix adjust. Identities = 108/173 (62%), Positives = 133/173 (76%), Gaps = 5/173 (2%) Query: 1 MDHNETGCQAPPEAPILCINNCGFFGSAATMNMCSKCHKDLVLKQEQAKLAASSFESIVE 60 M+H ETGCQ+ PE PILC+NNCGFFGSAATMNMCSKCHKD+VLKQEQ KLAASSF SIV Sbjct: 1 MEHEETGCQSAPEGPILCVNNCGFFGSAATMNMCSKCHKDMVLKQEQTKLAASSFGSIVN 60 Query: 61 GSSNCNAKESMVAIAKADIIQTGPSESMPVPTQAACASPSETNDRVK-EGPNRCSSCRKR 119 +S+ NA E + ++ +Q P E + +Q + + S ++ K EGP RC++C KR Sbjct: 61 RTSSINANEPVASVD----VQPHPMEPKTLSSQPSFSFGSGSSGEPKPEGPKRCNTCNKR 116 Query: 120 VGLTGFNCRCGNIFCAVHRYSDKHACPFDYRTAARDAIAKSNPVIKPEKLDKI 172 VGLTGFNCRCG++FCAVHRYSDKH C +DY TA +DAIAK+NPV+K +KL KI Sbjct: 117 VGLTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANPVVKADKLGKI 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7275 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10357 (117 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53517 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24121 105 5e-25 >Contig24121 Length = 439 Score = 105 bits (263), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 62/202 (30%), Positives = 102/202 (50%), Gaps = 30/202 (14%) Query: 1 MKAMDKNVMLNRNKVHRACAEREILDMLDHPFLPALYASFQTKTHICLITDYCPGGELFL 60 +K +DK +L + E E + ++ HP + LY +KT I ++ ++ GGELF Sbjct: 41 LKILDKEKVLKHKMAEQIKREIETMKLIKHPNVVQLYEVMGSKTKIFIVMEFVTGGELFD 100 Query: 61 LLDRQPTKVLKEDAVRFYAAEVVVALEYLHCQGVIYRDLKPENVLLQSSGHVALTDFDLS 120 + +KED R Y +++ A++Y H +GV +RDLKPEN+LL + G++ ++DF LS Sbjct: 101 KIVNNGR--MKEDEARRYFQQLINAVDYCHSRGVYHRDLKPENLLLDAYGNLKVSDFGLS 158 Query: 121 CLT-SCKPQLLMPNTNEKKRQHKGQQNPIFMAEPMRASNSFVGTEEYIAPEIITGAGHTS 179 L+ + L+ T GT Y+APE++ G+ Sbjct: 159 ALSQQVRDDGLLHTT--------------------------CGTPNYVAPEVLNDRGYDG 192 Query: 180 AV-DWWALGILLYEMLYGYTPF 200 A D W+ G++L+ +L GY PF Sbjct: 193 ATADLWSCGVILFVLLAGYLPF 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32064 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46990835 207 2e-55 >46990835 Length = 192 Score = 207 bits (527), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 100/154 (64%), Positives = 124/154 (80%) Query: 19 MTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGSVCDVSS 78 MTALVTGGTKGIG+AIVEELAGLGA +HTC+R E +LN+CL W+ KGF V+GSVCDV S Sbjct: 1 MTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVS 60 Query: 79 RAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVYHLSQLA 138 + QRE+L+ VSS+F+GKLNIL+NN K T+E TAE++S +M+ N ES YHL QL+ Sbjct: 61 KTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAYHLCQLS 120 Query: 139 HPLLKASGAGSIVFISSVAGVVSLKYLSAYSATK 172 HPLLKASG+ +IV +SS+AGVVSL + YSATK Sbjct: 121 HPLLKASGSANIVLLSSIAGVVSLNIGTIYSATK 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32058 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 46990835 162 7e-42 >46990835 Length = 192 Score = 162 bits (409), Expect = 7e-42, Method: Compositional matrix adjust. Identities = 74/125 (59%), Positives = 96/125 (76%) Query: 19 MTALITGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGSVCDVSS 78 MTAL+TGGTKGIG+AIVEELAGLGA +HTC+R E +LN+CL W+ KGF V+GSVCDV S Sbjct: 1 MTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVS 60 Query: 79 RAQREKLMQTISSVFNGKXXXXXXXXXXSIQKPTVEVTAEEFSTIMATNFESVYHLSQIA 138 + QRE+L+ +SS+F+GK + K T+E TAE++S +M+TN ES YHL Q++ Sbjct: 61 KTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAYHLCQLS 120 Query: 139 HPLLK 143 HPLLK Sbjct: 121 HPLLK 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3366 (124 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14312 (127 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20159 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11014 87 2e-19 >Contig11014 Length = 227 Score = 87.0 bits (214), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 1/140 (0%) Query: 20 LVSGSDDFTMFLWEPADSKHPKTRMTGHQQLVNHVYFSPDGQWVASASFDKSVKLWNGTT 79 S S D T +W D P M GH V+ V + + ++A+ S DK+V+LW+ T Sbjct: 77 FASASHDRTARIWS-MDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQT 135 Query: 80 GKFVAAFRGHVGPVYQISWSADSRLLLSGSKDSTLKVWDIRTHKLKQDLPGHEDEVFAVD 139 G+ V F GH V ++ S D R + SG +D + +WD+ T + L GH V+ +D Sbjct: 136 GECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGAIMMWDLSTGRCVTPLMGHTSCVWTLD 195 Query: 140 WSPDGEKVASGGRDRVLKLW 159 +S +G +ASG D +KLW Sbjct: 196 FSGEGSLLASGSADCTVKLW 215 Score = 79.7 bits (195), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 44/140 (31%), Positives = 74/140 (52%), Gaps = 1/140 (0%) Query: 20 LVSGSDDFTMFLWEPADSKHPKTRMTGHQQLVNHVYFSPDGQWVASASFDKSVKLWNGTT 79 ++S S D T+ LW + + GH V V FSP G + ASAS D++ ++W+ Sbjct: 35 ILSSSADSTVRLWSTKLNAN-LVCYKGHNYPVWDVQFSPVGHYFASASHDRTARIWSMDR 93 Query: 80 GKFVAAFRGHVGPVYQISWSADSRLLLSGSKDSTLKVWDIRTHKLKQDLPGHEDEVFAVD 139 + + GH+ V + W A+ + +GS D T+++WD++T + + GH V ++ Sbjct: 94 IQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQTGECVRIFIGHRSMVLSLA 153 Query: 140 WSPDGEKVASGGRDRVLKLW 159 SPDG +ASG D + +W Sbjct: 154 MSPDGRYMASGDEDGAIMMW 173 Score = 72.0 bits (175), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 35/122 (28%), Positives = 61/122 (50%) Query: 38 KHPKTRMTGHQQLVNHVYFSPDGQWVASASFDKSVKLWNGTTGKFVAAFRGHVGPVYQIS 97 K P T GH V F+P G ++ S+S D +V+LW+ + ++GH PV+ + Sbjct: 10 KKPYTLFQGHSGPVYSATFNPLGDFILSSSADSTVRLWSTKLNANLVCYKGHNYPVWDVQ 69 Query: 98 WSADSRLLLSGSKDSTLKVWDIRTHKLKQDLPGHEDEVFAVDWSPDGEKVASGGRDRVLK 157 +S S S D T ++W + + + + GH +V V W + +A+G D+ ++ Sbjct: 70 FSPVGHYFASASHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHANCNYIATGSSDKTVR 129 Query: 158 LW 159 LW Sbjct: 130 LW 131 Score = 69.7 bits (169), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 34/100 (34%), Positives = 59/100 (59%), Gaps = 1/100 (1%) Query: 20 LVSGSDDFTMFLWEPADSKHPKTRMTGHQQLVNHVYFSPDGQWVASASFDKSVKLWNGTT 79 + +GS D T+ LW+ + + GH+ +V + SPDG+++AS D ++ +W+ +T Sbjct: 119 IATGSSDKTVRLWDVQTGECVRI-FIGHRSMVLSLAMSPDGRYMASGDEDGAIMMWDLST 177 Query: 80 GKFVAAFRGHVGPVYQISWSADSRLLLSGSKDSTLKVWDI 119 G+ V GH V+ + +S + LL SGS D T+K+WD+ Sbjct: 178 GRCVTPLMGHTSCVWTLDFSGEGSLLASGSADCTVKLWDV 217 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4966261 (340 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226800151 184 2e-48 >226800151 Length = 150 Score = 184 bits (467), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 82/118 (69%), Positives = 105/118 (88%) Query: 39 SPRVRLSDGRHLAYRETGVSKEEAKYKIIVIHGFDSSKDLNLPASQELIEELGIYFLFFD 98 SPR++L+DGRHLAYRE+GV K +A YKII++HGF SSK+++ A QELI+ELGIYFL +D Sbjct: 22 SPRIKLADGRHLAYRESGVPKSKANYKIIMVHGFGSSKEMSFLAPQELIDELGIYFLLYD 81 Query: 99 RAGYGDSDPNPKRSVKSEAFDIQELADKLQIGSKFYVFGVSMGAYPIWGCLKYIPNRL 156 RAGYG+SDPNPKRSVKSEA DI++LAD+L++GSKFYV GVSMG+Y W C+K+IP+R+ Sbjct: 82 RAGYGESDPNPKRSVKSEALDIEQLADQLELGSKFYVIGVSMGSYSTWSCIKHIPHRI 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5522 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3802 79 5e-17 >Contig3802 Length = 163 Score = 79.3 bits (194), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 51/149 (34%), Positives = 79/149 (53%), Gaps = 16/149 (10%) Query: 22 GPLDIELWPKEAPKAVRNFVQLCL--EG--------YYDNTIFHRIIKGFLVQXXX-XXX 70 G + +EL P+ NF LC +G +Y + FHR+I GF+ Q Sbjct: 9 GRIVMELDADTTPRTAENFRALCTGEKGVGRSGKPPHYKGSAFHRVIPGFMCQGGDFTAG 68 Query: 71 XXXXXESIYGSAFADEFHSRLRFNHRGLVACANAGSPNSNGSQFFISLDRCDWLDRKNTI 130 ESIYG+ FADE ++ + G+++ ANAG P +NGSQFFI + +WLD K+ + Sbjct: 69 NGTGGESIYGAKFADENFNK-KHTGPGILSMANAG-PGTNGSQFFICTAKTEWLDGKHVV 126 Query: 131 FGKVTG--DSLYNLPRLGDVEIDKNDRPV 157 FG+V D + N+ ++G + + +PV Sbjct: 127 FGQVVEGLDVVKNIEKVGSGQ-GRTSKPV 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14935 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12823 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10115 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34249 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 71825938 308 8e-86 >71825938 Length = 206 Score = 308 bits (788), Expect = 8e-86, Method: Compositional matrix adjust. Identities = 147/201 (73%), Positives = 172/201 (85%), Gaps = 4/201 (1%) Query: 5 VSIFSPQIQIFKFLPLKAS---KACTDREVSSSASGFQPYGYGSGFQPPTFPVVRLRGLP 61 +S+F ++ L ++ + + CTDREVSS ASGFQPYGYG FQPP FPV RLRGLP Sbjct: 6 ISVFPSPLETRSCLGIQIAASLQPCTDREVSSGASGFQPYGYGGNFQPPVFPVARLRGLP 65 Query: 62 FNCTDIDIFKFFAGLDIVDVLLVNKSGRFSGEAYVVFAGSMQADFALQRDRQNMGRRYVE 121 FNCTDIDIFKFFAGLDIVDVLLVNK GRFSGEA+VVFAG MQ + ALQRDRQNMGRRYVE Sbjct: 66 FNCTDIDIFKFFAGLDIVDVLLVNKGGRFSGEAFVVFAGPMQVELALQRDRQNMGRRYVE 125 Query: 122 VFRCKKQDYYHAVASEVNYEGIYDNDFH-GSPPPSRSKRFSDKDQMEHTEILKLRGLPFS 180 VFRCK+Q+YY AVA+EVNYEGIYDND+ SPPPS+SKRFSDK++ME+TEILK+RGLPFS Sbjct: 126 VFRCKRQEYYKAVAAEVNYEGIYDNDYQAASPPPSKSKRFSDKEKMEYTEILKMRGLPFS 185 Query: 181 VKKSQILEFFGDFELGDDKVH 201 KKS+ILEFF +F++ +D+VH Sbjct: 186 AKKSEILEFFEEFKVVEDRVH 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54458 (164 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6614 233 1e-63 >Contig6614 Length = 248 Score = 233 bits (595), Expect = 1e-63, Method: Compositional matrix adjust. Identities = 113/155 (72%), Positives = 131/155 (84%) Query: 9 SIPGSSRGVFGVPSAKKSEIEALVKLLESQNPTPEPTLNLDKVNGWWKLVYSTITILGSK 68 +I G +RG+FGVPSAKKS+IEALV LES+NPTP+P LNL KV G WKLVYSTITILGSK Sbjct: 82 AIKGINRGIFGVPSAKKSQIEALVNQLESRNPTPDPLLNLQKVGGCWKLVYSTITILGSK 141 Query: 69 RTKLGLRNFITLGDFLQIIDVEEAKAVNVIKFNARGFNFLNGELKIEASFKIASKSRVDI 128 RTKLGLR+FI+LGDF Q I++ + KAVNVIKF+ RG N NG L IEASFK AS SRVDI Sbjct: 142 RTKLGLRDFISLGDFFQNINIAKGKAVNVIKFDVRGLNLFNGRLTIEASFKKASNSRVDI 201 Query: 129 KYDSSTINPDKLMNVFKQNYDLLLGIFNPEGWLEI 163 YD+S I P +LM+VF++NYD+LLGIFNPEGWLEI Sbjct: 202 NYDNSMITPSQLMSVFRKNYDILLGIFNPEGWLEI 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51319 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9361 226 1e-61 >Contig9361 Length = 305 Score = 226 bits (577), Expect = 1e-61, Method: Compositional matrix adjust. Identities = 102/137 (74%), Positives = 126/137 (91%) Query: 51 RELLRGPLYYVLILLVCTMVFWRESPIGVISLSMMCGGDGIADIMGRRFGSLKLPYNQQK 110 +ELLRGPLYYVLIL++C +VFWRESP+G+ISL+MMCGGDG+ADIMGR+FGS+K+PYN +K Sbjct: 167 KELLRGPLYYVLILILCALVFWRESPVGLISLAMMCGGDGVADIMGRKFGSIKIPYNPKK 226 Query: 111 SWAGSISMFVFGFLISIGMLHYFSALGYFQLDWFWTMEKVALTSLVATVVESLPTTKVVD 170 SWAGSISMF+FGFLIS+GML+Y+S LGYF+L+W T EKVA +LVAT+VESLP T+V+D Sbjct: 227 SWAGSISMFLFGFLISMGMLYYYSFLGYFELNWIQTAEKVAFVALVATLVESLPITEVLD 286 Query: 171 DNISVPLASMVMAFLSF 187 DN+SVPLASM A+LSF Sbjct: 287 DNVSVPLASMAAAYLSF 303 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47510 (344 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47659 (393 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26787 467 e-133 >Contig26787 Length = 444 Score = 467 bits (1202), Expect = e-133, Method: Compositional matrix adjust. Identities = 235/381 (61%), Positives = 277/381 (72%), Gaps = 29/381 (7%) Query: 40 IADNFNSLDQVTDALRESGLESSNLILGIDFTKSNEWTGRHSFHRKSLHAISNTPNPYEQ 99 IAD++NSL++VT+AL +GLESSNLI+GIDFTKSNEWTG SFHRKSLH + NTPNPYE Sbjct: 65 IADSYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHHVGNTPNPYEH 124 Query: 100 AISIIGRTLSPFDEDNLIPCFGFGDASTHDKYVFSFYPDHRYCRGFEEVLARYKEIVPYL 159 AISIIG+TL+ FDEDNLIPCFGFGDASTHD+ VFSFY D RYC GFEEVL RY+EIVP L Sbjct: 125 AISIIGKTLAVFDEDNLIPCFGFGDASTHDQDVFSFY-DDRYCNGFEEVLTRYREIVPKL 183 Query: 160 KLSGPTSFAPIIDAAIDIVEGSNGQYHVLVIIADGQVSGSLDGSSGRFSPQEQATVNSIV 219 +L+GPTSFAP+I+ A+ IVE S+GQYHVL+IIADGQV+ S+D GR SPQEQ TVN+IV Sbjct: 184 RLAGPTSFAPVIEQAMTIVEESHGQYHVLLIIADGQVTRSVDTERGRLSPQEQNTVNAIV 243 Query: 220 AASRYPLSIILVGVGDGPWDAMKLFDDNIPQRSFDNFQFVNFSKIMSENMEASKKETAFA 279 AAS+ PLSIILVGVGDGPWD MK FDDNIP R+FDNFQFVNF++IMS+N+ S+KET FA Sbjct: 244 AASKLPLSIILVGVGDGPWDMMKEFDDNIPTRAFDNFQFVNFTQIMSKNVPPSRKETEFA 303 Query: 280 LSALMEIPFQYRATLRLQSIDNNLVGGPRTRPLPPP--KEVLDHDREALQHMMATTLSVE 337 L+ALMEIP QY+ATL L + P PLPPP + + +T S Sbjct: 304 LAALMEIPSQYKATLELSLLGGRKGNIPERVPLPPPVYGASSFSSSKPSRGTGFSTPSFT 363 Query: 338 AVEQTAPVD--------------------------QVCPICLTNPKNMAFGCGHLTCKEC 371 QT + QVCPICLTN K+MAFGCGH TC +C Sbjct: 364 KPSQTTSYEPSVPPYYGDSSSVGTAPSAPSSTYDHQVCPICLTNSKDMAFGCGHQTCCDC 423 Query: 372 GESISLCPLCREPINTRLKLY 392 G+ + CP+CR I TR+KLY Sbjct: 424 GQDLHSCPICRTTIQTRIKLY 444 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7008 (238 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38985 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39875 (372 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24364 88 2e-19 >Contig24364 Length = 347 Score = 88.2 bits (217), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 41/98 (41%), Positives = 69/98 (70%) Query: 172 GAESSTESEFPTLSLTEIQNARGIMDVLAEMLSALDPGNKEGLRQEVIMDLVDQCRTYKQ 231 ++S T E LSL+ + + R +M++L +ML A++P ++ ++ EVI +LV+ CR ++ Sbjct: 5 SSKSRTWLERKNLSLSNLDSMRNVMELLDDMLQAVNPSDRLAIKDEVIEELVNGCRANQK 64 Query: 232 RVVHLVNSTADESLLCQGLALNDDLQRLLAKHEAIASG 269 +++H++ +T DE LL +GL LND +Q LLAKH+AI SG Sbjct: 65 KLIHMLTTTGDEELLARGLDLNDRMQSLLAKHDAIVSG 102 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55560 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3618 (254 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35823 (268 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47597 (162 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9179 (371 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48411817 244 1e-66 >48411817 Length = 154 Score = 244 bits (624), Expect = 1e-66, Method: Compositional matrix adjust. Identities = 116/135 (85%), Positives = 125/135 (92%) Query: 1 MEITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDM 60 MEITNV+EYEAIAK+KLPKMV+DYYASGAEDQWTL +NR+AF++ILFRPRILIDVS+IDM Sbjct: 20 MEITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDM 79 Query: 61 TTTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWATSSVEEVASTG 120 TTTVLGFKISMPIMIAPTAMQKMAHPEGEY GTIMTLSSWATSSVEEVASTG Sbjct: 80 TTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTG 139 Query: 121 PGIRFFQLYVYKDRH 135 PGIRFFQLYVYKDR+ Sbjct: 140 PGIRFFQLYVYKDRN 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35060 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22683 132 8e-33 >Contig22683 Length = 265 Score = 132 bits (331), Expect = 8e-33, Method: Compositional matrix adjust. Identities = 66/89 (74%), Positives = 74/89 (83%) Query: 178 ATNYFSSDNKLGEGGFGPVYKGILQGGQEIAVKMLSKTSRQGLKEFKNEVESITKLQHRN 237 AT+YFS+ NKLG+GGFGPVYKG L GGQEIAVK LS S QGL+EFKNEV I KLQHRN Sbjct: 112 ATDYFSNANKLGQGGFGPVYKGKLPGGQEIAVKRLSSCSGQGLEEFKNEVLLIAKLQHRN 171 Query: 238 LVKLLGCCIYGRERMLIYEYMPNKSLDLF 266 LV+LLG C+ G E+ML+YEYM NKSLD F Sbjct: 172 LVQLLGYCVEGEEKMLVYEYMANKSLDSF 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60475 (405 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13107 112 1e-26 >Contig13107 Length = 218 Score = 112 bits (279), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 67/188 (35%), Positives = 92/188 (48%), Gaps = 5/188 (2%) Query: 67 AAKADASVTSTASKPGHELLLFEALREGLEEEMDRDPRVCVMGEDVGHYGGSYKVTKGLA 126 AA V T SK L L+ A+ + L ++ DPR V GEDV +GG ++ T GLA Sbjct: 34 AAGDGTIVRGTGSK---SLNLYSAINQALHIALETDPRSYVFGEDV-SFGGVFRCTTGLA 89 Query: 127 TKYGDLRVLDTPIAENSFTGMGIGAAMTGLRPIIEGMNMGFLLLAFNQISNNCGMLHYTS 186 ++G RV +TP+ E G GIG A G R + E ++ AF+QI N Y S Sbjct: 90 DRFGKQRVFNTPLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRS 149 Query: 187 GGQFKXXXXXXXXXXXXXQLGAE-HSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS 245 G QF G HSQ E++F PG+++V +P K L+ + IR Sbjct: 150 GNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHAPGLKVVIPRSPLQTKSLLLSCIRD 209 Query: 246 ENPVILFE 253 NPV+ FE Sbjct: 210 PNPVVFFE 217 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12571 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26965 (379 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54335 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21129 (159 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18866257 (332 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54996 (130 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8613 229 2e-62 >Contig8613 Length = 612 Score = 229 bits (583), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 102/129 (79%), Positives = 118/129 (91%) Query: 1 MFERDTEVWQQRVDNYWNILGAKINPDTLRNLMDMKASMGSFAAALKDKNVWVMNVVAED 60 +FE+D EVWQQRV+NYWN+L KI+ DT+RN+MDMKA++GSFA ALK+K+VWVMNVV ED Sbjct: 428 IFEKDMEVWQQRVENYWNLLSPKISSDTIRNVMDMKANLGSFAGALKNKDVWVMNVVPED 487 Query: 61 GPNTLKIIYDRGLIGTIHNWCEAFSTYPRTYDLLHAWTVFSDIERNXCSAEDLLIEMDRI 120 GPNTLKIIYDRGLIG++HNWCEA+STYPRTYDLLHAWTVFSDIER CS DLLIEMDRI Sbjct: 488 GPNTLKIIYDRGLIGSVHNWCEAYSTYPRTYDLLHAWTVFSDIERKECSGVDLLIEMDRI 547 Query: 121 LRPTGFVII 129 LRP GF+I+ Sbjct: 548 LRPKGFIIV 556 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36276 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58683 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26510 157 2e-40 >Contig26510 Length = 221 Score = 157 bits (397), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 75/110 (68%), Positives = 89/110 (80%), Gaps = 3/110 (2%) Query: 1 MTMSNAIGQFGDTTLTKVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYG 60 MT +N GQFGDTT TKVFVGGLAWET KE M+ +FE++G+ILEAV+I+DK TGRSKGYG Sbjct: 1 MTPANLAGQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYG 60 Query: 61 FVTFKEPEAAKKACEDTTPMINGRRANCNLASLGARRPRSAASSTPPHQG 110 FVTF+E EAA +AC D P+I+GRRANCNLASLG +R + STP H G Sbjct: 61 FVTFREAEAAMRACVDAAPVIDGRRANCNLASLGVQR---SKPSTPKHGG 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8236 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12743 206 2e-55 >Contig12743 Length = 150 Score = 206 bits (523), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 96/124 (77%), Positives = 110/124 (88%) Query: 1 MNSSSAGPSSKPRAGSSQPSDSSFKRKRGVFQKDLQHMMYGFGDDANPLPETVALLEDIV 60 M++ S G +SK +AG SQPS+SS KRKRGVFQK+LQHMMYGFGDD NPLPE+VAL+EDIV Sbjct: 1 MSNPSGGTTSKSKAGGSQPSESSNKRKRGVFQKELQHMMYGFGDDPNPLPESVALMEDIV 60 Query: 61 VEYVTDLVHKAQETASKRGKLLTEDFLFLMRKDLPKLNRCTELLSMNEELKQARKAFDVD 120 VEYVTDLVHKAQE SKRG+L +DFL+L+RKD PKLNRC ELLSMNEELKQAR+AF+ D Sbjct: 61 VEYVTDLVHKAQEIGSKRGRLSVDDFLYLIRKDFPKLNRCRELLSMNEELKQARRAFETD 120 Query: 121 EEKL 124 EEKL Sbjct: 121 EEKL 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51732 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36198 (403 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51178 (243 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7270 107 1e-25 >Contig7270 Length = 365 Score = 107 bits (268), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 67/213 (31%), Positives = 116/213 (54%), Gaps = 17/213 (7%) Query: 40 SDPQDSIPVIDFSLLTSGNPDQRSKAIQDLHRACEEWGFFMVINHGVEESLMKGMIEACR 99 +D + IP+I + + +R + + + ACE+WG F +++HGV+ L+ M R Sbjct: 34 NDFSNEIPIISLAGIDEVE-GRRGEICKKIVAACEDWGIFQIVDHGVDAELISEMTGLAR 92 Query: 100 GFFDLTEEEKGEFEGKPVLAPIRCG---TSSNTSLDKILFWRDFLKVFLHPQFHSL---- 152 FF L EEK F+ ++ + G SS+ + + WR+ + F +P H Sbjct: 93 EFFALPSEEKLRFD----MSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIRHRDYSRW 148 Query: 153 -NKPPGFSEVSLEYSQRIKKVVEELLKGISKSLGLEEWYIDKA-MNMSSGLQVLVANLYP 210 +KP + EV+ +YS + + +LL +S+++GL+ + KA ++M Q +V N YP Sbjct: 149 PDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGLDTEALTKACVDMD---QKVVVNFYP 205 Query: 211 PCPQPEHAMGLPPHSDYGLLTVLTQNEVGGLKC 243 CPQP+ +GL H+D G +T+L Q++VGGL+ Sbjct: 206 KCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQA 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19027 (124 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226787059 152 2e-39 >226787059 Length = 133 Score = 152 bits (383), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 78/109 (71%), Positives = 83/109 (76%), Gaps = 12/109 (11%) Query: 1 MDTNNWRPAQA-EQAMDLGDWRTQLSPDSRQGTVNRIMDTLKRHLPVSGQEGLHELRKIA 59 MDTN WRP+Q E AMD GDWR+QL DSRQ VN +MDTLKRH P SGQ+GL EL KIA Sbjct: 1 MDTNKWRPSQVGEAAMDAGDWRSQLQADSRQRIVNNLMDTLKRHFPFSGQDGLQELSKIA 60 Query: 60 VRFEEKIYTAATSQSDYLHKISLKMLTMETK-----------NSAGNSK 97 VRFEEKIYTAATSQSDYL KISLKMLT+ETK NSAGNSK Sbjct: 61 VRFEEKIYTAATSQSDYLRKISLKMLTLETKSQNSMGNPLQSNSAGNSK 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53084 (68 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12964 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2867 167 2e-43 >Contig2867 Length = 257 Score = 167 bits (422), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 100/256 (39%), Positives = 135/256 (52%), Gaps = 12/256 (4%) Query: 6 VPCLEDNYSYLIIDESSKEAAVVDPVEPQKVLQAAYEYGXXXXXXXXXXXXWDHAGGNEK 65 VPCL DNY+YL+ DE + VVDP E V+ A DH GGN + Sbjct: 9 VPCLRDNYAYLLHDEDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHDHTGGNAE 68 Query: 66 IKQLVPGIEVYGGSVDN--VKGCTHPLQNGDKLSLGSDLAVLALHTPCHTRGHISYYVTG 123 +K G +V G +D + G L GDK V + TP HTRGHI +Y Sbjct: 69 LKARY-GAKVIGSGIDRDRIPGIDIALNEGDKWMFAGH-EVQVMETPGHTRGHIGFYFPQ 126 Query: 124 KEEDVPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLASLPKPTRVYCGHEYTVKNLQF 183 A+FTGDTLF CGK FEGT EQM+ SL + SLP T +YCGHEYT+ N +F Sbjct: 127 SG----AIFTGDTLFSLSCGKLFEGTPEQMHSSL-TKITSLPDDTDIYCGHEYTLSNSKF 181 Query: 184 ALTVEPDNVRVGQKLSWAQHQRQAGLPTIPSTIDEEMETNPFMRVDLPELQERVG---CQ 240 AL++EP+N + + H R G+PT+P+ + E E NPF+R E+++ + Sbjct: 182 ALSIEPENEALQSYAAHVIHLRNKGMPTVPTRLKLEKECNPFLRTSSREIRQSLNIPDTA 241 Query: 241 SAIDALQEIRRQKDNW 256 + +AL IR+ KD + Sbjct: 242 NDAEALGVIRQAKDAF 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44542 (97 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23077 115 2e-28 >Contig23077 Length = 211 Score = 115 bits (287), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 52/72 (72%), Positives = 63/72 (87%) Query: 11 SFHTVNGKAYLFNKVVNISVGVHEEKMMMTGMYTVADIFCVGCGSIVGWRYETAHEKAQK 70 SF+ +GKAYLF+KVVN+ G E++ MMTG++TVADIFCVGCGSIVGW+YETAHEK QK Sbjct: 115 SFYCRHGKAYLFSKVVNVYSGECEDRAMMTGLHTVADIFCVGCGSIVGWKYETAHEKGQK 174 Query: 71 YKEGKSVLQRYR 82 YKEGKSVL+R + Sbjct: 175 YKEGKSVLERIK 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48734 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39656 (211 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17620 (373 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2566261 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26424 (155 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8012 237 6e-65 >Contig8012 Length = 211 Score = 237 bits (605), Expect = 6e-65, Method: Compositional matrix adjust. Identities = 108/155 (69%), Positives = 130/155 (83%), Gaps = 2/155 (1%) Query: 2 FGWGLYGQCGQGSTDDELSPTCVSSLLGIQIERVAAGLWHTVCISADGDVYTFGGNQFGQ 61 FGWGLYGQCGQG+T D+L P+ V SL +++ +AAGLWHT+C+S DG VY FGGNQFGQ Sbjct: 56 FGWGLYGQCGQGNTIDQLRPSYVKSLSETKVKNIAAGLWHTLCVSVDGRVYAFGGNQFGQ 115 Query: 62 LGTGVDQPE--TLPRLLDAPSLENAHAKIVSCGARHSAIITADGKMFSWGWNKYGQLGLG 119 LGTG D+ E TLP++LD+P L + HAK+ SCGARHS I+T DG++FSWGWNKYGQLGLG Sbjct: 116 LGTGADEGELQTLPKILDSPGLGSKHAKVASCGARHSVILTEDGQLFSWGWNKYGQLGLG 175 Query: 120 DVVDRNIPSQVTLDGCTPKNVACGWWHTLLLAESP 154 D VDRNIPSQV+++GC KN+ACGWWHTLLLAE P Sbjct: 176 DAVDRNIPSQVSIEGCLLKNIACGWWHTLLLAERP 210 Score = 63.2 bits (152), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 4/89 (4%) Query: 64 TGVDQPETLPRLLDAPSLENAHAKIVSCGARHSAIITADGKMFSWGWNKYGQLGLGDVVD 123 +G D+ + + P ++ K ++CG RHSA+IT G + ++GW YGQ G G+ +D Sbjct: 15 SGKDRSSVISQGSKVP---GSYVKEIACGGRHSAVITDAGALLTFGWGLYGQCGQGNTID 71 Query: 124 RNIPSQV-TLDGCTPKNVACGWWHTLLLA 151 + PS V +L KN+A G WHTL ++ Sbjct: 72 QLRPSYVKSLSETKVKNIAAGLWHTLCVS 100 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30033 (447 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11404 (108 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18766263 (296 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22855 122 9e-30 >Contig22855 Length = 237 Score = 122 bits (305), Expect = 9e-30, Method: Compositional matrix adjust. Identities = 70/96 (72%), Positives = 76/96 (79%) Query: 197 MSTGKLEMAEECLKHAMXXXXXXXXXXXXXXXXXISKLASLAKEQGKNNVAFLCLFMLGK 256 MS GKL+MAEECLKHAM IS+LA LAKEQGKNNVAFLCLFMLG+ Sbjct: 1 MSAGKLDMAEECLKHAMDLSGLLLLYSSLGDAEGISRLAVLAKEQGKNNVAFLCLFMLGR 60 Query: 257 LEECLQLLVDSNRIPEAALMARSYLPSKVSEIVALW 292 LEECL+LLV+SNRIPEAALMARSYLP KVSEIVA+W Sbjct: 61 LEECLELLVESNRIPEAALMARSYLPGKVSEIVAIW 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42482 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39848 (420 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39428 (380 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7031 123 4e-30 >Contig7031 Length = 210 Score = 123 bits (309), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 78/215 (36%), Positives = 120/215 (55%), Gaps = 24/215 (11%) Query: 185 MIKEHLTTVLGWKPKSNVTENWATTQIRRFQLGQIYAASILYGYFLKSASLRHHLEMSLV 244 MI+ HL+ +LG + + ++ + +I + ++GQ+YAAS++YGYFLK R LE ++ Sbjct: 1 MIQNHLSLILG----NRLGDSTSLAKISKLKVGQVYAASVMYGYFLKRVDQRFQLEKTMK 56 Query: 245 HTHHDLSSSNVSGFWSYGLKDLFLGPNG-------SSQP--TSLGEASSRQ---EEKEEK 292 + + + S G +D+ G G SS P SL S + Sbjct: 57 ILPGAMGAEDSDIHKSVG-EDVRPGSGGEALQAGASSHPEVPSLAGGVSPGGFGNALKHS 115 Query: 293 KLRCYVMGFDPDTLQRCAKLKSKEAVNLVEKHSCALFGDEKT-----GLLET--DDVIST 345 +LR YVM FD +TL R A ++S+EA++++EKH+ ALFG G +++ DD+I Sbjct: 116 RLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGTVDSSKDDLIKI 175 Query: 346 SFSSMKRLVLEAVAFGSFLWDTEEYVGSVYNLKEN 380 SF ++RL+LE+V FGSFLWD E YV S Y+ N Sbjct: 176 SFGGLRRLILESVTFGSFLWDVESYVDSRYHFVAN 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14248 (78 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46232 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11148 238 9e-65 >Contig11148 Length = 221 Score = 238 bits (606), Expect = 9e-65, Method: Compositional matrix adjust. Identities = 129/190 (67%), Positives = 142/190 (74%), Gaps = 2/190 (1%) Query: 1 MFSRMFRKGKEQSQTNAVATLDKLNETLEMLEKKERVLIXXXXXXXXXXXXYTKAKNKRA 60 MF+R+F GK + + +A+ TLDKLNETLEMLEKKE+VL +TKAKNK+A Sbjct: 4 MFTRIF--GKPKQENSALTTLDKLNETLEMLEKKEKVLQKKAAAEVDRAKDFTKAKNKKA 61 Query: 61 AIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKTMHKTTN 120 AIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMK M K TN Sbjct: 62 AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN 121 Query: 121 IDDLDKTMDEINEQTENMKQIQEALSTPIGSAADFXXXXXXXXXXXXXXXXXXXXXXXPT 180 IDD+DKTMDEINEQTENMKQIQEALSTPIG+AADF P Sbjct: 122 IDDVDKTMDEINEQTENMKQIQEALSTPIGAAADFDEDELEAELEELEGAELEEQLLQPA 181 Query: 181 TTAPAAPVSI 190 T APAAPV + Sbjct: 182 TQAPAAPVQV 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10829 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10810 341 1e-95 >Contig10810 Length = 250 Score = 341 bits (874), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 166/243 (68%), Positives = 187/243 (76%), Gaps = 1/243 (0%) Query: 4 PVVDTDYLKEIDKARRDLRALIASKNCAPIMLRLAWHDAGTYDVHTKTGGPNGSIRTEEE 63 P V +Y IDKARR LR LIA KNCAP+MLR+AWH AGTYD TKTGGP G++R E Sbjct: 6 PTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTMRCPAE 65 Query: 64 YSHGSNNGLKIAIDFCEEVKSKYPKITYADLYQLAGVVAVEITGGPTIDFVPGRKDSMIS 123 SHG+NNGL IA+ E +K ++P ++YAD YQLAGVVAVEITGGP + F PGRKD+ Sbjct: 66 QSHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRKDAPEP 125 Query: 124 PKEGRLPDAKKGVSHLRDIFYR-MGLSGKDIVALSGGHTLGRAHPERSGFDGPWTKNPLK 182 P EGRLPDA KG HLRD+F + MGLS KDIVALSGGHTLGR H ERSGF+GPWT NPL Sbjct: 126 PPEGRLPDATKGCDHLRDVFGKTMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTPNPLI 185 Query: 183 FDNSYFVELLQGESEGLLKLPTDKALLDDPEFRGYVELYAKDEDAFFRDYAVSHKKLSEL 242 FDNSYF LL G+ EGLL LP+DKALLDDP FR VE YA DEDAFF DYA +H +LSEL Sbjct: 186 FDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHMRLSEL 245 Query: 243 GFT 245 GF Sbjct: 246 GFA 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22593 (385 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21063 (267 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15312 468 e-134 >Contig15312 Length = 461 Score = 468 bits (1205), Expect = e-134, Method: Compositional matrix adjust. Identities = 222/265 (83%), Positives = 240/265 (90%) Query: 1 KDAEEKKTSFNPRPYFRFFINWLSELGSPDPVFDGANFQVLITFANAFHALQPLKIPAFS 60 KDAEEKKTSFNPRPYFR F+NWL +LGS DPV DGANFQ+L FANAFHALQPLK+P FS Sbjct: 45 KDAEEKKTSFNPRPYFRLFVNWLLDLGSLDPVIDGANFQILTAFANAFHALQPLKVPTFS 104 Query: 61 FAWLELVSHRSFMPKLLTGNPSKGWPYLHRLLVDLFQFMEPFLRNAILGEPVHFLYRGTL 120 FAWLELVSHRSFMPK+L GN KGWPY+ RLLV LFQFMEPFLRNA LG PVHF+Y+GTL Sbjct: 105 FAWLELVSHRSFMPKMLVGNGQKGWPYIQRLLVHLFQFMEPFLRNAELGVPVHFMYKGTL 164 Query: 121 RVLLVLLHDFPEFLCGYHFTFCDVIPPSCIQMRNIILSAFPRNMRLPDPSTPNLKIDLLV 180 RVLLVLLHDFPEFLC YHFTFCDVIPPSCIQMRNIILSAFPRNMRLPDPSTPNLKIDLL Sbjct: 165 RVLLVLLHDFPEFLCDYHFTFCDVIPPSCIQMRNIILSAFPRNMRLPDPSTPNLKIDLLA 224 Query: 181 EINQSPLILSDVDASLKVKQMKTDVDEYLKMGQQGSSFLSGMKQRLLLLPIDAARAGTRY 240 EI+QSP ILS+VDA+LK KQMK DVDEYLK QQGSSFL+ +KQ+LLLLP + A AGTRY Sbjct: 225 EISQSPRILSEVDAALKAKQMKADVDEYLKTRQQGSSFLTELKQKLLLLPSEVASAGTRY 284 Query: 241 NIPLINSLVLYVGMQAMQQLKARTP 265 N+PLINSLVLYVGMQA+QQL+ARTP Sbjct: 285 NVPLINSLVLYVGMQAIQQLQARTP 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22196 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17040 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig14063 100 2e-23 >Contig14063 Length = 580 Score = 100 bits (249), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 64/205 (31%), Positives = 105/205 (51%), Gaps = 30/205 (14%) Query: 25 VFVLGGPGSGKGTQCANIVKHFGYTHLSAGDLLRAEIKSGSENGNMIQSMIKEGKIVPSE 84 V + G P SGKGTQC IV FG H+S GDLLRAE+ SG+E GN + + G++VP E Sbjct: 77 VMISGAPASGKGTQCELIVNKFGLVHISTGDLLRAEVSSGTEIGNKAKEFMNAGRLVPDE 136 Query: 85 -VTIKLLQRAILEDSNDK-FLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRI 142 VT + R +D+ +K +L+DG+PR+ + + + KI P+ + D +E + R Sbjct: 137 VVTAMVTARLSRDDAKEKGWLLDGYPRSFNQAQSLQKL-KIIPDVYIVLDVPDETLIDRC 195 Query: 143 LNR------------------NQ-------GREDDNVETIRKRFKVFLESSLPVIEYYES 177 + R NQ R DD E ++ R +++ +++ + Y + Sbjct: 196 VGRRLDPVTGKIYHIKSFPPENQEIKARLITRPDDTEEKVKSRLEIYKKNADSISAAYSN 255 Query: 178 KGKVRKIDAAQSIEEVFEAVKAVFT 202 ++KID S + VFE + ++ + Sbjct: 256 --IMKKIDGNHSKDVVFEVIDSILS 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50131 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57970 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7583 372 e-105 >Contig7583 Length = 376 Score = 372 bits (956), Expect = e-105, Method: Compositional matrix adjust. Identities = 174/293 (59%), Positives = 227/293 (77%), Gaps = 19/293 (6%) Query: 2 IMEISRVFDQIYKEHLDGVRAGGDKIYHVFDNQLPAALKRLQFDKQLSMENVRKLITEAD 61 I+E+ R F++I+KEHLDG RAGGD+IY VFDNQLPAAL++L FD+ LS++NVRK+++EAD Sbjct: 82 ILELCRAFNRIFKEHLDGGRAGGDRIYGVFDNQLPAALRKLPFDRHLSLQNVRKVVSEAD 141 Query: 62 GYQPHLIAPEQGYRRLIESSIVSIRGPAEAAVDAVHAILKEMVNKAISETAEFKQYPALR 121 GYQPHLIAPEQGYRRLIE S+ RGPAEA+VDAVH +LKE+V K+++ET E K++P L+ Sbjct: 142 GYQPHLIAPEQGYRRLIEGSLSYFRGPAEASVDAVHFVLKELVRKSLAETQELKRFPTLQ 201 Query: 122 IEVANAACDSLDRMRDESKKATLKLVDMECSYLTVDFFRKLPQDIEKGGNPTH------- 174 E+A A ++L+R R+ESKK TL+LVDME SYLTVDFFR+LPQ++E GNP + Sbjct: 202 AEIAAACNEALERFRNESKKTTLRLVDMESSYLTVDFFRRLPQEMENTGNPGNPGKPGST 261 Query: 175 ------------SIFDRYNDSYLRRIGTTVLSYVNMVCATLRNSIPKSIVYCQVREAKRS 222 DRY++ + RRIG+ V SYV MV TLRN+IPK++V+CQV+EA S Sbjct: 262 PAGRPGTTPAPAPAMDRYSEGHFRRIGSNVSSYVGMVSETLRNTIPKAVVHCQVKEANTS 321 Query: 223 LLDHFFTELGKLEPKQLASLLNEDPAVMARRTALAKRLELYRSAQAEIDAVAW 275 LL+HF+ ++GK E K L+ LL+EDPA+M RR AKRLELY+SA+ EID+VAW Sbjct: 322 LLNHFYIQIGKREAKHLSQLLDEDPALMERRHQCAKRLELYKSARDEIDSVAW 374 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30100 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45299 (397 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33590 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25772 343 1e-96 >Contig25772 Length = 267 Score = 343 bits (881), Expect = 1e-96, Method: Compositional matrix adjust. Identities = 161/185 (87%), Positives = 176/185 (95%) Query: 1 MEGSANERLDFGKMGFGCKHYRRRCRIRAPCCNEIFPCRHCHNEATSMLRNPFDRHELVR 60 MEGSANERLDFGKMG+GCKHYRRRC+IRAPCCNEI PCRHCHNEATSML NPFDRHELVR Sbjct: 1 MEGSANERLDFGKMGYGCKHYRRRCQIRAPCCNEIHPCRHCHNEATSMLSNPFDRHELVR 60 Query: 61 HDVKQVICAVCDTEQPVAQVCTNCGVNMGEYFCEVCKFYDDDTTKGQFHCDDCGICIVGG 120 +DVKQV+C+VCDTEQPVA+VCTNCG++MGEYFC++CKFYDDDTTK QFHC+DCGIC +GG Sbjct: 61 YDVKQVVCSVCDTEQPVAKVCTNCGISMGEYFCDICKFYDDDTTKEQFHCNDCGICRIGG 120 Query: 121 RDKFFHCKKCGCCYSVGLRDNHSCVENSMRHHCPICYEYLFDSLKDTTVMVCGHTMHCEC 180 RDKFFHCKKCG CYS+ LRDNH CVENSMRHHCPICYE+LFDSLKDTTVM CGHTMH EC Sbjct: 121 RDKFFHCKKCGSCYSIRLRDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHREC 180 Query: 181 YNEMI 185 YNEM+ Sbjct: 181 YNEMM 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10928 (222 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8501 315 3e-88 >Contig8501 Length = 517 Score = 315 bits (808), Expect = 3e-88, Method: Compositional matrix adjust. Identities = 144/218 (66%), Positives = 182/218 (83%), Gaps = 3/218 (1%) Query: 5 GMSKNSTLICVPIMGETIEKMVVDMSKAKTSGADLVEVRLDTLKRFNPRQDLEVLIRKCP 64 G +NSTLIC P++ +++++M+V M KAK GADLVE+R+D LK F+PRQDL VLI++ P Sbjct: 3 GTRRNSTLICAPVVADSVDQMLVQMGKAKEVGADLVELRVDFLKNFSPRQDLSVLIKQSP 62 Query: 65 LPTLFTYRPKWEGGQYEGDENSRRDALRLAMELGADYVDIELKVAHEFINSIHGRKPEKF 124 LPTL TYRP WEGGQY+GD+ R+DALR+AM+LGAD++D+ELKVA EF NSI GRKPEK Sbjct: 63 LPTLVTYRPAWEGGQYKGDDKQRQDALRVAMDLGADFIDVELKVADEFYNSIQGRKPEKV 122 Query: 125 KVIVSSHNYQNTPSVEDLGNLVVSIQATGADIVKIATTALEITDVARIFQITVHSQVSSV 184 K+IVSSHNY+ TPS E++G+LV IQATGADIVKIATT L+ITD AR+FQ+ HSQ V Sbjct: 123 KIIVSSHNYEKTPSAEEIGDLVARIQATGADIVKIATTGLDITDSARVFQVLAHSQ---V 179 Query: 185 PVIGLVMGERGLISRILCPKFSGYLTFGSLEPGIVSAP 222 P+IGLVMGE+GLISR+L K+ +LTFG++E G+VSAP Sbjct: 180 PMIGLVMGEKGLISRVLSAKYGAFLTFGTIEAGVVSAP 217 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31562 (105 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26608 122 1e-30 >Contig26608 Length = 105 Score = 122 bits (307), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 57/105 (54%), Positives = 71/105 (67%) Query: 1 MQSGNSQAAPSINHQDSALAAADTRGKHRITAELKXXXXXXXXXXXXXXXXXKTERASAA 60 MQS S+ + +L+AADTRGKHRI AELK K ++AS+A Sbjct: 1 MQSDGSETLSPTTLRLQSLSAADTRGKHRIHAELKRLEQETRFLEEELEQLEKMDKASSA 60 Query: 61 CRELLSIVESRPDPLLPVTYGPANPIWDRWFEGPQDSQGCRCWIL 105 C+E+L+ E+RPDPLLP+T+GP NP WDRWFEGPQDS+GCRCWIL Sbjct: 61 CKEILNSAETRPDPLLPITHGPLNPFWDRWFEGPQDSKGCRCWIL 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31466256 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21966263 (213 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43954 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57583 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21408 144 9e-37 >Contig21408 Length = 174 Score = 144 bits (364), Expect = 9e-37, Method: Compositional matrix adjust. Identities = 70/96 (72%), Positives = 82/96 (85%), Gaps = 2/96 (2%) Query: 2 KDQDGGSWRDEEENP--GRIFCSDEEVASQVPTQAQSLVEGSGAVLVSEFKPVPDVDYLQ 59 +DQD GS +E+ + +F SDEE +Q+PTQAQS+VEGSGAV+VSE++PV DVDYLQ Sbjct: 76 RDQDIGSRSNEDASATGASMFGSDEEGGTQIPTQAQSVVEGSGAVMVSEYRPVDDVDYLQ 135 Query: 60 ELLAIQQQGPRAIGFFGTRNMGFTHQELIEILSYAM 95 ELLAIQQQGPRAIGFFGTRNMGF HQEL+EILSYAM Sbjct: 136 ELLAIQQQGPRAIGFFGTRNMGFMHQELVEILSYAM 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15680 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20455 181 4e-48 >Contig20455 Length = 117 Score = 181 bits (459), Expect = 4e-48, Method: Compositional matrix adjust. Identities = 89/117 (76%), Positives = 95/117 (81%) Query: 1 MAKSYFKQEHDFXXXXXXXXXXXXXYPDRIPVIVEKAERSDIPNIDKKKYLVPADLTVGQ 60 MAKS FK EH YPDRIPVIVEKAERSDIP+IDKKKYLVPADLTVGQ Sbjct: 1 MAKSSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQ 60 Query: 61 FVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSGIYDEKKDADGFLYVTYSGENTFG 117 FVYV+RKRIKLSAEKAIFIFV N+LPPT A+MS IY+E KD DGFLY+TYSGENTFG Sbjct: 61 FVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv63858 (74 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2896 (171 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58015 (89 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41423 (360 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25141 318 1e-88 >Contig25141 Length = 352 Score = 318 bits (814), Expect = 1e-88, Method: Compositional matrix adjust. Identities = 182/357 (50%), Positives = 249/357 (69%), Gaps = 17/357 (4%) Query: 8 RDVVSFSAMVALECTNVGLNTLYKAATLRGLNYHVFVVYAYGIAALVLLPSPFIT-HRRG 66 +DV+ F+AMV +ECTNVGLN L+KAATL+GL+Y+VF+VY+ +A LVLLP F+ + R Sbjct: 9 KDVLPFTAMVTVECTNVGLNVLFKAATLKGLSYYVFIVYSNLVATLVLLPLLFLFPNPRT 68 Query: 67 VLPPLSFPVLCKIFVLGLIGCASQTMGYRGINISSPTLASAISNLVPAFTFILAVIFRME 126 LP + +L K+F+LGLIG + GY GIN SSPTL SA+SNL PAFTFILAV FRME Sbjct: 69 GLPSFNLSLLLKVFLLGLIGFLADLCGYIGINYSSPTLDSAMSNLTPAFTFILAVFFRME 128 Query: 127 KLALRSSSSQAKIIGTIVSISGAFVVTLYKGXXXXXXXXXXXXXHQPPHP---LRSSESS 183 LALRS S+QAKI+GT+VSISGA VV LYKG P+P L + ++ Sbjct: 129 SLALRSYSTQAKIMGTLVSISGALVVVLYKGPTILST-------PSDPNPSPMLGTPPTN 181 Query: 184 WIIGALFLSVEYFLTPVWYIVQAHIIKEYPSEPTVVFFYNLFVSLLAAIVGLVTEPNSSV 243 W+IG L ++++ L WYI+Q H++K YP+E +VF YNL ++++A V + E N S Sbjct: 182 WVIGGLLCALQFLLNSTWYILQTHVMKAYPAEIVLVFLYNLCGTIISAPVCFIAETNLSA 241 Query: 244 WIVRPRIALASIVCSGIFGSFLGNTIHTWAIRMKGPVYVAMFKPLAIIIAVTMGVALLGD 303 W +RP IAL +I+ SG GS G+ +HTWA+ +KGPVY+++FKPL+I IA + V LGD Sbjct: 242 WRLRPDIALVAIIYSGCLGSSFGSLVHTWALHLKGPVYISIFKPLSIAIAAALSVIFLGD 301 Query: 304 SLYLGSVIGATIITMGFYTVMWGKAQEDMVEDCTIGSLESPSAQKAPLLQNYKTEEI 360 +L LGSV+GA I+++GFY V+WGK++E+ ++ IG KAPLL++YK E + Sbjct: 302 ALSLGSVVGAIILSLGFYAVIWGKSKEEQMKPLPIG------MGKAPLLESYKVENM 352 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37180 (79 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23500 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54396 (173 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49860 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1614 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54714 (254 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18120 (293 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23966261 (59 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4436 62 2e-12 >Contig4436 Length = 98 Score = 62.0 bits (149), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Query: 6 YPDLSFSEGATTTETIIAGVAPVKTHFEGSEMGVGAENGWKCGSNCSCDPC 56 YPDL + E A+T ET+IAGVAPVK +E SEM GAENG K GSNCS C Sbjct: 45 YPDLGYLENAST-ETLIAGVAPVKMFYERSEMNYGAENGCKYGSNCSYSSC 94 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34353 (484 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43938 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3802 104 9e-25 >Contig3802 Length = 163 Score = 104 bits (259), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 64/148 (43%), Positives = 81/148 (54%), Gaps = 16/148 (10%) Query: 19 GSFTVELYYKHAPRTCRNFLEL-------SRRG---YYDNVKFHRIIKDFIVQXXX-XXX 67 G +EL PRT NF L R G +Y FHR+I F+ Q Sbjct: 9 GRIVMELDADTTPRTAENFRALCTGEKGVGRSGKPPHYKGSAFHRVIPGFMCQGGDFTAG 68 Query: 68 XXXXXESIYGSKFEDEIKPELKHTGAGILSMANAGPNSNGSQFFITLAPAQSLDGKHTIF 127 ESIYG+KF DE KHTG GILSMANAGP +NGSQFFI A + LDGKH +F Sbjct: 69 NGTGGESIYGAKFADE-NFNKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLDGKHVVF 127 Query: 128 GRVCRGMEIIK---RLGSVQTDNTDRPI 152 G+V G++++K ++GS Q T +P+ Sbjct: 128 GQVVEGLDVVKNIEKVGSGQ-GRTSKPV 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18849 (227 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43714 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48121754 224 8e-61 >48121754 Length = 106 Score = 224 bits (570), Expect = 8e-61, Method: Compositional matrix adjust. Identities = 106/106 (100%), Positives = 106/106 (100%) Query: 1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT Sbjct: 1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 Query: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12397 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41955 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig32163 283 1e-78 >Contig32163 Length = 190 Score = 283 bits (725), Expect = 1e-78, Method: Compositional matrix adjust. Identities = 130/190 (68%), Positives = 150/190 (78%) Query: 21 MRFDLTSGGTKCISEDIKTNAMSVGKYSVINPNEGFPLPDTHKITAQVSSPYGNNYHTGD 80 M FDL SG TKCIS+DIK+++M+VGKY+V+NP EGFP+PD+HK+T +V+SPYG+NYH GD Sbjct: 1 MLFDLQSGATKCISDDIKSSSMTVGKYAVVNPKEGFPIPDSHKLTIRVTSPYGSNYHYGD 60 Query: 81 HIESGNFAFTAAEEGDYTACFWAPQHKPPLTVTIDFDWRTGVAAKDWSKVAKKGQVEVME 140 H+ESGNFAFTAAE GDY+ACFW HKP TVTIDFDW+TGVAAKDWSKVAKKGQ+E ME Sbjct: 61 HVESGNFAFTAAETGDYSACFWVSDHKPSTTVTIDFDWKTGVAAKDWSKVAKKGQIETME 120 Query: 141 LELKKLYDTVTSIHXXXXXXXXXXXXXQELNRATNSKMATXXXXXXXXXXXXAGLQLWHL 200 LELKKLYDTV+SIH Q+LNR+TNSKMA AGLQLWHL Sbjct: 121 LELKKLYDTVSSIHDEMFYLREREEGMQQLNRSTNSKMAVFSGLSLFVCLSVAGLQLWHL 180 Query: 201 KTFFERKKLL 210 K FFERKKLL Sbjct: 181 KMFFERKKLL 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50138 (302 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20015 244 1e-66 >Contig20015 Length = 220 Score = 244 bits (622), Expect = 1e-66, Method: Compositional matrix adjust. Identities = 114/129 (88%), Positives = 122/129 (94%) Query: 9 NKQTAVKDCIWLFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECIQLVKELG 68 + AVK CIWLFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECIQL+KELG Sbjct: 92 TRTEAVKGCIWLFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECIQLLKELG 151 Query: 69 APVEYIILPTFAYEHKIFVGPFSRKFPQAQIRVAPRQWSWPLNLPLEFFGIFRAKTLKDE 128 APVEYI+LPTFAYEHKIFVGPFSR+FP+AQ+ VAPRQWSWPLNLPLEFFGIFRAKTLK++ Sbjct: 152 APVEYIVLPTFAYEHKIFVGPFSREFPRAQVWVAPRQWSWPLNLPLEFFGIFRAKTLKNK 211 Query: 129 DMSTPWASE 137 D STPWA E Sbjct: 212 DFSTPWAEE 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21011 (61 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29667 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46377 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26966 336 2e-94 >Contig26966 Length = 442 Score = 336 bits (861), Expect = 2e-94, Method: Compositional matrix adjust. Identities = 165/226 (73%), Positives = 181/226 (80%), Gaps = 2/226 (0%) Query: 1 MNMNSPRCLFGSASLGEIAILAGGCDPRGNILSSAELYNSDTGTWVTLPSMNKPRKMCSG 60 M MN+PRCLFGSASL EIAILAGGCD +GNILSSAELYNS+T TW LPSMNKPRKMCSG Sbjct: 219 MRMNAPRCLFGSASLKEIAILAGGCDSQGNILSSAELYNSETQTWEMLPSMNKPRKMCSG 278 Query: 61 IFMDRKFYVIGGIGVGNSNSLTCGEVYDLEMRTWREIPNMFPGRNGSXXXXXXXXXXXXX 120 +FMD KFYVIGGIG + LTCGE YDL RTW EIPNM PGR+G+ Sbjct: 279 VFMDDKFYVIGGIGGSDLKVLTCGEEYDLTARTWTEIPNMSPGRSGAARETDVPAGEAPP 338 Query: 121 XXXXXXXNNELYAADYAEKEVRKYDKARNLWVTVGRLPEQAVSMNGWGLAFRACGDRLIV 180 NNELYAADYA+ EVRKYDK R +W+TVGRLPE+A SMNGWGLAFRACGD+LIV Sbjct: 339 LVAVV--NNELYAADYADMEVRKYDKERRVWLTVGRLPERAASMNGWGLAFRACGDQLIV 396 Query: 181 IGGPRVLGGGIIELNSWSPGEGPPQWDLLARKQSGSFVYNCAVMGC 226 IGGPR LG G IE+N+W PGEGPPQW+LLARKQSG+FVYNCAVMGC Sbjct: 397 IGGPRALGEGFIEINAWVPGEGPPQWNLLARKQSGNFVYNCAVMGC 442 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48157 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6784 (141 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20414 (345 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9938 71 2e-14 >Contig9938 Length = 492 Score = 71.2 bits (173), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/109 (34%), Positives = 56/109 (51%), Gaps = 2/109 (1%) Query: 122 KRPKRVVDVGCGIGGSSRYLAKKYGASCQGITLSPLQAQRAQTLAASQGLADKVSFQVAD 181 K ++V+DVGCGIGG Y+A + GI LS A L S GL V F+VAD Sbjct: 282 KPGQKVLDVGCGIGGGDFYMASNFDVEVIGIDLSVNMISFA--LEQSIGLKCAVEFEVAD 339 Query: 182 ALDQPFPDGQFDLVWSMESGEHMPDKKKFVSELARVAAPGGTIILVTWC 230 + +PD FD+++S ++ H+ DK PGG +++ +C Sbjct: 340 CTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYEWLKPGGKVLISDYC 388 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51189 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26501 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24573 (99 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20166258 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57937 (297 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40998 (212 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27492 231 5e-63 >Contig27492 Length = 202 Score = 231 bits (590), Expect = 5e-63, Method: Compositional matrix adjust. Identities = 109/198 (55%), Positives = 149/198 (75%), Gaps = 1/198 (0%) Query: 15 PLAAMAEAFEELSKLVKTCPSYHLRLITFCDACSLVSVLFGCLGIAFKFAELEYVSKIRD 74 PL +AEAF+EL V + P+ + + F ACSLVS LFGCLGIAFKFAE++YV+K+ D Sbjct: 6 PLRKIAEAFKELEAAVNS-PAADVEVAPFSHACSLVSPLFGCLGIAFKFAEMDYVAKVHD 64 Query: 75 LLEASKTYDTLEDIIDRDIENNTVRSAGSHSRNLRRVRQGLDLIRALFEQFLLSDDFSLR 134 L EAS + TL+ ++DRDIE + VR AGSHSRNL RV++G+D++R LFEQ +++ SL+ Sbjct: 65 LSEASDSISTLQVLLDRDIEADCVRKAGSHSRNLLRVKRGIDMVRVLFEQIIVTKGNSLK 124 Query: 135 EAASAAYSQVCAPYHTWAVRTAVSAGMYALPVREQLLVRLNENGQSAEKQMRRYINASLP 194 + AS AY+QV AP+H W +R AV+AGMYALP REQL+ +LNE+ SA+ QM+ YI AS P Sbjct: 125 DPASKAYAQVFAPHHGWVIRKAVAAGMYALPTREQLMNKLNEDDNSAKVQMQSYIAASAP 184 Query: 195 VIAYIDELYMARNISLDW 212 + YID+L+ +R + +DW Sbjct: 185 LSLYIDKLFHSRKLGVDW 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60751 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv65703 (340 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28146 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60283 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26432 (342 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48963 (271 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48482 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22916 307 1e-85 >Contig22916 Length = 286 Score = 307 bits (787), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 151/229 (65%), Positives = 186/229 (81%), Gaps = 5/229 (2%) Query: 77 KVVDVDLSLAVKKKAMEISPVLKGTSIFLVGMNSTIKTNVGKLLADALRYYHFDSDSLVE 136 KV D S AVK KA++I+P LKGTSIFLVGM S++KT++GKLLA+ LRYY+FDSDSLVE Sbjct: 63 KVSVADPSSAVKNKAIDITPELKGTSIFLVGMKSSMKTSLGKLLANVLRYYYFDSDSLVE 122 Query: 137 EACGGESVAKSLKEQDEKGFRDSETEVLKQLSSMGRLVVCAGDGLVQSSTNLALLRHGIS 196 EA GG S AK L+E D G+R+SETEVLKQLSSMGRLVVCAGDG VQSSTNLALLR+GIS Sbjct: 123 EAAGGGSAAKLLREADTNGYRESETEVLKQLSSMGRLVVCAGDGAVQSSTNLALLRYGIS 182 Query: 197 IWIDVPIEMVAKNMIEEGVQIPVTELSTAESYSETGDNQVFAQLAVVYEEMKGGYATADA 256 IWIDVP+++VA+ MIE+ Q+P +S + SY E V L+ +YEE++GGY TADA Sbjct: 183 IWIDVPLDLVARGMIEDQSQLPALNVSASASYPE-----VLTHLSTMYEEVRGGYETADA 237 Query: 257 SVSLQKVASQLGYDDLDAVTTEDMAMEVLKEIQRLTRLKKMMEEAARPF 305 +VS++K+A QLGYDD VTTED+A EVL E+++LTR+KKMME +ARPF Sbjct: 238 TVSIEKLAYQLGYDDFGDVTTEDVAFEVLMEMEKLTRVKKMMEASARPF 286 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53385 (399 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41364 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57845 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42836 (344 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37731 (359 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25132 275 9e-76 >Contig25132 Length = 319 Score = 275 bits (703), Expect = 9e-76, Method: Compositional matrix adjust. Identities = 150/259 (57%), Positives = 183/259 (70%), Gaps = 23/259 (8%) Query: 118 KTVVSGNKRGFADAMNGFSEGKFL----ANSEVNV-----MLSPRPSPNKENLGS----- 163 K +VSG KRGF+DA++G S GK++ SEV + +LSPR + L + Sbjct: 67 KGLVSGAKRGFSDAIDGAS-GKWVFSGSGGSEVELGKGGNLLSPRGVNAGKALAAGCEPS 125 Query: 164 -QPAKMKEMASPKIVQERPRAXXXXXXXXXXXXXXXSSAPATKAQVVGWPPIRSFRKNTL 222 QP + A VQ+ P+ S+APA KAQVVGWPPIRSFRKN++ Sbjct: 126 NQPTGLAGSAVKDGVQQSPKPLHEKKPQGSAG----STAPAAKAQVVGWPPIRSFRKNSM 181 Query: 223 ATT-SKN-TEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIG 280 A+ SKN + +GK G G L+VKVSMDGAPYLRKVDL+ Y +Y +LS ALEKMFSCFTIG Sbjct: 182 ASVPSKNGDDAEGKMGAGCLYVKVSMDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIG 241 Query: 281 QYGSHGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMK 340 Q GSHGA R+ LSES+L DLLHG+EYVLTYEDKDGDWMLVGDVPW+MF ++CKR+RIMK Sbjct: 242 QCGSHGAS-RDGLSESRLMDLLHGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMK 300 Query: 341 SCDAIGLAPRAVEKCKNRN 359 S +AIGLAPRA++KCKN N Sbjct: 301 SSEAIGLAPRAMQKCKNSN 319 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23925 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12008 300 8e-84 >Contig12008 Length = 392 Score = 300 bits (769), Expect = 8e-84, Method: Compositional matrix adjust. Identities = 135/183 (73%), Positives = 157/183 (85%) Query: 1 MKNAVSLEKSHNSSWAPIFIRPSNFKLPVDPLTPIIMVGPGTGLAPFRGFLQERLALKED 60 MKN++ LEKS + SWAPIF+R SNFKLP D PI+M+GPGTG APFRGFLQERLALKED Sbjct: 210 MKNSIPLEKSDDCSWAPIFVRQSNFKLPADTKVPILMIGPGTGFAPFRGFLQERLALKED 269 Query: 61 GVQLGPALLFFGCRNRRMDFIYEDELNNFVEQGILSELILAFSREGPQKEYVQHKMMDRA 120 G +LG + LFFGCRN +MD+IYEDELNNF+ G LSEL++AFSR+GP KEYVQHKMM +A Sbjct: 270 GAELGSSTLFFGCRNSQMDYIYEDELNNFLATGALSELVVAFSRQGPTKEYVQHKMMQKA 329 Query: 121 SYIWNIISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQENVESSKAEAIVKKLHTEGRYLR 180 S +WN+ISQGGY+YVCGDAKGMA+DVHRTLHTIVQEQ ++SSKAE +VK L GRYLR Sbjct: 330 SDVWNMISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGCMDSSKAEGLVKNLQMNGRYLR 389 Query: 181 DVW 183 DVW Sbjct: 390 DVW 392 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32066 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30431 124 9e-31 >Contig30431 Length = 228 Score = 124 bits (310), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 63/105 (60%), Positives = 73/105 (69%), Gaps = 3/105 (2%) Query: 32 KSAGYGPGNTPVYLNVYDLTPMNGYVYRAGLGIFHSGVEVHGVEYAFGAHDYPTSGVFEV 91 S GY + V LNVYDLTP+N Y GLGIFHSG+EVHG EY FGAHD+P SGVFEV Sbjct: 16 SSKGY---ESQVVLNVYDLTPLNNYTVWFGLGIFHSGIEVHGKEYGFGAHDFPVSGVFEV 72 Query: 92 EPRQCPGFKFRKSILDRTTCLDPIQDREFMERHSAIYNGDTYHLI 136 EPR CPGF +R SI + P + R F+E +A Y+GDTYHLI Sbjct: 73 EPRSCPGFIYRCSIQLGRINMPPSEFRTFIEHVAAEYHGDTYHLI 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11077 (113 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27666260 (593 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4806 (349 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5700 (116 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55404 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12773 (119 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1609 178 3e-47 >Contig1609 Length = 111 Score = 178 bits (451), Expect = 3e-47, Method: Compositional matrix adjust. Identities = 84/106 (79%), Positives = 93/106 (87%) Query: 14 WHQVAAVSGAVGIGLGAFGAHVFKPQNPIYKEVWKTASLYHLVHTAALLATPVTKHPNIF 73 WH+VAA+SG +GLG +GAH FKPQNP YKEVW+TASLYHLVHTAALLA P+TK P IF Sbjct: 6 WHKVAALSGMAALGLGTYGAHGFKPQNPTYKEVWQTASLYHLVHTAALLAAPITKRPTIF 65 Query: 74 GGLVTAGILAFSGSCYTVAYFEDRKYSFLAPFGGLAFIAAWGSLLF 119 GGL+T GILAFSG+CYTVA+ EDRKYS LAPFGG AFIAAWGSLLF Sbjct: 66 GGLLTTGILAFSGTCYTVAFLEDRKYSTLAPFGGFAFIAAWGSLLF 111 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17373 (144 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32253 (142 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30789 (260 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27037 112 9e-27 >Contig27037 Length = 227 Score = 112 bits (279), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 9/106 (8%) Query: 27 PVSAADNGSDKNSYGGFDCNICLDFVQDPVVTLCGHLFCWPCIYKWLHFQSISTENPDQK 86 P S + +G++ N G F+CNIC + QDP++T CGHLFCWPC+Y+WLH S S E Sbjct: 13 PQSVSCSGNNANDVGDFECNICFELAQDPIITRCGHLFCWPCLYRWLHHHSNSQE----- 67 Query: 87 HPQCPVCKAEVSDTTLIPLYGRGQATKPSNAKAPHPDIFIPRRPSG 132 CP CKA + + L+PLYGRG+ +K+ +P I IP RPSG Sbjct: 68 ---CPFCKALIEEEKLVPLYGRGKTQTDPRSKS-YPGINIPNRPSG 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30012 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60922 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14526 (60 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24828 (118 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv64741 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 340 1e-95 >Contig2543 Length = 199 Score = 340 bits (871), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 162/199 (81%), Positives = 173/199 (86%) Query: 1 MARTGNKNIQAKLVLLGDMGTGKTSLVLRFVKGQFYDFQESTIGAAFFTQVLSLNEATIK 60 MARTGNKNIQAKLVLLGDMGTGKTSLVLRFV G+F ++QESTIGAAFFTQVLSLNEATIK Sbjct: 1 MARTGNKNIQAKLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIK 60 Query: 61 FDIWDTAGQERYHSLAPMYYRGXXXXXXXYDITSMDSFERAKKWVQELQRQGNPNLLMIL 120 FDIWDTAGQERYHSLAPMYYRG YDITSMDSF RAKKWV E+QRQ NP L+M L Sbjct: 61 FDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFLRAKKWVLEVQRQANPTLIMFL 120 Query: 121 VANKADLETKREVENEKGEQYAKENGLLFFETSAKTAQNVNELFYEIAKKLAKACPSRPG 180 NKADLE KR+V +E+GEQYAKENGL+F ETSAKTAQNVNELFYEIAKKLAKA PSR Sbjct: 121 AGNKADLEDKRKVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKLAKASPSRQS 180 Query: 181 GIKLHRRSQERGRRLFCCS 199 GIKLH RS + RR+FCCS Sbjct: 181 GIKLHSRSPQNSRRMFCCS 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18966262 (322 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8613 182 8e-48 >Contig8613 Length = 612 Score = 182 bits (461), Expect = 8e-48, Method: Compositional matrix adjust. Identities = 109/330 (33%), Positives = 164/330 (49%), Gaps = 37/330 (11%) Query: 1 MFLIEVDRVLKPGGYFVLXXXXXXXXXXXXXXXXXXVLTPIEELTQRICWSLLAQQDETL 60 + L+E+DRVL+PGGYF + + L +R+CW + +++++T+ Sbjct: 294 ILLLELDRVLRPGGYFAYSSPEAYAQDEEDLK----IWKAMSALVERMCWKIASKRNQTV 349 Query: 61 IWQKTMDVHCYTSRKQGAVP-LCKEEHDTQSYYQ-PLIPCISGTTSKRWIPIQNRSSGFH 118 IW K + CY R G P LC+ + D + Y + CI+ + + + R SG Sbjct: 350 IWVKPLTNDCYMERPPGTQPPLCRSDDDPDAVYNVKMEACITPYSEQNH---RARGSGLA 406 Query: 119 LSSVELEV-------HGVHPDDYFEDSEFWRSSLRNYWSLLTPLIFSDHPKRPGDEDPLP 171 L G D + +D E W+ + NYW+LL+P I SD Sbjct: 407 PWPARLTTPPPRLGDFGYSSDIFEKDMEVWQQRVENYWNLLSPKISSD------------ 454 Query: 172 PFNMIRNVMDMNARYGGLNAAFLEAKRSVWVMNVVPTRTQNTLPLILYQGFAGVLHDWCE 231 IRNVMDM A G A + VWVMNVVP NTL +I +G G +H+WCE Sbjct: 455 ---TIRNVMDMKANLGSFAGAL--KNKDVWVMNVVPEDGPNTLKIIYDRGLIGSVHNWCE 509 Query: 232 PFPTYPRTYDMLHANGLLSHLTSEGCNIMNLLLEMDRILRPEGWVVLSDNMVAIEKARAL 291 + TYPRTYD+LHA + S + + C+ ++LL+EMDRILRP+G++++ D +E Sbjct: 510 AYSTYPRTYDLLHAWTVFSDIERKECSGVDLLIEMDRILRPKGFIIVRDKRKVVEFINKY 569 Query: 292 ATQIRWEA-RVIDLQKGT---DQRLLVCQK 317 + WEA D + G+ D + + QK Sbjct: 570 MKALHWEAVATADAEGGSELDDDVVFIIQK 599 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5081 (348 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16066256 (111 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35775 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27537 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9798 (45 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55270 (224 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6184 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6191 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25777 112 7e-27 >Contig25777 Length = 155 Score = 112 bits (279), Expect = 7e-27, Method: Compositional matrix adjust. Identities = 58/131 (44%), Positives = 82/131 (62%), Gaps = 20/131 (15%) Query: 1 MPVVQKLYNACKESSSVDG----PLSEEALGKVRSILDDMKPSNVGLEQEAQLARGWKGS 56 M VQKLY CKE S G P +++ + ++ S+L +KP++VGL + Sbjct: 39 MSPVQKLYETCKEVFSSGGAGVIPPADD-IQRLSSVLGAIKPADVGLTPDLPY------- 90 Query: 57 MHGANGKKVRNGSHQYPPPIKYLHLHECDRFSIGIFCMPPSSIIPLHNHPGMTVVSKLLY 116 R + P I YLHL+EC+++S+GIFC+PPS ++PLHNHPGMTV SKLL+ Sbjct: 91 --------FRMTVARRTPAITYLHLYECEKYSMGIFCLPPSGVLPLHNHPGMTVFSKLLF 142 Query: 117 GTLHVKSYDWL 127 GT+H+KSYDW+ Sbjct: 143 GTMHIKSYDWV 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4036 (296 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15674 (389 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19649 171 2e-44 >Contig19649 Length = 389 Score = 171 bits (433), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 99/326 (30%), Positives = 166/326 (50%), Gaps = 8/326 (2%) Query: 47 MIPIGLISAVTTLKNLVKYLSFLKPIVEIVAIKTVLEAYXXXXXXXXXXXXXXXXXXXXS 106 MIPI ++ + +L L K FLKPIVE+ IK+V+ + + Sbjct: 13 MIPIAIVQSFASLDGLEKVAPFLKPIVEVKFIKSVIAGFLPGIALKIFLIFLPTILMIMA 72 Query: 107 KAEGIPSQSHAVRAASGKYFYFTILNVFIGVTVGATLFDTFKTIEEDQPKEIVSILAKSL 166 K EG S S R A+ +Y+ F+++NVF+G + T F+ + +I + ++ Sbjct: 73 KFEGYISLSSLERRAASRYYLFSLVNVFLGSIITGTAFEQLDSFTHQSASDIPKTIGVAI 132 Query: 167 PSNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTETEVKEAWAPGDLGYVSR 226 P ATFF++++ + + G E+ + PLII+HLK +L KT+ + +EA PG +G+ + Sbjct: 133 PMKATFFISYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDKDREEAMDPGSIGFNTG 192 Query: 227 VPGDLLIITIVLCYSVIAPIILPFGVLYFGLGWLILRNQALKVYVPSYESNGRMWPHIHV 286 P L I + L Y+ + P +LPF +++FGL +++ R+Q + VY YES WP +H Sbjct: 193 EPQIQLYILLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDVHG 252 Query: 287 RLIGALLLYQVTMLGYFGVKK-FHYTPXXXXXXXXXXXXXXXCQKKFYRSFQSVPLEVA- 344 R+I AL++ Q+ + G K+ TP C+ +F +F + PL+ A Sbjct: 253 RIITALIISQLLLFGLLSTKEAASSTPFLIALPVLTLSFHRYCKGRFEPAFTTYPLQEAM 312 Query: 345 ---SHELKESPNME---HIFRAYIPP 364 + E PN+ ++ AYI P Sbjct: 313 MKDTLERAREPNLNLKGYLQSAYIHP 338 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4554 (304 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62914 (115 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9128 (122 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7822 (386 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13504 108 2e-25 >Contig13504 Length = 334 Score = 108 bits (269), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 96/330 (29%), Positives = 146/330 (44%), Gaps = 68/330 (20%) Query: 63 LQGPREEMEDEAVVRSDGLDGFSFAAVFDGHAGFSSVKF---------LRDELYK--DCV 111 +QG R MED D SF V+DGH G KF L++E Y D Sbjct: 1 MQGWRATMEDAHAAYPDLDASTSFFGVYDGHGGKVVAKFCAKYLHQQVLKNEAYAAGDIG 60 Query: 112 AALQGGL-----LLSGK--------------NFNIIREALEKAFESADA--KLLNWLETT 150 ++Q ++ G+ F + E L + S+D+ + +W Sbjct: 61 TSVQKAFFRMDEMMRGQRGWRELAVLGDKINKFTGMIEGLIWSPRSSDSNDQADDWAFEE 120 Query: 151 GEDVE-----SGSTATVLLIGDDMVFISHVGDSCVVLSRSGKAEELTNPHRPYGSNKSSL 205 G + SG TA V ++ + + +++ GDS V+SR G+A L+ H+P L Sbjct: 121 GPHSDFTGPTSGCTACVAILRNKQLVVANAGDSRCVISRKGQAYNLSRDHKP------DL 174 Query: 206 E-EIRRIREAGGWIVNGRICGDIAVSRSFGDMRFKTKKNEMLEKGLEEGRWSQKFVSRVQ 264 E E RI +AGG+I GR+ G + ++R+ GDM FK K EK Sbjct: 175 ELEKERILKAGGFIHAGRVNGSLNLARAIGDMEFKQNKFLPAEK---------------- 218 Query: 265 FTGDLVVASPDVFQVALGSDAEFLLLASDGLWDYMNSSEAVTFVRNELRQHGDVQVAYE- 323 +V ASPD+ V L D EF++LA DG+WD M+S + V FV +L + V E Sbjct: 219 ---QIVTASPDINTVELCDDDEFIVLACDGIWDCMSSQQVVDFVHEQLLSESKLSVVCER 275 Query: 324 ----ALARAALDRRTQDNVSIIIADLGRTD 349 LA + D DN+++I+ + + Sbjct: 276 ALDRCLAPSTADGEGCDNMTMIVVQFKKPE 305 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49213 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv42152 (539 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56147 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20403 (179 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59502 (226 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7766263 (346 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34312 (195 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig23011 226 2e-61 >Contig23011 Length = 243 Score = 226 bits (577), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 108/177 (61%), Positives = 141/177 (79%), Gaps = 2/177 (1%) Query: 1 DVEAFVKWLDEELSYLVDERAVLKHFPKWPERKADALREAAFSYRDLKNLEAEVSSFEDN 60 DV FVKWLD+ELSYLVDERAVLKHF +WPE+KADALREAAF Y DLK LE+E SSF D+ Sbjct: 43 DVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFGYCDLKKLESEASSFPDH 101 Query: 61 TKQPLTQSLRRIQALQDRVERSVANMEKMRDGASKRYKEFQIPWEWMLNTGLIGQIKISS 120 ++QP +L+++QAL +++E V N+ +MRD A+KRYK FQIP WML++ + QIK++S Sbjct: 102 SRQPCGPTLKKMQALLEKLEHGVYNLSRMRDSATKRYKVFQIPTNWMLDSEFVSQIKLAS 161 Query: 121 TKLAKKYMKRIIKEMQSI-ECSQEDNLMLQGVRFAFRVHQFAGGFDVDTMHAFEELK 176 KLA KYMKR+ E++ + +E+ L++QGVRFAFRVHQFAGGFD +TM AF+ L+ Sbjct: 162 VKLAMKYMKRVSAELEIVGGVPEEEELIVQGVRFAFRVHQFAGGFDAETMRAFQVLR 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21350 (47 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31041 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21241 87 1e-19 >Contig21241 Length = 531 Score = 87.4 bits (215), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 47/114 (41%), Positives = 68/114 (59%), Gaps = 2/114 (1%) Query: 75 DDTFSGTAAGCKLFGFSLTGETPPNSQNSGKRSCTKVHKQGNLVGRAIDLSRLNGYGDLF 134 D TF+ + F +G P R+ TKV+K+G VGR+ID++R + Y +L Sbjct: 387 DMTFNSIDSAINDSSFLDSGPWAPAPPFQRMRTYTKVYKRG-AVGRSIDMTRYSNYDELK 445 Query: 135 SELERLFGMEGLLRDPDK-GWQILYTDSENDMMVVGDDPWHEFCNVVSKIHIYT 187 +L R FG+EG L D + GW+++Y D END+++VGDDPW EF N V I I + Sbjct: 446 QDLARRFGIEGQLEDRGRVGWKLVYVDHENDVLLVGDDPWEEFVNCVRCIKILS 499 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41919 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38140 (432 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48497 (375 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37204 (181 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49382 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66220 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15366264 (387 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17486 80 6e-17 >Contig17486 Length = 245 Score = 80.1 bits (196), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 40/57 (70%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Query: 258 MLRRMYETVQEPFLNATTMSGDSGSDLGSNPFAALLGTQGGVQAHDRSANPPTAGSD 314 MLRRMYE VQEPF+NATTM+GD+GSD GSNPFAALLG +GG Q +S N T SD Sbjct: 1 MLRRMYENVQEPFMNATTMAGDAGSD-GSNPFAALLGAEGGNQTRAQSTNQSTVSSD 56 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58612 (332 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14945 (136 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47095 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig20614 239 2e-65 >Contig20614 Length = 217 Score = 239 bits (611), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 126/195 (64%), Positives = 143/195 (73%), Gaps = 3/195 (1%) Query: 11 LCFAPSSKHFPLNXXXXXXXXXXXXXXAKNAHPLKL-QHPPRASSE--GIPTELIEDSKF 67 L F PS PL +H LKL + PRASSE G+P ELIEDSKF Sbjct: 19 LLFIPSISSNPLLPPKISTLSSSSSSENYRSHQLKLLKSTPRASSEREGVPGELIEDSKF 78 Query: 68 VPLNSDDPIYGPPAXXXXXXXXXXXXKIRQLLKELDGEFLQVIYCTEDMITRSLWEAMNT 127 VPLN+D+ I+GPPA KI+Q LK+LDGEFL+VIYCTEDMITRSLW+AMNT Sbjct: 79 VPLNADEMIFGPPALLLLGFEAEEAEKIQQFLKQLDGEFLKVIYCTEDMITRSLWDAMNT 138 Query: 128 KQSNLEALKIAKALPRICFLSGLSGEEMMMFIDAFPETGLEAAVFAALVPNSADKPLQEL 187 Q NLEALKIAK LPRICF SGLSGEEMM+FID+FPE+GLE A+FAALVPNSADKPL EL Sbjct: 139 SQPNLEALKIAKPLPRICFFSGLSGEEMMVFIDSFPESGLEPAIFAALVPNSADKPLAEL 198 Query: 188 IEEIMGDHEMLSGKQ 202 IEEI+GDHEML+ K+ Sbjct: 199 IEEIVGDHEMLTAKE 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5807 (404 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31382 114 4e-27 >Contig31382 Length = 274 Score = 114 bits (284), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 59/129 (45%), Positives = 77/129 (59%), Gaps = 23/129 (17%) Query: 262 GSGQGLIGSLSASEIELSEDYTCVISHGPNPKTTHIYGDCILECHSNDLANHNKNEEHKI 321 GSG G + SE+ELSEDYTCVIS GP P+TTHI+ +CI+E + H +++ Sbjct: 164 GSGSGCVSE--RSEMELSEDYTCVISRGPKPRTTHIFDNCIVESY------HTLSDQSSS 215 Query: 322 GSPLIVECSDNSTPYPSNDFLSICYSCKKKLEEGKDIYMYRGEKAFCSLNCRSQEILIDX 381 GS +FLS CY+C+K LE+ DIY+YRGEKAFCS CR QE+L+D Sbjct: 216 GS---------------ENFLSFCYTCRKNLEQKIDIYIYRGEKAFCSQECRYQEMLLDE 260 Query: 382 XMEKTTDDS 390 DD+ Sbjct: 261 VGNTQLDDT 269 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35377 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53282 (92 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5650 (98 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39117 (110 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28689 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10964 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40628 (300 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9466 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48920 (282 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2998 (387 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5772 213 5e-57 >Contig5772 Length = 116 Score = 213 bits (541), Expect = 5e-57, Method: Composition-based stats. Identities = 98/116 (84%), Positives = 105/116 (90%) Query: 168 VSKFLDLLPSSSSVEKTTWNGRLSSENEAIVIPTQVNYVGKATNIYDTGYQLKGSAYVIS 227 +SKFLDLLP+SS V +WN +L S NEAIVIPTQVNYVGKA NIYD GY+L GSA+VIS Sbjct: 1 MSKFLDLLPNSSPVATASWNAQLPSANEAIVIPTQVNYVGKAGNIYDAGYRLSGSAHVIS 60 Query: 228 KYISNTWLWDRVRVSGGAYGGFCDFDTHSGVFSFLSYRDPNLLKTLDVYDGTGDFL 283 KYISNTWLWDRVRVSGGAYGGFCDFD+HSGVFSFLSYRDPNLLKTL VYDGTGDFL Sbjct: 61 KYISNTWLWDRVRVSGGAYGGFCDFDSHSGVFSFLSYRDPNLLKTLGVYDGTGDFL 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47102 (411 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9875 74 6e-15 >Contig9875 Length = 275 Score = 73.6 bits (179), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 54/186 (29%), Positives = 92/186 (49%), Gaps = 19/186 (10%) Query: 80 LWVGDLHQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRATAEKILHSY 139 L+VG+L +D L F G V +++I +K TG+S G+GFV + AE Sbjct: 90 LFVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGFVTMSNVQEAESAARQL 149 Query: 140 NGTLMPNTEQPFRLNWATFSTGDRRTDAG--------------SDLSIFVGDLASDVTDA 185 NG + + R+N+ R D+ S+ ++VG+LA V + Sbjct: 150 NGYELDG--RALRVNYGP--PPPRTEDSSFRGARGPRGGGGYDSNNRLYVGNLAWGVDNL 205 Query: 186 LLQETFATRYPSVKGAKVVTDSNTGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRI 245 L+ F+ + V AKVV D ++GRS+G+GFV + +E + A+ ++G+ + R +R+ Sbjct: 206 ALENLFSEQ-GKVLEAKVVFDRDSGRSRGFGFVTYDTADEMNSAIESLDGVDLNGRSIRV 264 Query: 246 GVATPK 251 A P+ Sbjct: 265 SAAEPR 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35303 (394 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13504 119 7e-29 >Contig13504 Length = 334 Score = 119 bits (299), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 90/314 (28%), Positives = 134/314 (42%), Gaps = 56/314 (17%) Query: 93 GPRRYMEDEHIRIDDLSMHLGSVSRLPNPCAFYGVFDGHGGP------------------ 134 G R MED H DL +F+GV+DGHGG Sbjct: 3 GWRATMEDAHAAYPDLDA----------STSFFGVYDGHGGKVVAKFCAKYLHQQVLKNE 52 Query: 135 -EAAAYVRKNVDRFFFEDANFPRTS-----------EVND--------VFSERVENSVRK 174 AA + +V + FF R ++N ++S R +S + Sbjct: 53 AYAAGDIGTSVQKAFFRMDEMMRGQRGWRELAVLGDKINKFTGMIEGLIWSPRSSDSNDQ 112 Query: 175 AFXXXXXXXXXXXXXXXXXXXXXXXXXIFGRTLMVANAGDCRAVLCRKGQAVDMSQDHRP 234 A + + L+VANAGD R V+ RKGQA ++S+DH+P Sbjct: 113 ADDWAFEEGPHSDFTGPTSGCTACVAILRNKQLVVANAGDSRCVISRKGQAYNLSRDHKP 172 Query: 235 SYPLERKRVEELGGFVDGEYLNGVLSVTRALGDWDM---KFPRGSASPLIAEPEFRQVAL 291 LE++R+ + GGF+ +NG L++ RA+GD + KF + A P+ V L Sbjct: 173 DLELEKERILKAGGFIHAGRVNGSLNLARAIGDMEFKQNKFLPAEKQIVTASPDINTVEL 232 Query: 292 TEEDEFLIIGCDGIWDVMSSQEAVSLVRRGLRRHDDPEQSARDLVMEALRLNTF-----D 346 ++DEF+++ CDGIWD MSSQ+ V V L + L +T D Sbjct: 233 CDDDEFIVLACDGIWDCMSSQQVVDFVHEQLLSESKLSVVCERALDRCLAPSTADGEGCD 292 Query: 347 NLTVIVICFSSPDQ 360 N+T+IV+ F P+Q Sbjct: 293 NMTMIVVQFKKPEQ 306 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47006 (147 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15777 (208 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57603 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7180 357 e-101 >Contig7180 Length = 199 Score = 357 bits (917), Expect = e-101, Method: Compositional matrix adjust. Identities = 174/199 (87%), Positives = 185/199 (92%), Gaps = 10/199 (5%) Query: 1 MSFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKP 60 MSFIGTQQKCKAC KTVYPVE+LSADG+ YHKSCFKC+HC GTLKLSNYSSMEGVLYCKP Sbjct: 1 MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK 120 HFEQLFKE+GNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQ+KCATCGKTAYPLEK Sbjct: 61 HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK 120 Query: 121 VTVESQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASMK 180 VTVESQAYHKSCFKCSHGGCPI+PSNYAALEGILYCKHHF+QLFKEKGSYNHLIKSAS+K Sbjct: 121 VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK 180 Query: 181 R----------SAASVPDA 189 R + AS+P+A Sbjct: 181 RTAAAAAAAAATVASIPEA 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv45791 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2618 244 7e-67 >Contig2618 Length = 161 Score = 244 bits (622), Expect = 7e-67, Method: Compositional matrix adjust. Identities = 117/157 (74%), Positives = 133/157 (84%), Gaps = 1/157 (0%) Query: 6 KSVMVVGVDDSEHSFYALQWTLDHFFAPFPG-TAPFKLVIVHAKPSPTTAIGLAGPGAAD 64 K VMV+G DDSE YAL+WTLDH F P G TAPFKL+IVHAKPS ++ +G GP A+ Sbjct: 5 KQVMVIGADDSEEGHYALEWTLDHLFKPLGGDTAPFKLIIVHAKPSVSSVVGFVGPAGAE 64 Query: 65 VLPYVEADLKKIAGRVVGKAHEICASKSVTDVILEVVEGDARNVMCEAVEKHHASILVVG 124 VLP V+ADLKK+A RV +A E CASKSVTDV++EV+EGDARNV+CEAVE+HHASILVVG Sbjct: 65 VLPIVDADLKKMAARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHHASILVVG 124 Query: 125 SHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIKH 161 SHGYGAIKRA+LGSVSDYCAHH HCTVMIVKKPK KH Sbjct: 125 SHGYGAIKRALLGSVSDYCAHHVHCTVMIVKKPKTKH 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10131 (473 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25277 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25232 125 4e-31 >Contig25232 Length = 273 Score = 125 bits (315), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 68/199 (34%), Positives = 107/199 (53%), Gaps = 12/199 (6%) Query: 17 KLLLIGDSGVGKSCLLLRXXXXXXXXXXXXXXXXXXKIRTIELDGKRIKLQIWDTAGQER 76 KL+L+GD G GKS L+LR +T+ ++ +K +IWDTAGQER Sbjct: 85 KLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQER 144 Query: 77 FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKVLVGNKADMDESK 136 + ++ YYRGA ++VYD+T+++SF + W+ ++ + N+ L GNKAD+ E++ Sbjct: 145 YHSLAPMYYRGAAAAIIVYDLTNQASFERAKKWVLELKSQGNPNMVMALAGNKADLVEAR 204 Query: 137 RAVPTSKGQALADEYGIKFFETSAKTNLNVEEVFFSIAKDIKQRLAETDSKAEPQ-TIKI 195 + V Q+ A E G+ F ETSAKT NV ++F+ IAK RL P + + Sbjct: 205 K-VAAEDAQSYAQENGLFFLETSAKTADNVNDIFYEIAK----RLPRVQPVQNPAGMVLV 259 Query: 196 NQPDQAANGGQAPQKSACC 214 ++P + S+CC Sbjct: 260 DRPSERV------ASSSCC 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4366264 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6269 150 2e-38 >Contig6269 Length = 170 Score = 150 bits (378), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 80/127 (62%), Positives = 88/127 (69%) Query: 1 MKVTKGKAAARKDKKEALKPVEDRRLGKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPP 60 MK +KGK RKDKKE LKPVED ++GKR RP Sbjct: 1 MKASKGKGPVRKDKKEVLKPVEDVKVGKRKAAIEADKSRRKLAKNAKLGKKDPNKPKRPA 60 Query: 61 SAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLSEADKAPYEAKAAKRKSDYEKL 120 SAFFVFLEEFR VYK+EHPNVKAVSAVGKAGGEKWKS+S A+KAPYEAKAAKRK++YEKL Sbjct: 61 SAFFVFLEEFRTVYKKEHPNVKAVSAVGKAGGEKWKSMSPAEKAPYEAKAAKRKTEYEKL 120 Query: 121 MAAYNKK 127 M AYN K Sbjct: 121 MKAYNNK 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20419 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28510 76 3e-16 >Contig28510 Length = 152 Score = 76.3 bits (186), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 41/122 (33%), Positives = 65/122 (53%) Query: 29 NKALISSLGFTFATTLTSWHLLVTFCSLHVALWMKLFEHKPFDAKAVMXXXXXXXXXXXX 88 NKAL+++ GF+FATTLT H T V W+ + ++ Sbjct: 31 NKALMATYGFSFATTLTGLHFATTTLMTVVLRWLGYIQPSHLPVSELLKFMVFANFSIVG 90 Query: 89 XXXXXXXXXVGFYQMTKLAIIPCTVLLETLFFRKKFSRSIQLALSILLMGVGIATVTDLQ 148 VGFYQ+ KL++IP + LLE + + ++SR +L++ I+L+GVG+ TVTD+ Sbjct: 91 MNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIGIVLLGVGVCTVTDVS 150 Query: 149 LN 150 +N Sbjct: 151 VN 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18694 (293 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7245 (280 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20266261 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24077 188 5e-50 >Contig24077 Length = 232 Score = 188 bits (477), Expect = 5e-50, Method: Compositional matrix adjust. Identities = 117/226 (51%), Positives = 128/226 (56%), Gaps = 43/226 (19%) Query: 2 VTSNQTIKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDRSISFAELLVKLGELCGKSVC 61 +T TIKFLCSYGGKILPRYPDGKLRY GGETRVLAV RSISF+EL KL ELCG SV Sbjct: 8 LTKVTTIKFLCSYGGKILPRYPDGKLRYLGGETRVLAVPRSISFSELSSKLTELCGPSVT 67 Query: 62 ---LRCQLPTEDLDALVSVTSDEDLANLIEEYDRVASPPASLKIRAFLXXXXXXXXXXXX 118 LRCQLPTEDLDALVS+ SDEDL NLIEEYDR AS A++KIRAFL Sbjct: 68 AVSLRCQLPTEDLDALVSIKSDEDLVNLIEEYDRAAS-SANMKIRAFLSLIPTARTPKSI 126 Query: 119 XXXXXXX--------------------XXXXXXXXRFTMPAA--VDLCHHQISPQ----- 151 RF MP++ VD C Q+ PQ Sbjct: 127 SSPSTSSASAASTTSSSGNSSSSNNYFSAASGSTPRFPMPSSTPVDRCLRQMPPQPSPST 186 Query: 152 VPFQKSSRKVPHYG--YHV---HGNP-------SHVYLIHNGNHWQ 185 VPFQ+ KVPH YH HG+ S YL+HNGNHWQ Sbjct: 187 VPFQRPPSKVPHCANIYHARQGHGSNKPASTTGSRPYLVHNGNHWQ 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8576 (323 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34890 (312 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2839 458 e-131 >Contig2839 Length = 289 Score = 458 bits (1178), Expect = e-131, Method: Compositional matrix adjust. Identities = 229/313 (73%), Positives = 253/313 (80%), Gaps = 25/313 (7%) Query: 1 MARRYDPNPF-DEEEVNPFSDPAVRGKTSTNYGGGAFYTTNPGSVPPASNSRLSPLPPEP 59 MA RYD NPF +EEEVNPFS NPG V PA NSRLSPLPPE Sbjct: 1 MAGRYDSNPFAEEEEVNPFS--------------------NPGIVAPAKNSRLSPLPPER 40 Query: 60 AGFNYDGGATIDIPLDTAGSNFQDLKKKERELQAKEAELRKREQEVKRKEDAAARAGIVL 119 AGFNY G +DIP+D DLKK+ERELQAKEAELRKRE+ V+RKE+AAARAGIVL Sbjct: 41 AGFNYGLGDPVDIPIDGNA----DLKKRERELQAKEAELRKREEIVRRKEEAAARAGIVL 96 Query: 120 EEKNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTFLGLACCLXXXXXXXXXXXXKGEGVK 179 EEKNWPPFFPIIHHDIANEIPIHLQ++QYVAFTT+LGL CL KGEGVK Sbjct: 97 EEKNWPPFFPIIHHDIANEIPIHLQRVQYVAFTTWLGLVLCLFWNVIAVTTAWIKGEGVK 156 Query: 180 IWFLAIIYFIAGVPGAYVLWYRPLYRAFRNESALKFGWFFMFYLLHIAFCIFAAVAPPVI 239 IWFLA+IYFI+G PG+YVLWYRPLYR FR+ESALK+GWFF+FYL+HI FCIFAAVAPP+ Sbjct: 157 IWFLAVIYFISGAPGSYVLWYRPLYRVFRSESALKYGWFFLFYLIHIGFCIFAAVAPPIF 216 Query: 240 FHGKSLTGILPAVDLIGDHVLVGIFYFIGFGMFCVESVLSIWVIQQVYMYFRGSGKAAEM 299 F GKSLTGILPA+D++GDHVLVGIFYFIGFGMFC+ESVLSIWVIQQVYMYFRGSGKAAEM Sbjct: 217 FKGKSLTGILPAIDVLGDHVLVGIFYFIGFGMFCLESVLSIWVIQQVYMYFRGSGKAAEM 276 Query: 300 KREAARGAMRAAL 312 +RE ARG +RAAL Sbjct: 277 RREGARGVVRAAL 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2820 (374 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3766256 (106 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16415 (283 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23194 (375 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25288 251 1e-68 >Contig25288 Length = 324 Score = 251 bits (642), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 166/382 (43%), Positives = 194/382 (50%), Gaps = 74/382 (19%) Query: 1 MSAFDAYSNDGEDVRASSNRPFDDDTFVEYDPSLPSRRXXXXXXXXXXXXXXXXXXXXXG 60 M++FDA+S DG+D+ A N FD D V Sbjct: 1 MASFDAFSMDGDDLHAP-NSHFDQDDVVV------------------------------- 28 Query: 61 GFPVEDEVTVDHVSHNVDGVHP--LPGMYGFEGSSMADDPNPNFSEDS--FSVPIANGNG 116 E D+ S+ G P ++GFE DP+PN+S + SVP+ NGNG Sbjct: 29 ------ESYADYGSYTDHGAAAPASPDVFGFE------DPSPNYSHSTPFDSVPVENGNG 76 Query: 117 KPYDISADNED--IFSSDGPVLPPPTEMQPEEGFILREWRRQNAIQLXXXXXXXXXMRNQ 174 Y + + D +F+SDGPVLP P+E EEG LREWRRQNAI L +RNQ Sbjct: 77 NGYGVDENGIDDGVFTSDGPVLPEPSEFV-EEGSALREWRRQNAILLEEKEKREKELRNQ 135 Query: 175 IIEEAEEYKRAFYEKRKVNIETNKTNNREREKLYLANQEKFHKEADKQYWKAIAELIPHE 234 IIEEAEE+KRAFYEKRK+N+ETNK NRE+EKL+L NQE FHK ADKQ WKAIAELIPHE Sbjct: 136 IIEEAEEFKRAFYEKRKLNVETNKVENREKEKLFLVNQENFHKNADKQSWKAIAELIPHE 195 Query: 235 VPNIEXXXXXXXXXXXXSITVIQGPKPGKPTDLSRMRHILVKLKHTPPPHMLXXXXXXXX 294 VPNIE I VIQGPKPGKPTDLSR+R +LVKLKH PPHM+ Sbjct: 196 VPNIEKRRGKKDQEKKPGIQVIQGPKPGKPTDLSRLRQVLVKLKHKTPPHMI-------- 247 Query: 295 XXXXXXXXXXXXXXXXXXXXXXXXXXXVKDGKDXXXXXXXXXX----------XXXXKDA 344 KD KD KDA Sbjct: 248 -----PPPPAPAKDAKDAKDAKDGKAPAKDAKDAKNAEDAAPKANGSAEAEVPASEAKDA 302 Query: 345 TSNGSPDTPEQAAPVAAEDQTA 366 TSNGS D PEQAAP E+ TA Sbjct: 303 TSNGSSDAPEQAAPAPTEELTA 324 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9627 (481 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41435 (320 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32125 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36904 (446 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28992 75 3e-15 >Contig28992 Length = 832 Score = 74.7 bits (182), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 93/385 (24%), Positives = 153/385 (39%), Gaps = 46/385 (11%) Query: 77 IALGYTSGTTASPKGVVLHHRGAYIMALSGALVWGMNEGAVYLWTLPMFHCNGWCFTWTL 136 + L YTSG+T PKGV LH G Y++ + + + + ++ C C W Sbjct: 444 LFLLYTSGSTGKPKGV-LHTTGGYMVYAATTFKYAFDYKSS-----DIYWCTADC-GWIT 496 Query: 137 AALCGTNICLRQVATKAIYQAIAND-------------GVTHLCAAPVVLNSIVNAPKSE 183 T L AT +Y+ N V+ AP ++ S++ Sbjct: 497 GHSYVTYGPLLNGATAVLYEGAPNYPDPGRCWDVVDKYKVSIFYTAPTLVRSLMRDSDEY 556 Query: 184 TILPLPRVVHVMTAGAAP-PPS----VLFAMSQQGFRVTHTYGLSETYGPSTVCAWKPEW 238 + + V+ + P PS V + ++ T+ +ET G + W Sbjct: 557 VTRYSRKSLRVLGSVGEPINPSAWKWVFNVVGDSKCPISDTWWQTET-GGFMITPLPGAW 615 Query: 239 DELPPETQARLNARQGVRYIGLEGLDVVSTTDMKPVPADGTTIGEIVMRGN--TVMKGYL 296 + P Q V D K V +G G + ++ + + Sbjct: 616 PQKPGSATFPFFGVQAV------------IVDEKGVEIEGECSGYLCVKSSWPGAFRTLY 663 Query: 297 KNPKANEETFAN---GWFHSGDLGVKHPDGYIQLKDRSKDIIISGGENISSVEIENAVYL 353 + + E T+ G++ SGD + DGY L R D+I G I + E+E+A+ Sbjct: 664 GDHERYETTYFKPFPGYYFSGDGCSRDKDGYHWLTGRVDDVINVSGHRIGTAEVESALVS 723 Query: 354 HPAVLEASVVARPDDRWGESPCAFVTLKPGVDRSDERRLAEDIMKFCRSKLPAYWIPKSV 413 HP EA+VV + G+ AFVTL GV S+E R + ++ R ++ + P + Sbjct: 724 HPQCAEAAVVGVEHEVKGQGIYAFVTLVEGVPYSEELR--KSLILAVRKQIGPFAAPDKI 781 Query: 414 VFGP-LPKTATGKIQKHLLRARAKE 437 + P LPKT +GKI + +LR A Sbjct: 782 HWAPGLPKTRSGKIMRRILRKIASR 806 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29266 (341 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7384 225 1e-60 >Contig7384 Length = 326 Score = 225 bits (573), Expect = 1e-60, Method: Compositional matrix adjust. Identities = 131/308 (42%), Positives = 176/308 (57%), Gaps = 3/308 (0%) Query: 21 SYGQLSPTYYDDTCPNASSIVRGVIQEAFISDVRIGASLIRLHFHDCFVNGCDGSLLLDN 80 S GQL +Y +CPN SIV + + A+ +RL HDCFV GCD S+++ + Sbjct: 22 SEGQLVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEGCDASIIIAS 81 Query: 81 TETIVSEKDAIPNANSTRGFEVVDSIKTALESSCPGIVSCADILAIAAEASVCMSGGPSW 140 + A + + GF+ V K A+E+ CPG+VSCADILA+AA V ++GGPS+ Sbjct: 82 PNGDAEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAGGPSF 141 Query: 141 TVLLGRRDSRIANQSGANTALPNPRQNITTLKAVFEAVGLNTTTDLVALSGAHTFGRGAC 200 V LGRRD I+ S LP P N+ L +F L + TD++ALSGAHT G C Sbjct: 142 PVELGRRDGLISKASRVAGNLPEPTFNLNQLTTMFAKHNL-SLTDVIALSGAHTLGFSHC 200 Query: 201 RFFSDRIYNFSGTESPDPSLNSSYLETLSALCPQDGDGTVLANLDPTTPDGFDKNYFSNL 260 FSDR+YNFS + + DPSLN Y + L A CP D ++ LDP TP FD Y+ NL Sbjct: 201 NRFSDRLYNFSPSSTVDPSLNPDYAKQLMATCPIAVDPNIVMTLDPDTPFTFDNAYYRNL 260 Query: 261 QENRGLLQSDQELFSTTGSDTIDIVNLFASNETAFFESFVESMIRMGNISPLTGTEGEIR 320 +GLL SDQ LFS + S + V FA+N F +FV +M ++G + TG +GEIR Sbjct: 261 VAGKGLLSSDQVLFSDSASRS--TVLNFANNADNFNGAFVTAMRKLGRVGVKTGNQGEIR 318 Query: 321 LDCRKVNN 328 DC N+ Sbjct: 319 RDCTTFNS 326 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14866265 (539 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51049 (161 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56745 (547 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13466 145 2e-36 >Contig13466 Length = 361 Score = 145 bits (365), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 99/288 (34%), Positives = 154/288 (53%), Gaps = 25/288 (8%) Query: 255 SAEVLGKGTFGTAYKAILEMGTVVAVKRLKDVTISEN--EFREKIEGVGAMDHEHLVPLR 312 S ++G+G++G Y A L G VAVK+L + E EF ++ V + HE+LV L Sbjct: 73 SKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPETNVEFLTQVSMVSRLKHENLVELL 132 Query: 313 AYYYSRDEKLLVYDYMPMGSLSALLHGNKGA-GRTP---LNWEIRSGIALGAARGIEYLH 368 Y + ++L Y++ MGSL +LHG KG G P L+W R IA+ AARG+EYLH Sbjct: 133 GYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVRIAVEAARGLEYLH 192 Query: 369 SQ-GPSVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTPNRVA-----------GYR 416 + P++ H +I+SSN+LL + + A+++DF L+ + P+ A GY Sbjct: 193 EKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLS-----NQAPDMAARLHSTRVLGTFGYH 247 Query: 417 APEVTDPRKVSQKADVYSFGVLILELLTGKAPTHAILNEEGVDLPRWVQSIVREEWTSEV 476 APE +++QK+DVYSFGV++LELLTG+ P + L W + E+ + Sbjct: 248 APEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQC 307 Query: 477 FDLELLRYQNVEEEMVQLLQLAIDCTAQYPDKRPPISEVTKRIEELCR 524 D +L Y + + +L +A C + RP +S V K ++ L + Sbjct: 308 VDPKLKDYP--AKGVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLK 353 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13708 (168 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13954 109 2e-26 >Contig13954 Length = 239 Score = 109 bits (273), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 72/160 (45%), Positives = 94/160 (58%), Gaps = 26/160 (16%) Query: 34 KLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLKKKLMRMGIDPNNHRLGE--------- 84 KLHALLGNRWSLIAGRLPGRTDNEVKNYWNSH++KKL++MGIDPNNHRL + Sbjct: 79 KLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGIDPNNHRLNQIIPRPNPQN 138 Query: 85 ----RASGTSKSFESRDQ-TSNPLISAADNNAVLDSTCGSASKTTSSLP---DLNLNLNV 136 A+ +S S + + T PL S+ D S S + +S P DLNL+L + Sbjct: 139 DSVSPAATSSGSMSNINACTKTPLKSSDDQIDHRASEAASVLEDETSGPSSRDLNLDLTI 198 Query: 137 GAPSVDEQMQ------LTGAN-SHKELEP--APFTTLLLF 167 P Q++ + G+N + +E+E TL+LF Sbjct: 199 AFPEPSLQVEEGMPKLIKGSNTTAREIETNLQHLPTLVLF 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34171 (100 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27048 (386 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22077 373 e-105 >Contig22077 Length = 213 Score = 373 bits (957), Expect = e-105, Method: Compositional matrix adjust. Identities = 180/211 (85%), Positives = 193/211 (91%) Query: 1 MAMVDEPLYPIAVLIDELKNADIQLRLNSIRRLSTIARALGEERTRNELIPFLSENNDDD 60 MAMVDE LYPIAVLIDELKN DIQLRLNSIRRLSTIARALGEERTR ELIPFLSENNDDD Sbjct: 1 MAMVDERLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD 60 Query: 61 DEVLLAMTEELGVFIPYVGGLEHACVLLPPLETLCTVEETRVRDKAVESLCRIGSQMKEN 120 DEVLLAM EELGVFIPYVGG+EHA +LLPPLETLCTVEET VRDKAV+SLC+IG QM+E Sbjct: 61 DEVLLAMAEELGVFIPYVGGVEHANILLPPLETLCTVEETCVRDKAVDSLCKIGGQMREK 120 Query: 121 DLINWFIPLVKRLASGEWFTARVSACGLFHIAYPSAPEMLKMELRAIYSQLCQDDMPMVR 180 DL+ +FIPLVKRLA+GEWFTARVS+CGLFHIAY SAPE LK ELR YSQLCQDDMPMVR Sbjct: 121 DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYTSAPETLKTELRTTYSQLCQDDMPMVR 180 Query: 181 RSAASSLWKFSATVEPVHLKNDIMTIFENLT 211 RSAAS+L KF+ TVE VHLK DIM+IFE+LT Sbjct: 181 RSAASNLGKFAGTVEAVHLKADIMSIFEDLT 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28701 (382 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19762 600 e-174 >Contig19762 Length = 385 Score = 600 bits (1548), Expect = e-174, Method: Compositional matrix adjust. Identities = 288/384 (75%), Positives = 339/384 (88%), Gaps = 3/384 (0%) Query: 1 MALKAVHVSDVPCLDQVPENASLGLYSTRFSAGVDVGRSSFRIPKFLVIGHRGSGMNMLQ 60 MALKAVHVSDVP LDQVPENAS+ LYS+RF+ G ++ R++ RIP+FLVIGHRG+GMN LQ Sbjct: 1 MALKAVHVSDVPNLDQVPENASMALYSSRFAKGAEMNRAAPRIPRFLVIGHRGNGMNALQ 60 Query: 61 SSDRRMKAIKENSILSFNTAAEFSVDFVEFDVQVTKDDIPVIFHDNFIFSEDNGVVYEKR 120 SSDRRM+AIKENSI+SFN AA F +DFVEFDVQVTKDD PVIFHD+FI SE+NG V+++R Sbjct: 61 SSDRRMRAIKENSIMSFNAAARFPIDFVEFDVQVTKDDCPVIFHDDFILSEENGTVFQRR 120 Query: 121 VTELLLSDFLRYGPQREPGKVGKSMLRKTKDGRIVNWNVEADDCLCTLKEAFEKVEPSLG 180 + EL LS+FL YGPQREPGK GK++LRKTKDG+IV W+VE DD LCTL+EAFE+V+PSLG Sbjct: 121 INELSLSEFLNYGPQREPGKEGKTLLRKTKDGKIVKWDVENDDPLCTLQEAFEQVDPSLG 180 Query: 181 FNIELKFDDNIVYEQEYLTHVLQAIVEVVFQYAKDRPIIFSTFQPDAAQLVRKLQSSYPV 240 FNIELKFDDNIVY+++YL VLQ++ +VVF+ +DRPIIFS+FQPDAA LV+KLQ++YPV Sbjct: 181 FNIELKFDDNIVYQEDYLFRVLQSVFQVVFECGRDRPIIFSSFQPDAALLVKKLQNTYPV 240 Query: 241 FFLTNGGTEVYYDVRRNSLEEAVKLCLEGGLQGIVSQVKAVFRNPAAVTKIKESKLSLLT 300 FFLTNGGTE+YYDVRRNSLEEA+KLC EGGLQGIVS+VK V RNP AVTKIKE+KLSLLT Sbjct: 241 FFLTNGGTELYYDVRRNSLEEAIKLCSEGGLQGIVSEVKGVLRNPGAVTKIKEAKLSLLT 300 Query: 301 YGQLNNVAEAVYMQHLMGVEGVIVDLVKEITEAVSDLMKP---SKEGDEESLPEGVGQMQ 357 YG+LNNV EAVYMQ+LMGVEGVIVD VKEITEAVSD++KP ++E + L E MQ Sbjct: 301 YGKLNNVPEAVYMQYLMGVEGVIVDFVKEITEAVSDMIKPLGGAEEDGGKRLLEEDRPMQ 360 Query: 358 VKSKPQFSQRELSFLLKLIPELIH 381 VKSKP+FS+RELSFLLKLIPELI Sbjct: 361 VKSKPEFSERELSFLLKLIPELIQ 384 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53094 (331 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8751 515 e-148 >Contig8751 Length = 325 Score = 515 bits (1327), Expect = e-148, Method: Compositional matrix adjust. Identities = 252/331 (76%), Positives = 287/331 (86%), Gaps = 6/331 (1%) Query: 1 MGRFPLLAIAMWSLSLSVCVFPDTASAQLKQNYYANICPNVENIVRGVVNMKFKQTFVTV 60 MGRF L I +WSL +S+C+ SAQLK NYYANICPNVE+IVR V KF+QTFVTV Sbjct: 1 MGRFHL--ILVWSLCISLCLLLCPTSAQLKTNYYANICPNVESIVRDAVTKKFQQTFVTV 58 Query: 61 PATLRLFFHDCFVQGCDASVIISSTGSNTAEKDHPDNLSLAGDGFDTVIKAKAEVDKNPT 120 P TLRLFFHDCFV+GCDASVI++ST +N AEKD+PDNLSLAGDGFDTVIKAKA VD P Sbjct: 59 PGTLRLFFHDCFVEGCDASVIVASTANNKAEKDNPDNLSLAGDGFDTVIKAKAAVDAVPQ 118 Query: 121 CRNKVSCADILTMATRDVIALSGGPSYAVELGRLDGLRSTSASVNGKLPQPTFNLDKLNS 180 C+NKVSCADIL +ATRDVI LSGGPSY+VELGRLDGL STS SVNGKLP+ TFNL++LNS Sbjct: 119 CKNKVSCADILALATRDVIGLSGGPSYSVELGRLDGLSSTSTSVNGKLPKSTFNLNQLNS 178 Query: 181 LFAANGLSQTDMIALSAAHTLGFSHCSKFANRIYNFSRENPVDPTLDKTYAAQLQSMCPK 240 LFA++GLSQ DM+ALS AHTLGFSHC++F+NRIY NPVDPTL+KTYA QLQ MCPK Sbjct: 179 LFASHGLSQADMVALSGAHTLGFSHCNQFSNRIY----SNPVDPTLNKTYATQLQQMCPK 234 Query: 241 NVDPRIAIDMDPTTPKKFDNVYYQNLQQGKGLFTSDEVLFTDSRSKPTVNTWASSSTAFQ 300 NVDP IAIDMDPTTP+KFDNVY+QNL +GKGLFTSD+VL+TDSRS+PTV TWA ++ AF Sbjct: 235 NVDPDIAIDMDPTTPRKFDNVYFQNLVEGKGLFTSDQVLYTDSRSQPTVRTWAKNNAAFN 294 Query: 301 TAFVQAITKLGRVGVKTGKNGNIRRDCSVFN 331 AF+ A+TKLGRVG+KTGKNGNIRRDCSVFN Sbjct: 295 QAFITAMTKLGRVGMKTGKNGNIRRDCSVFN 325 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2866265 (276 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig18919 162 6e-42 >Contig18919 Length = 282 Score = 162 bits (410), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 80/228 (35%), Positives = 130/228 (57%), Gaps = 1/228 (0%) Query: 1 MISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSEPPLDWTTRKRIALG 60 ++S HRNL++ G+C +L+Y +M NG++ L E ++W R IA Sbjct: 29 LLSRIHHRNLVQFLGYCQEDGRSMLIYEFMHNGTLKEHLYGPLTHEQSINWIKRLEIAED 88 Query: 61 SARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTI 120 +A+G+ YLH C P IIHRD+K++NIL+D+ A V DFGL+KL +HV++ VRGT+ Sbjct: 89 AAKGIEYLHTGCVPAIIHRDLKSSNILIDKHMRAKVSDFGLSKLAVDGASHVSSIVRGTV 148 Query: 121 GHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVXXXXXXX 180 G++ PEY + + ++K+DV+ +G++LLELI+GQ A + ++ W Sbjct: 149 GYLDPEYYISQQLTDKSDVYSFGVILLELISGQEAISNENFGVNCR-NIVQWAKLHIESG 207 Query: 181 XXXXXVDPDLQTNYVEAEVEQLIQVALLCTQGSPMERPKMSEVVRMLE 228 +DP L Y + ++ + AL+C Q RP MSEV++ ++ Sbjct: 208 DIQGIIDPSLDGEYDIQSMWKIAEKALMCVQAHGFMRPSMSEVLKEIQ 255 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26058 (329 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11006 372 e-105 >Contig11006 Length = 402 Score = 372 bits (954), Expect = e-105, Method: Compositional matrix adjust. Identities = 177/243 (72%), Positives = 211/243 (86%) Query: 1 MAALAKNCKGLKKLSCGSCTFGTKGINAVLDHCSALEELSVKRLRGMNDRGVAEPIGPGV 60 M + AKNCKGLKKLSCGSCTFG KG+NAVLD+CSALEELSVKRLRG+ D AEPIGPGV Sbjct: 160 MMSFAKNCKGLKKLSCGSCTFGAKGMNAVLDNCSALEELSVKRLRGITDGSAAEPIGPGV 219 Query: 61 AASSLKSLCLKELYNGQCFERLVVASKKLRTLKLFGCFGDWDRFLETVTDGNSNLVEIHL 120 AA+SLK++CLKELYNGQCF L++ +KKLRTLKLF C GDWD+ L+ +++ +++VEIHL Sbjct: 220 AAASLKTICLKELYNGQCFGPLIIGAKKLRTLKLFRCSGDWDKLLQVISERVTSMVEIHL 279 Query: 121 ERLQVTDMGLSAISKCLNLEILHILRTPECTNLGLVSVAGNCKLLRKLHIDGWRTNRIGD 180 E+LQV+D+GL+AIS CL+LEILH+++TPECTN+GLVSVA CKLLRKLHIDGW+ NR+GD Sbjct: 280 EKLQVSDVGLTAISNCLDLEILHLVKTPECTNVGLVSVAERCKLLRKLHIDGWKANRVGD 339 Query: 181 EGLIAVAKQCTNLQELVLIGVNPTSSSITAVASNCQKLERLALCGSQTIGDKEISSIAAK 240 EGL++VAK C NLQELVLIGVNPT S+ A+ASNC LERLALCGS T+GD EIS IA K Sbjct: 340 EGLVSVAKNCANLQELVLIGVNPTKVSLEALASNCPNLERLALCGSDTVGDVEISCIAVK 399 Query: 241 CTA 243 C A Sbjct: 400 CVA 402 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2674 (389 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8160 698 0.0 >Contig8160 Length = 389 Score = 698 bits (1801), Expect = 0.0, Method: Compositional matrix adjust. Identities = 340/389 (87%), Positives = 363/389 (93%) Query: 1 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPTNPCRLTAFLGYKAGMTHIVREV 60 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDP+ PC+LTAFLGYKAGMTHIVR+V Sbjct: 1 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCKLTAFLGYKAGMTHIVRDV 60 Query: 61 EKPGSKLHKKETCEAVTIIETPPMVVVGVVGYLKTPRGLRSLNTVWAQHLSEEVKRRFYK 120 EKPGSKLHKKETCEAVTIIE PPMVVVGVVGY+KTPRGLRSLNTVWAQHLSEEVKRRFYK Sbjct: 61 EKPGSKLHKKETCEAVTIIEAPPMVVVGVVGYVKTPRGLRSLNTVWAQHLSEEVKRRFYK 120 Query: 121 NWCXXXXXXXXXXXXXXESEDGKKDIQAQLEKMKKYCNVIRVLAHTQIRKMKGLKQKKAH 180 NWC ESE+GKK I++Q EK+ KY VIRVLAHTQIRKMKGLKQKKAH Sbjct: 121 NWCKSKKKAFSKYSKNYESEEGKKSIESQFEKLIKYATVIRVLAHTQIRKMKGLKQKKAH 180 Query: 181 LMEIQVNGGDVAKKVDYAYGFFEKQIPIDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240 LMEIQVNGG +A+KV++A FFEKQIPIDA+FQKDEMIDIIGVTKGKGYEGVVTRWGVTR Sbjct: 181 LMEIQVNGGTIAQKVEFAKSFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240 Query: 241 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKVGKTGQESHSAMT 300 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYK+GK GQESH+A+T Sbjct: 241 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKAGQESHTAVT 300 Query: 301 EFDRTEKDITPMGGFPHYGVVKDDYLLIKGCCVGPKKRVVTLRQSLLKQTSRVAMEEIKL 360 EFDRTEKDITP+GGFPHYGVVKDDY+LIKGCCVGPKKRVVTLRQSLLKQTSR+A+E+IKL Sbjct: 301 EFDRTEKDITPIGGFPHYGVVKDDYILIKGCCVGPKKRVVTLRQSLLKQTSRLALEDIKL 360 Query: 361 KFIDTSSKFGHGRFQTTQEKAKFFGRLKA 389 KFIDTSSKFGHGRFQTTQEK K++GRLKA Sbjct: 361 KFIDTSSKFGHGRFQTTQEKQKYYGRLKA 389 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22173 (531 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9766265 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19510 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27007 282 4e-78 >Contig27007 Length = 207 Score = 282 bits (722), Expect = 4e-78, Method: Compositional matrix adjust. Identities = 141/208 (67%), Positives = 169/208 (81%), Gaps = 3/208 (1%) Query: 1 MDSKMEEKDFLACCGSKKFAEEMTSSGPFANLDQAIDAARDIWFNKVDVNGWLEAFAAHP 60 M K EE++FLACC S KFA+EM + PF++LD+A+ AARDIWFNKVDVNGWL++F+AHP Sbjct: 1 MGLKFEEEEFLACCASTKFAKEMAEASPFSSLDEAVTAARDIWFNKVDVNGWLQSFSAHP 60 Query: 61 QIGQNPSAKHPSDTSAQWSKGEQSTALQTATDSSLQELSDWNARYWKKFGFVFLICASGR 120 QIG N + TSAQWSKGEQ+TA+ TAT SSLQEL++WNA+Y +KFGFVFLICASG+ Sbjct: 61 QIG-NSPSPSSHSTSAQWSKGEQATAVATATSSSLQELAEWNAKYRQKFGFVFLICASGK 119 Query: 121 TASEILAELKRRYPNRPIVEFEIAAQEQMKVTELRLAKLFSTQVKAASISTQNPETAAKK 180 ++ ILAELK+RYPNRPIVEFEIAAQEQMK+TELRLAKLF+ + S +NP AKK Sbjct: 120 SSDGILAELKKRYPNRPIVEFEIAAQEQMKITELRLAKLFAAKENVTSTGNKNPTIVAKK 179 Query: 181 AGEDRVSIIGAHLTAT-SEASAGKTPQI 207 A EDRVSIIG HLTAT SEAS+ K Q+ Sbjct: 180 A-EDRVSIIGGHLTATASEASSVKLSQL 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1799 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11167 (492 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48281431 324 2e-90 >48281431 Length = 178 Score = 324 bits (831), Expect = 2e-90, Method: Compositional matrix adjust. Identities = 150/178 (84%), Positives = 167/178 (93%) Query: 1 MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP 60 MDPYKYRPSSA+NSPFWTTN+GAPV NNNSSLTVGP GP+LLEDYHLVEKLANFDRERIP Sbjct: 1 MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPIGPVLLEDYHLVEKLANFDRERIP 60 Query: 61 ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR 120 +RVVHARGASAKGFF+ THDIS+L+CADFLRAPGVQTPVI+R+STVIHERGSPET+RDPR Sbjct: 61 KRVVHARGASAKGFFDVTHDISHLSCADFLRAPGVQTPVIVRYSTVIHERGSPETIRDPR 120 Query: 121 GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH 178 GFA KFYT EGN+DLVGNN P FF+RD +KFPD++HA KPNPKSHIQE WR++DF SH Sbjct: 121 GFAAKFYTGEGNWDLVGNNLPAFFVRDAVKFPDVIHAFKPNPKSHIQEYWRVLDFLSH 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1285 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57051 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig17022 323 1e-90 >Contig17022 Length = 443 Score = 323 bits (828), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 145/243 (59%), Positives = 192/243 (79%) Query: 1 MLDEGQASTSDEFRVFYADRSPWNLIIKAFGMPGHGSRLYDNSAMENLMKSVEIITKFRE 60 +LDEG AS ++ +R FYA+R P L+IKA G PGHG++LYDN+AMENL+KS+E + +FR Sbjct: 189 VLDEGLASPTETYRAFYAERCPMWLVIKATGAPGHGAKLYDNTAMENLLKSIESVRRFRA 248 Query: 61 SLFDVVKAGKAANSEVISVNPVYLKAGIPSPTGFVMNMQPSEAEAGFDLRMPPTADPDLV 120 + FD+VKAG A EVISVN V+LKAG P+PTGFVMNMQPSEAEAGFD+R+PP AD + + Sbjct: 249 AQFDLVKAGLKAEGEVISVNMVFLKAGTPTPTGFVMNMQPSEAEAGFDIRVPPIADQESL 308 Query: 121 KIRIAEEWAPAIRNMTYQIIEKGPIRDYMGRPLMTLTNDSNPWWSIFKQAITEAGGKLAK 180 + RIAEEWAP RNMT++ +K + D G+P++T T+ SNPWW++ + A+ +A GKL K Sbjct: 309 EKRIAEEWAPTSRNMTFRFKQKVSVLDKSGKPILTATDSSNPWWALLEDAVKKANGKLGK 368 Query: 181 PEILASTTDARYMRQMGIPTLGFSPMTNTPILLHDHNEFLKDTIYLRGIKVYESVISSLS 240 PEI ++TDARY R +G+P +GFSPM NTPILLHDHNEFL YL+GI++YES+I + + Sbjct: 369 PEIFPASTDARYFRNLGLPAIGFSPMANTPILLHDHNEFLNKDEYLKGIEIYESIIKAYA 428 Query: 241 SFV 243 S+V Sbjct: 429 SYV 431 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31880 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19252 92 7e-21 >Contig19252 Length = 125 Score = 92.4 bits (228), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 2/86 (2%) Query: 163 SATCPIDTLKLGACVDLLGGLVHIGLGDPVANECCPVLSGLVELEAAVCLCTTLKIKLLN 222 + TCP DTLKLGACVDLLG LV++ +G P + CC +L GL +LEAA+CLCT +K L Sbjct: 40 AETCPKDTLKLGACVDLLG-LVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALG 98 Query: 223 LNIFVPLALQLLIT-CGKTPPPGYTC 247 LN+ VP+AL LL++ C KT PPG+ C Sbjct: 99 LNMEVPVALSLLVSACQKTVPPGFKC 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12 (142 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21666261 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv62748 (238 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8751 88 2e-19 >Contig8751 Length = 325 Score = 87.8 bits (216), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/137 (35%), Positives = 74/137 (54%), Gaps = 6/137 (4%) Query: 103 SFGLRNFRYLDRFAAIGIDTPGLVALLGAHSVGRTHCVKLVHRLYPE-VDPVLNTDHVEH 161 +F L L FA+ G+ +VAL GAH++G +HC + +R+Y VDP LN + Sbjct: 170 TFNLNQLNSL--FASHGLSQADMVALSGAHTLGFSHCNQFSNRIYSNPVDPTLNKTYATQ 227 Query: 162 MLHKCPDAIPDPKAVQYVRNDRGTPMKLDNNYYRNILDNKGLLIVDHQLATDKRTKPYVK 221 + CP + DP + D TP K DN Y++N+++ KGL D L TD R++P V+ Sbjct: 228 LQQMCPKNV-DPDIA--IDMDPTTPRKFDNVYFQNLVEGKGLFTSDQVLYTDSRSQPTVR 284 Query: 222 KMAKSQDYFFKEFCRAI 238 AK+ F + F A+ Sbjct: 285 TWAKNNAAFNQAFITAM 301 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18033 (261 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52183 (405 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51307 (258 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7976 306 2e-85 >Contig7976 Length = 241 Score = 306 bits (785), Expect = 2e-85, Method: Compositional matrix adjust. Identities = 157/245 (64%), Positives = 196/245 (80%), Gaps = 13/245 (5%) Query: 12 LISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALS 71 +I SLV + + G Y G W +AHATFYGG DASGTMGGACGYGNLYSQGYG NTAALS Sbjct: 8 VIGFLSLV-SSVNGYY--GGWSNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALS 64 Query: 72 TALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPH 131 TALFNNGL+CGAC++++C NDP WC GS I++TATNFCPP GGWC+PP+ H Sbjct: 65 TALFNNGLTCGACYQIRCVNDPQWCLPGS--IIVTATNFCPP--------GGWCDPPQQH 114 Query: 132 FDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGDIVR 191 FDL+ P+FL+IA+Y+AG+VPV++RRV CR++GG+RFT+NG YFNLVL+TNV GAGD+ Sbjct: 115 FDLSQPVFLRIAQYKAGVVPVSYRRVRCRRRGGIRFTVNGHSYFNLVLVTNVGGAGDVQS 174 Query: 192 ASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSWNIAPAHWQFGQTF 251 ++KGS+T W ++SRNWGQNWQSN+ L GQSLSF VT SD R S+N+AP +W FGQT+ Sbjct: 175 VAIKGSRTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSYNVAPPNWSFGQTY 234 Query: 252 SGKNF 256 +G+ F Sbjct: 235 TGRQF 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15978 (274 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30575 65 2e-12 >Contig30575 Length = 332 Score = 64.7 bits (156), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 50/154 (32%), Positives = 73/154 (47%), Gaps = 33/154 (21%) Query: 96 MMTGDNWATATAIAKEVGI-----------------------KE---------VYAETDP 123 M+TGDN TA AIA E GI KE V + P Sbjct: 1 MVTGDNLQTAKAIALECGILLSLEDATEPTIIEGKTFRELSEKEREQTAKKITVMGRSSP 60 Query: 124 LGKAERIKNLQMKGMTVAMVGDGINDSPALVAADVGMAIG-AGTDVAIEAADIVLIKSNL 182 K ++ L+ G VA+ GDG ND+PAL AD+G+++G GT+VA E++DIV++ N Sbjct: 61 NDKLLLVQALRKGGEVVAVTGDGTNDAPALHEADIGLSMGIQGTEVAKESSDIVILDDNF 120 Query: 183 EDVITALDLSRKTMSRIRLNYVWALGYNVLAMPV 216 V+ + R + I+ + L NV A+ + Sbjct: 121 ASVVKVVRWGRSVYANIQKFIQFQLTVNVAALVI 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38640 (513 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2428 (217 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6806 (388 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8189 120 3e-29 >Contig8189 Length = 136 Score = 120 bits (302), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 60/144 (41%), Positives = 82/144 (56%), Gaps = 15/144 (10%) Query: 248 MNPMVAYQKGLTTWAKWVDLNLDPHKTRVIFRSVSPRHNRQNGWK-----CYNQKQPLEF 302 M+ + AY KGL+TWA+WVD N+D +T+V F+ +SP H + W C + PL Sbjct: 1 MDRLTAYYKGLSTWARWVDSNVDTSRTKVFFQGISPTHYQGKEWNSPKKTCSGELGPLSG 60 Query: 303 FSHQLHVPEQMVVLKGVLKGMRFPVYLQDITMMSALRKDGHPSVYTRAMDQEQKQHPRDF 362 ++ P + V+ VL ++ PVYL DIT +S LRKD HPS Y+ Sbjct: 61 STYPAGAPPSVAVVYKVLSTIKNPVYLLDITTLSQLRKDAHPSTYSGDHSGN-------- 112 Query: 363 TSDCSHWCLPGVPDAWNEMLSALL 386 DCSHWCLPG+PD WN++L A L Sbjct: 113 --DCSHWCLPGLPDTWNQLLYAAL 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47074 (437 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21354 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22056 (487 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13739 848 0.0 >Contig13739 Length = 485 Score = 848 bits (2190), Expect = 0.0, Method: Compositional matrix adjust. Identities = 407/465 (87%), Positives = 425/465 (91%), Gaps = 1/465 (0%) Query: 1 MAPIRGILTLQRMALVSRQSKKWGPGCRAFXXXXXXXXXXXXXXXXXXXXEKTHFGGLKD 60 MAPI+GIL+LQR AL KWG R+F EKTHFGGLKD Sbjct: 1 MAPIKGILSLQRAALARHHGAKWGLAFRSFSTQGAAPSTTAQPPPPPPP-EKTHFGGLKD 59 Query: 61 EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKSGLRGRGGAGFPSGL 120 EDRIFTNLYGLHDPFLKGAMKRGDWYRTKD+V+KG+DWIVNEMKKSGLRGRGGAGFPSGL Sbjct: 60 EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGL 119 Query: 121 KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATTAYIY 180 KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+ AYIY Sbjct: 120 KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY 179 Query: 181 IRGEYVNERKNLERARKEAYEAGLLGKNACGSGYDFDVHIHYGAGAYICGEETALLESLE 240 IRGEYVNER NL +AR EAY AGLLGKNACGSGYDFDVHIH+GAGAYICGEETALLESLE Sbjct: 180 IRGEYVNERLNLVKARNEAYAAGLLGKNACGSGYDFDVHIHFGAGAYICGEETALLESLE 239 Query: 241 GKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGPEWFAGFGRKNNAGTKLYC 300 GKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGPEWFA FGRKNN+GTKL+C Sbjct: 240 GKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGPEWFASFGRKNNSGTKLFC 299 Query: 301 VSGHVNKPCTVEEEMSIPLKELIERHCGGVRGGWDNLLAVIPGGSSVPLLPKHICDDVLM 360 +SGHVNKPCTVEEEMSIPLKEL+ERHCGGVRGGWDNLLAVIPGGSSVPLL K IC+DVLM Sbjct: 300 ISGHVNKPCTVEEEMSIPLKELLERHCGGVRGGWDNLLAVIPGGSSVPLLTKDICNDVLM 359 Query: 361 DYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREGTGWLLMMME 420 D+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREGTGWL M+ME Sbjct: 360 DFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTGWLWMIME 419 Query: 421 RLKVGNANLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHF 465 R+KVGNA LEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHF Sbjct: 420 RMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHF 464 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12166257 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2543 116 3e-28 >Contig2543 Length = 199 Score = 116 bits (290), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 72/197 (36%), Positives = 100/197 (50%), Gaps = 11/197 (5%) Query: 10 KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQER 69 K+++LGD G GKTSL+ ++V KF ++TIGA F T+ + + IWDTAGQER Sbjct: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 Query: 70 FQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKVDV 129 + SL +YRGA V+VYD+ M SF W E QA+P+ + GNK D+ Sbjct: 72 YHSLAPMYYRGAAAAVVVYDITSMDSFLRAKKWVLEVQRQANPT----LIMFLAGNKADL 127 Query: 130 DGGNSRVVSDKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKTGEEEEIYLPD 189 + + R V ++ + G + + ETSAK NV E F IAK K + Sbjct: 128 E--DKRKVGSEEGEQYAKENG-LVFLETSAKTAQNVNELFYEIAKKLAKASPSRQ----S 180 Query: 190 TIDVGSSSQQRSSGCEC 206 I + S S Q S C Sbjct: 181 GIKLHSRSPQNSRRMFC 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv41852 (205 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27916 125 4e-31 >Contig27916 Length = 246 Score = 125 bits (315), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 61/134 (45%), Positives = 87/134 (64%), Gaps = 11/134 (8%) Query: 72 ESGDRPGVEEYYKRMLEENPSNPLFLRNYAQFLYQSKHDLQAAEEYLCRAILADPRDGEI 131 E G++ + YY+ ML+ NP +PL LRNY +FL++ + D AEE CRAIL P DGE+ Sbjct: 111 EEGEQRKIGAYYQEMLKSNPGDPLLLRNYGKFLHEVEKDAVGAEECYCRAILGSPGDGEL 170 Query: 132 LSQYAKLVWELHRDQDRASSYFERAVQAAPEDSHVQAAYASFLWQT----------EEDD 181 LS YAKL+WE RD++RA SYF++AV A+P+D V ++ASF+W+ E + Sbjct: 171 LSLYAKLIWETQRDEERAKSYFDQAVSASPDDCMVLGSFASFMWEAEEDEDEDDSKEINI 230 Query: 182 DDGTCHVDAMPTLL 195 DGT V ++P L+ Sbjct: 231 YDGT-QVSSVPALV 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50199 (415 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10257 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19252 72 9e-15 >Contig19252 Length = 125 Score = 71.6 bits (174), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 37/62 (59%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Query: 148 QTCPIDTLKLGACVDLLGGLVHIGIRSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLNV 207 +TCP DTLKLGACVDLLG LV++ I S CC +L+GL DL+AA+CLCT IK L + Sbjct: 41 ETCPKDTLKLGACVDLLG-LVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALGL 99 Query: 208 NI 209 N+ Sbjct: 100 NM 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5906 (187 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46095 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10799 323 1e-90 >Contig10799 Length = 252 Score = 323 bits (828), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 163/211 (77%), Positives = 181/211 (85%), Gaps = 1/211 (0%) Query: 1 MAFNKLTDSGSSTPAGLVAAALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLL 60 MAF KLTD ++TP+GLVAAALAH F LFVAV++ ANISGGHVNPAVTFGAFIGG+I+LL Sbjct: 42 MAFAKLTDDAATTPSGLVAAALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLL 101 Query: 61 RGILYWIAQLLGSVVACLLLKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYA 120 RG+LYWIAQLLG+ VAC LLK T G T+AFSLS GV VWNA VFEIVMTFGLVYTVYA Sbjct: 102 RGLLYWIAQLLGATVACGLLKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYA 161 Query: 121 TAVDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWSWANHWVYWA 180 TA+DPKKG++G IAPIAIGFIVGANILAGGAFDGASMNPAVSFGPA+VSWSW NHWVYWA Sbjct: 162 TAIDPKKGSVGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWA 221 Query: 181 GPLXXXXXXXXXYDLIFI-DSTHEQLPTTDY 210 GPL Y+ +FI +S HEQLP+TDY Sbjct: 222 GPLIGAGIAGVIYEFVFIGNSGHEQLPSTDY 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2096 (151 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6839 239 2e-65 >Contig6839 Length = 289 Score = 239 bits (610), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 1/151 (0%) Query: 1 MIMQCLGAICGAGMVKWFQRRD-FETLGGGINAVASGYSKLAGLGAEIVGTFVLVYTVLS 59 ++MQ LGAI GA +VK F++ FE LGGG N+VA GY+K GLGAEI+GTFVLVYTV S Sbjct: 139 IVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANSVAHGYTKGQGLGAEIIGTFVLVYTVFS 198 Query: 60 ATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRGNAWDD 119 ATDAKR+ARDSHVPILAPLPIGFAVFLVHLATIP+TGTGINPARSLGAAIIYN+ +AWDD Sbjct: 199 ATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPARSLGAAIIYNKKHAWDD 258 Query: 120 MWIFWVGPFIGATLATLYHQIVIRAISFKTR 150 WIFWVGPFIGA LA LYH +VIRAI FK++ Sbjct: 259 HWIFWVGPFIGAALAALYHVVVIRAIPFKSK 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7366262 (120 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13274 (107 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20752 (307 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 55855564 191 2e-50 >55855564 Length = 161 Score = 191 bits (484), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 95/129 (73%), Positives = 108/129 (83%) Query: 7 SHPYSSKRSEGEFKDFVTARKVQKADREKLRRDRLNEQFIELGNALDPDRPKNDKATILS 66 S+ S +R + E KD + ARKVQKADREKLRRDRLNE F ELGN LDPDRPKNDKATIL+ Sbjct: 29 SNSDSRQRLDVETKDPIVARKVQKADREKLRRDRLNEHFFELGNTLDPDRPKNDKATILT 88 Query: 67 DTIQLLKDSTAQVEKLKAENASLNEESRELTQEKNDLREEKASLKSATENLNVQYQQRVR 126 DTIQ+LKD T V KLKAE ++L +ESRELTQEKN+LREEKASLKS ENLNVQYQQR+R Sbjct: 89 DTIQMLKDLTTDVNKLKAECSALTDESRELTQEKNELREEKASLKSDIENLNVQYQQRLR 148 Query: 127 AMFPWSAID 135 MFPW+ +D Sbjct: 149 VMFPWAGMD 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13591 (204 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17425 (172 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv927 (74 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig31982 58 4e-11 >Contig31982 Length = 239 Score = 57.8 bits (138), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 27/47 (57%), Positives = 34/47 (72%) Query: 3 SQDRGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTNAAGNVASP 49 S ++G +PKFGEWD N+PASA+GFT IFNK R+EK A G + P Sbjct: 169 SPEKGAAVPKFGEWDENDPASADGFTHIFNKVREEKAGKAPGTPSHP 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49339 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2666262 (383 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11372 62 2e-11 >Contig11372 Length = 541 Score = 61.6 bits (148), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 19/146 (13%) Query: 18 SDEELF-TCLQGMINGSPLPDNVIIEVNPYQHNPSCLPDRV--------WYLTSSEDTKF 68 +D EL L+ ING+ VI E++ + P LPD W+ +D K+ Sbjct: 18 TDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTTDPEWFFFCPQDRKY 77 Query: 69 ----------AEGFWKPKGEPYEIFSNSSITGWRTTFEFYEGTTPHVLKTDWVLQQYKIT 118 G+WK G+ +I S+ + G + T F+ G P +T+WV+ +Y+ T Sbjct: 78 PNGHRLNRATIRGYWKATGKDRQIKSDKILIGMKKTLVFHIGRAPKGKRTNWVMHEYRAT 137 Query: 119 QKGQSKNIKPMASSSLCRVFQSREQS 144 QK +S LCR+F+ ++++ Sbjct: 138 QKELDGTNPGQSSFVLCRLFKKQDET 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15037 (398 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27214 265 1e-72 >Contig27214 Length = 297 Score = 265 bits (676), Expect = 1e-72, Method: Compositional matrix adjust. Identities = 135/207 (65%), Positives = 163/207 (78%) Query: 192 IEKIAEANLHIDALCMAFYARSEEARQTHSVHKXXXXXXXXXXXXSKGLPIQTEIVVLHK 251 IEK+AEANLHI+ALC+AFYARSEEARQTHS HK SKGLPI+ EI LH Sbjct: 91 IEKMAEANLHINALCVAFYARSEEARQTHSAHKFALGALALDDALSKGLPIEREIEALHT 150 Query: 252 YLDGIXXXXXXXXXXXXXPEETRNHGTDTVLQLNQKFDDLKATLRHFSLIPPGGGGILAH 311 YL+GI PEETR +GTDT+LQLNQKFD LK T+RH SLIP GGGGILAH Sbjct: 151 YLEGIDKDSILDVVLSSLPEETRRNGTDTLLQLNQKFDALKGTVRHLSLIPLGGGGILAH 210 Query: 312 SLANVASRLKVKQGDQSGDGIESVINRVESYLAQGQLVEAADALEDGVRGSEAAEIIVDW 371 SLA++AS LKVK+ D SGDGIES+IN+VE YLA+G++ EAA+ALE+GV+G++A ++ +W Sbjct: 211 SLAHIASWLKVKEVDHSGDGIESIINKVEYYLAEGKIAEAAEALEEGVKGTQAMGVVSEW 270 Query: 372 VKQARNRAIAEQALTLLQSYATSVSLT 398 VK+ARNRAI +QALTLLQSYATS+S+T Sbjct: 271 VKRARNRAITDQALTLLQSYATSISVT 297 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22651 (87 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61295 (299 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22560 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37239 (257 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9034 85 1e-18 >Contig9034 Length = 386 Score = 84.7 bits (208), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 36/58 (62%), Positives = 44/58 (75%) Query: 54 YRGVRMRTWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGNSAILNFPE 111 YRG+R R WGKW +EIR+PRK R+WLGTF+T E AARA+D A I+G A +NFPE Sbjct: 114 YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26961 (285 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8059 142 6e-36 >Contig8059 Length = 222 Score = 142 bits (358), Expect = 6e-36, Method: Compositional matrix adjust. Identities = 94/246 (38%), Positives = 128/246 (52%), Gaps = 37/246 (15%) Query: 43 RSTASDFVLQWGNRKRLRCMKIQVKDDSAPVHKTTXXXXXXXXXADKDSLNQPTTTAAAT 102 R++ +F LQWGNRKRLRC++++ + SA K + +T+ Sbjct: 11 RASEPEFFLQWGNRKRLRCVRVKGSEISAERFKFNGGMCRTITSSRIHRF--AVSTSGKD 68 Query: 103 SNGYFNLRHRXXXXXXXXXXXXXRVLRNSENSSAMKGQSNGVRGFSSPARDQ---DRRGX 159 +G+ R+ RNS+ + ++ + R SSP +++ RRG Sbjct: 69 ISGF----------------QSNRLTRNSD-GALLRCSAGENRKSSSPEKEERYYTRRGS 111 Query: 160 XXXXXXXXXXXXXKSASSETAHDXXXXXXXXXXXXXEAVPPVWPPKFVIALTNKEKEEDF 219 E+ + E VWP K I L++KEKEEDF Sbjct: 112 V--------------GVDESCNGNGNGKVMMDGNNVEDRGLVWP-KLYITLSSKEKEEDF 156 Query: 220 MAIKGSKLPQRPKKRAKFIQRTLNLVSPGAWLCDLTLERYEVREKKISKKKPRGLKAMGN 279 +A+KG KLPQRPKKRAK IQR+L LVSPGAWL D+ ERYEVREKK +KKK RGLKAMG+ Sbjct: 157 LAMKGCKLPQRPKKRAKLIQRSLLLVSPGAWLTDMCQERYEVREKKSTKKKSRGLKAMGS 216 Query: 280 MESDSE 285 +E+DSE Sbjct: 217 LETDSE 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14030 (80 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18823 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18824 (149 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17597 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57243 (253 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv50164 (249 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv11919 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21920 (109 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2737 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12739 326 1e-91 >Contig12739 Length = 169 Score = 326 bits (836), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 157/169 (92%), Positives = 165/169 (97%) Query: 1 MANTSRLYFTCIRNTLEAAMCLQNFPCQEVERHNKPEVELKTSPEVLLNPVLICRNEAEK 60 M+N+ RLY CIRNTL+AAMCLQNFPCQEVERHNKPEVELKTS E+LLNPVLICRNEAEK Sbjct: 1 MSNSLRLYLACIRNTLDAAMCLQNFPCQEVERHNKPEVELKTSSELLLNPVLICRNEAEK 60 Query: 61 CLIETSINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFLITN 120 CLIETSINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFL+TN Sbjct: 61 CLIETSINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFLVTN 120 Query: 121 YHCEDMQKHKLIDFIVQFMEDIDKEISELKLSVNTRGRLVATEFLKQFI 169 YHCE+MQKHKLIDFIVQFMEDIDKEISELK+SVNTRGRLVATEFLKQF+ Sbjct: 121 YHCEEMQKHKLIDFIVQFMEDIDKEISELKMSVNTRGRLVATEFLKQFM 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35366259 (371 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36473 (67 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3577 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15312 (154 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31219 (252 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22024 357 e-100 >Contig22024 Length = 301 Score = 357 bits (916), Expect = e-100, Method: Compositional matrix adjust. Identities = 177/238 (74%), Positives = 199/238 (83%), Gaps = 1/238 (0%) Query: 1 MKPIFCGNLEYDARQSDVERLFRRYGKVDRVDLKSGFAFVYMXXXXXXXXXXXXXXXTVF 60 M+PIFCGNL++DARQSDVERLF+RYGKV+RVD+KSGFAFVYM T F Sbjct: 1 MRPIFCGNLDFDARQSDVERLFKRYGKVERVDIKSGFAFVYMDDERDAEYAIRRLDRTEF 60 Query: 61 GRKGRQLRVEWTKQERGIRRPGGSRKSSANMKPSKTLFVINFDPIHTRTRDLERHFDLYG 120 GRKGR+LR+EWTK ERGIRRP SR+ SANMKPSKTLFVINFDP+HTRT+DLERHFD YG Sbjct: 61 GRKGRRLRIEWTKHERGIRRPD-SRRPSANMKPSKTLFVINFDPVHTRTKDLERHFDPYG 119 Query: 121 KILNIRIRRNFAFIQFESQEDATKALDATNMSKFMDRVISVEYAAXXXXXXXXNGYSPER 180 KI NIRIRRNFAFIQ+ESQEDATKAL+ATN SKFMDRVISVEYAA NG+SP+R Sbjct: 120 KITNIRIRRNFAFIQYESQEDATKALEATNTSKFMDRVISVEYAARDDDDDKRNGHSPDR 179 Query: 181 RGRDMSPDRRSHDRGRSPSPYHRDRASPDYGHGANANSRSEPRGSPNYDRDESPVNER 238 RGRDMSP+RRS+DRGRSPSPY RDR SPDYGHGA +SR+E R SP+Y+R SPVN+R Sbjct: 180 RGRDMSPERRSNDRGRSPSPYRRDRGSPDYGHGARVSSRTESRRSPDYERAASPVNDR 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8820 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3139 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33548 (269 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48206 (194 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48693757 239 2e-65 >48693757 Length = 150 Score = 239 bits (611), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 121/158 (76%), Positives = 132/158 (83%), Gaps = 9/158 (5%) Query: 1 MEKALMKVSSLKAGSFWISSKAKEEFSNITQDITDICFKNGLLCKQKHEKYISNTVEEKA 60 MEKAL KV+SLK GS WIS KAKEEFSNI+ D++ +C + SNTVEEKA Sbjct: 1 MEKALTKVNSLKVGSLWISKKAKEEFSNISDDLS--------VCNSNLSTF-SNTVEEKA 51 Query: 61 KWVFNKLKGKPLKTLPDLLREYNLPPGLFPQNITCYEFDESKAKLTVYLPSACEVSFSDS 120 KWVFNKLKGKP K+LPDLLREYNLPPGLFPQNITCYEFDE+K+KL VY+PSACEVSF DS Sbjct: 52 KWVFNKLKGKPPKSLPDLLREYNLPPGLFPQNITCYEFDETKSKLIVYMPSACEVSFKDS 111 Query: 121 SVIRYATRVKGILLRGKLTGIEGMKTKVLVWVKVTNVA 158 SV+RYATRVK ILLRGKLTGIEGMKTKVLVWVKVT V Sbjct: 112 SVMRYATRVKAILLRGKLTGIEGMKTKVLVWVKVTCVV 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10966264 (513 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25486 90 1e-19 >Contig25486 Length = 460 Score = 89.7 bits (221), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 93/409 (22%), Positives = 167/409 (40%), Gaps = 67/409 (16%) Query: 96 TTKISKCLNLGSYNYLGFAASDEFCTPRVIESLKRFSPGTCSTRVDGGTTTLHKEVEECV 155 T K K L +YLG ++ +L+ G + + G T H+ +E C+ Sbjct: 84 TQKFKKLLLFSGNDYLGLSSHPTIGKAAAKAALEH-GMGPRGSALICGYTDYHRRLESCL 142 Query: 156 ANFVGKPAAIVFGMGYVTNSAILPVLIGKGGL--------------IISDSLNHNSIVNG 201 A+ K ++ G+ N A++ L G L + SD+LNH SI++G Sbjct: 143 ADLKKKEDCLLCPTGFAANMALMVALGNVGSLLSAGKMPLTNEKIAVFSDALNHASIIDG 202 Query: 202 ----ARGSGATVRVFQHNIPSHLEKVLREQIAEGQPRTHRPWKKIIVVVEGIYSMEGELC 257 R + +++H +HL +L +K +VV + ++SM+G+ Sbjct: 203 IRLAERQKSVEIFIYRHCDMAHLNALLSSCTM----------RKKVVVTDTLFSMDGDFA 252 Query: 258 KLPEIVAICKKYKVCSSTQKNLQSSGACYRYASMTYKAYVYLDEAHSIGAVGKTGRGVCE 317 + E+V + +++ + +D+AH GK G GV E Sbjct: 253 PITELVKLRREHDF------------------------LLVIDDAHGTFVCGKNGGGVAE 288 Query: 318 LLGVDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS 377 + DVDI +GT +K+ G GG+IA SK Q+++ + +++T+ P A + Sbjct: 289 EYNCE-GDVDICVGTLSKAAGCHGGFIACSKRWKQFIQSRGRSFIFSTATPVPIAAAAHA 347 Query: 378 SIKVILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPA 437 ++ V E R RE N + G + +SP++ +++ + K Sbjct: 348 AVFVARKE---------TWRRREIWNRVKDFRALTGIPI----NSPIISLIVGSEEKALQ 394 Query: 438 FSRECLKQNXXXXXXXXXXXXLLLARARICISASHTREDLIKGLEVISR 486 S+ LK R R+ +SA+HTR D+ + +SR Sbjct: 395 ASQSLLKSGFHVTAIRPPTVPPNSCRLRVTLSATHTRNDVERFTAALSR 443 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31981 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2138 (88 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv569 (284 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13102 351 9e-99 >Contig13102 Length = 291 Score = 351 bits (900), Expect = 9e-99, Method: Compositional matrix adjust. Identities = 187/288 (64%), Positives = 210/288 (72%), Gaps = 8/288 (2%) Query: 1 MDPPLINESSFSAANPSAYSLAEIWPFPVNSASAIGEPTAGLGLRIANFGQIMGQFADSS 60 MDPPLINESSFSAA+P++YSLAEIWP + G +G +FG + DSS Sbjct: 8 MDPPLINESSFSAAHPASYSLAEIWPISGEPGGSGGGLGLRMGNLGQSFGGL----GDSS 63 Query: 61 ANRDVSVDESTVTEQXXXXXXXXXXXXXXXEDEXXXXXXXXXXXGMNASNGKRMKISRTP 120 NRD S++ESTVTEQ EDE G+ S GKRMK++ + Sbjct: 64 VNRDGSLEESTVTEQSGGGCGGRKRRDVSSEDESSKQVSTSSGNGLKYSGGKRMKLAGSS 123 Query: 121 DENGGSKAELEASSVAGE-KPAEES-KPAEQSKQDYIHVRARRGQATDSHSLAERARREK 178 +ENG KAE+E SS AG+ KPAEES KP+E KQD+IHVRARRGQATDSHSLAERARREK Sbjct: 124 NENGSLKAEVEESSAAGDNKPAEESTKPSEPPKQDFIHVRARRGQATDSHSLAERARREK 183 Query: 179 ISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRMNH--TVE 236 ISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQ QVEFLSMKLEAVNSRMN T+E Sbjct: 184 ISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQHQVEFLSMKLEAVNSRMNMNPTIE 243 Query: 237 GFPLKDLGVQTFDAAAMIYGSQATREYAQGSQPEWLHMQVGGSIERAS 284 FP KDLG Q FDAA +++GS REYAQ SQPEWLHMQVGGS ERA+ Sbjct: 244 AFPPKDLGAQPFDAAGLLFGSHTPREYAQSSQPEWLHMQVGGSFERAT 291 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28791 (191 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32375 (334 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10294 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7542 541 e-156 >Contig7542 Length = 285 Score = 541 bits (1395), Expect = e-156, Method: Compositional matrix adjust. Identities = 248/284 (87%), Positives = 274/284 (96%) Query: 1 MEAKPTEISGSKMFGGYNKRFKHFSPTLGCSMTFHVYFPPLPSPSHKFPVLYWLSGLSCT 60 ME KP+E+S SKMFGGYNKR+KHFSPTLGCSMTFH+YFPP PSPSH+FPVLYWLSGL+CT Sbjct: 1 METKPSEMSSSKMFGGYNKRYKHFSPTLGCSMTFHIYFPPSPSPSHRFPVLYWLSGLTCT 60 Query: 61 DENFIIKSGAQRVASSEGIALVAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKWKNW 120 DENFI KSGAQRVASSEG+AL+A DTSPRGL++EGEADSWDFGVGAGFYLNAT+EKWKNW Sbjct: 61 DENFITKSGAQRVASSEGVALIALDTSPRGLSIEGEADSWDFGVGAGFYLNATEEKWKNW 120 Query: 121 QMYDYVVKELPKVLSENFAQLDTSRASISGHSMGGHGALTIYLKNLDKYKSVSAFAPIVN 180 +MYDYVVKELP++L++NF+QLDTSRASISGHSMGGHGALTIYLKNLDKYKSVSAFAPIVN Sbjct: 121 RMYDYVVKELPQLLNDNFSQLDTSRASISGHSMGGHGALTIYLKNLDKYKSVSAFAPIVN 180 Query: 181 PMNCPWGQKAFTNYLGGNKADWEEYDATCLISKFNDVSATILIDQGEDDKFLHDQLLPHK 240 P+NCPWGQKAF+NYLGGNK DWEEYDAT LI KFNDVS TILIDQGEDDKFLHDQL+PHK Sbjct: 181 PINCPWGQKAFSNYLGGNKTDWEEYDATSLIKKFNDVSGTILIDQGEDDKFLHDQLMPHK 240 Query: 241 FEEACKNAKVPLLLRLQPGYDHSYYFIATFIDHHIQHHAQALNM 284 FEEAC++AKVPLLLRLQPGYDHSY+FI+TFID HI+HHAQALN+ Sbjct: 241 FEEACQSAKVPLLLRLQPGYDHSYFFISTFIDDHIRHHAQALNL 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20032 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21210 249 2e-68 >Contig21210 Length = 225 Score = 249 bits (636), Expect = 2e-68, Method: Compositional matrix adjust. Identities = 115/150 (76%), Positives = 134/150 (89%) Query: 1 MSYKQGDELLVSSIDDVLLILKSDYENAYFVTGIFTSAIYDEDCIFEDPTIKFRGKDLYS 60 +S K+ DE VS IDDV+ IL+SD+ENAYFVTGIFTSAIY EDC+FEDPTI+F+GKDLYS Sbjct: 73 VSDKESDEFSVSGIDDVVTILQSDFENAYFVTGIFTSAIYTEDCVFEDPTIRFQGKDLYS 132 Query: 61 RNLKLLVPFFDHPSIALQKIEKGSNSETKFVLASWKLRTYLKLPWRPLISIAGSTVYDLN 120 RNLKLLVPFFD PSI L+KIEKG +SE FVLA+WKLRTYLKLPWRPLI I GSTVYDL+ Sbjct: 133 RNLKLLVPFFDSPSIGLEKIEKGIDSEANFVLATWKLRTYLKLPWRPLICIDGSTVYDLD 192 Query: 121 DEFKIVRHAESWNISALQAVGQIFTPSLRR 150 D+FKIVRHAESWN+SA++A+GQ+FTP+ R Sbjct: 193 DKFKIVRHAESWNVSAIEAIGQLFTPTYGR 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12295 (66 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9001 115 2e-28 >Contig9001 Length = 159 Score = 115 bits (287), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 53/65 (81%), Positives = 58/65 (89%) Query: 2 ETGVVEPSLFPMLATWQREHTMEDILTQLKKEMMSPQNRKLAQPPEGNEEARIDQKSIDR 61 +TGVVEPSLFPMLA WQRE+TMEDILTQLKKEMMSPQNRKLAQPPEGNEE R+DQK + Sbjct: 95 DTGVVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNRKLAQPPEGNEEGRVDQKGLVV 154 Query: 62 SXCIL 66 CI+ Sbjct: 155 KCCII 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21042 (231 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6266261 (425 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11952 666 0.0 >Contig11952 Length = 360 Score = 666 bits (1718), Expect = 0.0, Method: Compositional matrix adjust. Identities = 321/362 (88%), Positives = 342/362 (94%), Gaps = 2/362 (0%) Query: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGKSHGSVHELQDQPLVVQNSRWAGLPPEL 60 MSFRSIVRDVRDGFGSLSRRSF+VRLPGHHRGKSHGSVHE+ DQP V+QNSRWA LPPEL Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSHGSVHEVHDQPSVIQNSRWASLPPEL 60 Query: 61 LRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIVKSPEFSGKLTFPISLKQPGPR 120 LRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIV+SPEF GK+TFP++LKQPG R Sbjct: 61 LRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIVRSPEFCGKITFPVALKQPGSR 120 Query: 121 DGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRNRRTTCTEYVISMDADNISR 180 DG IQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKR RRTTCTEYVIS DADNISR Sbjct: 121 DGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRTRRTTCTEYVISTDADNISR 180 Query: 181 SSSTYIGKLRSNFLGTKFIIYDTQPPYNGSQLSPPGRTSRRFYSKKVSPKVPTGSYNIAQ 240 SS+ YIGKLRSNFLGTKFIIYDTQPPYN +QLSPPGR SRRFYSKKVSPK+PTGSYNIAQ Sbjct: 181 SSNKYIGKLRSNFLGTKFIIYDTQPPYNSAQLSPPGR-SRRFYSKKVSPKLPTGSYNIAQ 239 Query: 241 VTYELNVLGTRGPRRMHCTMHSIPASSLEPGGTVPGQAELLPRNLEDSFRSISFSKSIDN 300 V+YELNVLGTRGPRRMHCTMHSIPA+SLEPGG VPGQ E+L R+LEDSFRSISFSKSI + Sbjct: 240 VSYELNVLGTRGPRRMHCTMHSIPAASLEPGGIVPGQPEILQRSLEDSFRSISFSKSIVD 299 Query: 301 STEFSSSRFSDIIGPRDEEDEGKDRPLVLRNKPPRWHEQLQCWCLNFRGRVTVASVKNFQ 360 S+EFSS+RFSDI+G EED G++RPL+LRNK PRWHEQLQCWCLNFRGRVTVASVKNFQ Sbjct: 300 SSEFSSARFSDIVGAHCEED-GRERPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQ 358 Query: 361 LI 362 LI Sbjct: 359 LI 360 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47042 (270 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9212 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43299 (163 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57609 (568 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19151 (133 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53716 (254 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28883 (185 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12672 146 2e-37 >Contig12672 Length = 318 Score = 146 bits (369), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 81/186 (43%), Positives = 114/186 (61%), Gaps = 4/186 (2%) Query: 1 MSGEGKVVCVSGASGYIASWLVKLLLEQGYYVRATVRNPNDTKKTGHLLALDGAKERLHL 60 M+ E CV+GA G++ASW+VKLLL + + T+R+P++ K HL LD A E L L Sbjct: 1 MAVEKGRYCVTGAGGFLASWVVKLLLSKDSIIHGTLRDPSNDKH-AHLKKLDKASENLKL 59 Query: 61 FKADLLEEGSFDSVVDGCDGVFHTASPAALE-VTDPQADLIDPALKGTMNVLRSCAKIPS 119 FKADLL+ S + + GCDGVFH ASP + V +P+ +LI+PA+KGT+NVL++C + Sbjct: 60 FKADLLDYESLHTAIQGCDGVFHVASPVPYDPVPNPEVELIEPAVKGTLNVLKACLE-AK 118 Query: 120 VKRXXXXXXXXXXXXNGKPLTPDVLVDESWFSDPVFFQETKQWYMLSKTLAEEASWKFAK 179 VKR N K VL + W SD + + TK WY LSKT AE + ++A+ Sbjct: 119 VKRVVFVSSAASLVMNPKWSQGQVLNETCW-SDKEYCRSTKNWYCLSKTEAEYEALEYAR 177 Query: 180 ENGMDM 185 NG+D+ Sbjct: 178 INGLDL 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55264 (178 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8059 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37676 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14923 (117 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29537 (132 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17700 (423 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8462 (305 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 71925660 79 1e-16 >71925660 Length = 214 Score = 78.6 bits (192), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 30/59 (50%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Query: 161 LEDGYRWRKYGQKAVKNSPFPRSYYRCTNS-KCTVKKRVERSSEDPSIVITTYEGQHCH 218 ++DGY+WRKYGQK +++P PR+YY+C+ + C VKK+V++S+E+P +++ TYEG+H H Sbjct: 148 VKDGYQWRKYGQKVTRDNPSPRAYYKCSFAPSCPVKKKVQKSAENPCVLVATYEGEHNH 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35126 (206 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig26935 346 2e-97 >Contig26935 Length = 201 Score = 346 bits (887), Expect = 2e-97, Method: Compositional matrix adjust. Identities = 167/206 (81%), Positives = 186/206 (90%), Gaps = 5/206 (2%) Query: 1 MSASEEEISRLFRIRKTVMQMLKDRGYFVGDFEINMTKHQFVSKFGENMKREDLVINKAK 60 M +EEEI+RL+R+RKTVMQMLKDR Y VGDFEINM+K QF K+GENMKREDL+INK K Sbjct: 1 MVLTEEEITRLYRVRKTVMQMLKDRNYLVGDFEINMSKEQFKDKYGENMKREDLIINKTK 60 Query: 61 RTDSSDQIYVFFPEEQKVGVKTMKTYTNRMKSENVFRAILVVQQNLTPFARTCINEISTK 120 RTD++DQIYVFFP+E KVGVKTMKTYTNRMKSENVFRAILV QQ+LTPFA+TCI+EIS K Sbjct: 61 RTDTNDQIYVFFPDEPKVGVKTMKTYTNRMKSENVFRAILVTQQSLTPFAKTCISEISGK 120 Query: 121 FHLEVFQEAELLVNIKEHVLVPEHQVLTSEEKKTLLERYTVKETQLPRIQVSDPIAGYFG 180 FHLEVF EAELLVNIKEHVLVPEH+VLT+EEKKTLLERYTVKETQL + PIA Y+G Sbjct: 121 FHLEVFLEAELLVNIKEHVLVPEHRVLTNEEKKTLLERYTVKETQL-----TQPIAKYYG 175 Query: 181 LKRGQVVKIIRPSETAGRYITYRYVV 206 LKR QVVKIIRPSETAGRY+TYRYV+ Sbjct: 176 LKRAQVVKIIRPSETAGRYVTYRYVI 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48987 (184 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15880 (157 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26272 (357 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig22441 445 e-127 >Contig22441 Length = 367 Score = 445 bits (1144), Expect = e-127, Method: Compositional matrix adjust. Identities = 228/367 (62%), Positives = 270/367 (73%), Gaps = 10/367 (2%) Query: 1 MDGNKDEALKCLKIGKDALEAGDRARALKFVTKARRLDPNLPVDDLLSAIERETG-QSET 59 MDGNKD+ALKC +IGKDALEAGDR+RA+KF+TKARRLDP LP+DDLLS+I+ + QS + Sbjct: 1 MDGNKDDALKCFRIGKDALEAGDRSRAVKFLTKARRLDPALPIDDLLSSIDGNSNPQSGS 60 Query: 60 PAGGANDEAS-----KASDHPSVRHRVPXXXXXXXXXXXXVAYTEEQISIVRQVKKKKDY 114 A G+ + S K D PS+R R +Y+EEQI++VRQ+KKKKDY Sbjct: 61 DADGSANGPSGLGSAKPFDQPSLRQRATATGSSSSKPSAGASYSEEQIAMVRQLKKKKDY 120 Query: 115 YEVLGLEKSCTVEDIRKAYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNEESRKKYD 174 YE+LG+E+SCTVED+RKAYRKLSLKVHPDKNKAPGAEEAFK+VSKAFQCLSN+ESRKKYD Sbjct: 121 YEILGVERSCTVEDVRKAYRKLSLKVHPDKNKAPGAEEAFKSVSKAFQCLSNQESRKKYD 180 Query: 175 LVGSDEPVYERHPATRRA---NGFNGFYDGDVDAEEIFRNFFFGGMPQATTQFRGFAFG- 230 ++GSDEPVYER A NGFNGFYD DVDAEEIFRNFFFGG TQFRGF+FG Sbjct: 181 VMGSDEPVYERRATNHGAHGFNGFNGFYDADVDAEEIFRNFFFGGGMAPATQFRGFSFGH 240 Query: 231 PGMGTRTGNNDSGGFNIRAXXXXXXXXXXXXXXXXPSSEPMYAFARSYPYEYRFVTQKGV 290 GMG R G++ SGG +IR PSSEP+YA +RSYPYEYR T+KGV Sbjct: 241 NGMGQRGGDHGSGGSHIRTLIQLLPVLLILLLNFMPSSEPIYALSRSYPYEYRITTEKGV 300 Query: 291 NYYVKSTKFEQDYPSNSHXXXXXXXXXXXXYFALLSQNCRHELQRLQWGFIRETPHCDML 350 N+YVKSTKFEQ++P + +F +LSQNCR E+QR QWGFIRETPHCDML Sbjct: 301 NFYVKSTKFEQEFPPGTSERVNLEHRVEREFFNILSQNCRLEMQRRQWGFIRETPHCDML 360 Query: 351 KQFEAVA 357 ++FE A Sbjct: 361 QKFETAA 367 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49124 (218 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13327 (259 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30148 89 7e-20 >Contig30148 Length = 305 Score = 89.0 bits (219), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 59/212 (27%), Positives = 101/212 (47%), Gaps = 9/212 (4%) Query: 46 ECTSWRFGVEANNLGPWKTIPVACAEYVKDYMTGRAYEIDLGRVANEAAIYARSVELSAD 105 C + +E N + + P C Y+ Y DL + Y S+ + D Sbjct: 88 HCQIFSLHMELNAVEADR-FPSMCRVVALQYIKEGQYARDLNSTVSMIQNYFSSITPTHD 146 Query: 106 GNDVWVFDVDETLLSNLPYYAEHGYGLEVFDEMEFAKWVEKATAPAIGSSLKLYEVVQSL 165 G DV + D+D+ L SN L +D+ + +VE+A L+LY + + Sbjct: 147 GLDVVLIDIDDILSSNRR--------LHRYDQYGGSDFVEEAKHLKQMFILRLYMELHAG 198 Query: 166 GFKTFLLTGRSENQRSVTVENLINAGFQNWDKLILRGSNDHGKQATVYKSEKRSEMVKEG 225 G+ LL+ + E +R+ ++E+LI+AG++ W LI+R ++ ++ Y S++R M KEG Sbjct: 199 GWPLILLSRKPEAERNSSIEDLISAGYRAWSSLIMRSEDELHMESHDYFSKRRDAMQKEG 258 Query: 226 YRIVGNSGDQWSDLLGSEMSLRSFKLPNPMYY 257 +R + + L R FKLPNP++Y Sbjct: 259 FRAIASVSSHMDALRSPFSGERIFKLPNPIFY 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46771 (291 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21182 80 3e-17 >Contig21182 Length = 183 Score = 80.5 bits (197), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 60/196 (30%), Positives = 85/196 (43%), Gaps = 30/196 (15%) Query: 86 MASPRSYVDSFLDVK---EGRYNPKMSPVIPKAKWRKGSQWISLVRSHAEVIVDDQVIFS 142 M + SYVD F D GRY+ M P I K +RKG+QW S+ R HA +++ D + +S Sbjct: 1 MNTNISYVDCFEDPGPHGNGRYSEHMLPEIEKKDFRKGAQWFSMKRQHAVIVMADSLYYS 60 Query: 143 VFKKFCKRRPPIDARKGKQNIKLQKQHNCIPDEHYVQXXXXXXXXXXXXXXXXXXXXXWN 202 F+ +CK P D R NCI DEHY+ W+ Sbjct: 61 KFRDYCK--PGFDGR------------NCIADEHYLP--------TFFNIIDPGGIANWS 98 Query: 203 LSVTKMEREGWHPITFSYANAGPQRIKEIKDVN---HVYYETEFRTE-W-CRANSTSVPC 257 ++ WHP + + + +K I V+ HV + + + W C N PC Sbjct: 99 VTHVDWSERKWHPKLYKSQDITYELLKNITSVDVSVHVTSDAKKVVQRWPCLWNGIQRPC 158 Query: 258 FLFARKFSRGAAMRLL 273 +LFARKF LL Sbjct: 159 YLFARKFHPETLNDLL 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17532 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv15181 (239 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15251 72 1e-14 >Contig15251 Length = 195 Score = 71.6 bits (174), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 29/58 (50%), Positives = 43/58 (74%) Query: 129 ESLPPPVQESNILFVDGLPKDCTRREVGHLFRPFIGFKEIRVVHKEPRHSGDKAMVLC 186 E++P P+ S+ L+V+GLP D TRREV H+FRPF+G+K +R+V KE +H G ++ C Sbjct: 138 ETVPLPLDASSTLYVEGLPPDSTRREVAHIFRPFVGYKAVRLVSKESKHRGGDPLIPC 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43278 (281 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52403 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226787194 182 6e-48 >226787194 Length = 144 Score = 182 bits (461), Expect = 6e-48, Method: Compositional matrix adjust. Identities = 88/134 (65%), Positives = 106/134 (79%) Query: 79 TSSVEGVVTLSQEDDGPTTVSVRITGLTPGNHGFHLHEFGDTTNGCMSTGAHFNPNGMTH 138 + V+G + QE DGPTTV+ I+GL PG HGFH+H FGDTTNGC+STG HFNPNG H Sbjct: 11 SEGVKGTINFVQEGDGPTTVTGCISGLKPGLHGFHVHAFGDTTNGCLSTGPHFNPNGKEH 70 Query: 139 GAPEDDVRHAGDLGNIVANAEGVAEATIVDTQIPLSGPNAVIGRALVVHELEDDLGKGGH 198 GAPED+ RHAGDLGN+ +G A T++D QIPL+GP++VIGRA+VVH DDLGKGGH Sbjct: 71 GAPEDEDRHAGDLGNVTVGDDGTATFTLIDKQIPLTGPHSVIGRAVVVHGDPDDLGKGGH 130 Query: 199 ELSLTTGNAGGRLA 212 ELS +TGNAGGR+A Sbjct: 131 ELSKSTGNAGGRVA 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3410 (180 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9746 139 2e-35 >Contig9746 Length = 169 Score = 139 bits (351), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 70/142 (49%), Positives = 98/142 (69%) Query: 5 LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI 64 LT + E KEAF LFD DG G I KEL MR+LG TE ++ MI +VD DG+G I Sbjct: 21 LTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAI 80 Query: 65 DFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDE 124 DF EF ++M K+ + D++EEL +AF++ D D+NG ISAA+++ + +LGE TD E+ E Sbjct: 81 DFDEFAHMMTAKIGERDTKEELMKAFQLIDLDRNGKISAADIKSIAKDLGENFTDSEIQE 140 Query: 125 MIREADVDGDGQINYEEFVKVM 146 MI EAD D DG++N +EF+++M Sbjct: 141 MIEEADRDRDGEVNADEFIRMM 162 Score = 61.2 bits (147), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 30/66 (45%), Positives = 45/66 (68%) Query: 84 EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 143 +E+KEAF +FD D +G I A EL M LG ++T+E++ +MI + D DG G I+++EF Sbjct: 27 QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAIDFDEFA 86 Query: 144 KVMMAK 149 +M AK Sbjct: 87 HMMTAK 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32048 (66 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv10640 (282 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33277 (254 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6539 263 2e-72 >Contig6539 Length = 173 Score = 263 bits (673), Expect = 2e-72, Method: Compositional matrix adjust. Identities = 130/162 (80%), Positives = 148/162 (91%) Query: 86 MMKSKSNSKVKEAAVRILISLFPPFLLDLYRMLVAPIGGGKVAAMMVARVTALSCQWLMG 145 M+KS +NS KEAAVRIL SLFPP LLDLY++LVAP+ GGKVAA+MVARVTA++CQWLMG Sbjct: 1 MLKSPTNSHAKEAAVRILRSLFPPLLLDLYKLLVAPLQGGKVAAIMVARVTAITCQWLMG 60 Query: 146 PCTVNSVNLPDGSSCSSGVFVERCKYLEESKCVGICINTCKLPTQTFFKDYMGVPLAMEP 205 PCTVNSV+LPDG+S +SGVFVE+CKYLEESKCVGIC+NTCKLPTQ F KDYMGVPL MEP Sbjct: 61 PCTVNSVDLPDGTSWNSGVFVEKCKYLEESKCVGICLNTCKLPTQAFIKDYMGVPLVMEP 120 Query: 206 DFTNYSCQFSFGVLPPRPEEDSTLKEPCLEICPNATRRKEIT 247 +F +YSCQF FGVLPP PE+D+TLKEPCLEICPNATRR+EI Sbjct: 121 NFVDYSCQFKFGVLPPLPEDDATLKEPCLEICPNATRRREIA 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56385 (181 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16690 311 4e-87 >Contig16690 Length = 243 Score = 311 bits (798), Expect = 4e-87, Method: Compositional matrix adjust. Identities = 141/181 (77%), Positives = 161/181 (88%) Query: 1 KDLYKFRYIRLIVAESLRLYPQPPLLIRRSLKSDSLPGGYKGKKDGHSIPAGTDIFLSVY 60 + + K Y RLI ESLRL+PQPPLLIRRSLK D LPGGY G KDG+++PAGTD+F+SVY Sbjct: 63 ESIKKLEYTRLIAVESLRLFPQPPLLIRRSLKPDKLPGGYNGAKDGYAVPAGTDLFISVY 122 Query: 61 NLHRSPYFWDRPHEFEPERFLVPRNSDIEGWSGFDPSRSPGALYPNEIVADFAFLPFGGG 120 NLHRSPYFWD P+EFEPERFLV + S +EGW+GFDPSRSPGALYPNEI+ADFAFLPFGGG Sbjct: 123 NLHRSPYFWDNPNEFEPERFLVEKKSHVEGWAGFDPSRSPGALYPNEIIADFAFLPFGGG 182 Query: 121 PRKCVGDQFALMESTIALTMLLQKFDVELKGGPESVELVTGATIHTKNGLWCRMMKRSDL 180 PRKCVGDQFALMEST+AL MLLQKF VELKG P+SVE VTGAT+HTKNGLWC++ KRSD+ Sbjct: 183 PRKCVGDQFALMESTVALAMLLQKFTVELKGSPDSVEQVTGATLHTKNGLWCKLQKRSDI 242 Query: 181 H 181 + Sbjct: 243 N 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25666263 (139 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16336 (400 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5939 408 e-116 >Contig5939 Length = 292 Score = 408 bits (1048), Expect = e-116, Method: Compositional matrix adjust. Identities = 207/279 (74%), Positives = 229/279 (82%), Gaps = 8/279 (2%) Query: 108 MTSVRGRRRDMEDAVSIHPSFWGQDAQNCTGLHYYGVYDGHGCSHVAMKCKDRMHEIAKE 167 MTSV GRRRDMEDAVSIHPSF ++ G H+YGV+DGHGCSHVA+KCKDR++EI K+ Sbjct: 1 MTSVCGRRRDMEDAVSIHPSFLQKENPESNGTHFYGVFDGHGCSHVALKCKDRLYEIVKQ 60 Query: 168 EIERCGQS--WEQVMERSFSRMDKEVVEWCNGQWSSNCRCELRTPQCDAVGSTAVVAIVT 225 E+E G+S W+ MERSF +MD+EV E SSNCRCEL+TPQCDAVGSTAVVA+VT Sbjct: 61 ELETEGESVQWKDAMERSFLKMDEEVQEGNLKAQSSNCRCELQTPQCDAVGSTAVVAVVT 120 Query: 226 PEKVVVSNCGDSRAVLCRNGVAIPLSSDHKPDRPDELLRIQAAGGRVIYWDVPRVLGVLA 285 PEK+VVSNCGDSRAVLCR+G A+PLSSDHKPDRPDEL+RI+AAGGRVIYWD RVLGVLA Sbjct: 121 PEKIVVSNCGDSRAVLCRSGAAVPLSSDHKPDRPDELVRIEAAGGRVIYWDGARVLGVLA 180 Query: 286 MSRAIGDNYLKPYVISEPEVTTWDRSPEDECLILASDGLWDVVSNDTACGVARMCLNAQA 345 MSRAIGDNYLKPYVISEPEVT DR+ EDECLILASDGLWDVVSNDTACGV RMCL AQ Sbjct: 181 MSRAIGDNYLKPYVISEPEVTVTDRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQT 240 Query: 346 PPSPPVSPETGAGIGAGGESSDKACLDASMLLTKLALAR 384 S E A SSDKAC DAS+LLTKLALAR Sbjct: 241 AAS---QSELCCDAAA---SSDKACSDASILLTKLALAR 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv46390 (287 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv54022 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14573 (207 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12750 113 2e-27 >Contig12750 Length = 248 Score = 113 bits (283), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 64/186 (34%), Positives = 98/186 (52%) Query: 12 VHQALGGGSVADFLLWRRWCGAAVCLVSASSLWFLFERAGYXXXXXXXXXXXXXXXXXXX 71 VH LGGG AD LLWR +A L +A+ +W LFE Y Sbjct: 53 VHHILGGGKSADVLLWRNKKISASVLTAATIVWVLFEWLNYHFLTLVGFALILGMLAQFL 112 Query: 72 WAKSASILNRPLPPLPDMEISEESVVKAADVIRVWINYALSVARDIAVGRNVKLFLQVAF 131 W+ + ++NR +P + + ++ V A I IN L+ +D+A NVK F+ V Sbjct: 113 WSNFSGMINRSPSKVPRLVLPKDLFVNIAISIGAEINRGLAFVQDVACEGNVKQFIVVVV 172 Query: 132 GLWVVSYIGSLFNFLTLVYIGVVLSLSVPVLYDKYQDHIDDKLRVTHRVVQTQYKKIDDK 191 L + + IGS NFLT++YIG V + ++PVLY++Y+D +D+ + +Q Y+K+D Sbjct: 173 SLLIAAMIGSWCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFVYQVLGQLQHNYRKLDTG 232 Query: 192 ILRKIP 197 +L KIP Sbjct: 233 VLSKIP 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv26683 (361 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6728 650 0.0 >Contig6728 Length = 361 Score = 650 bits (1677), Expect = 0.0, Method: Compositional matrix adjust. Identities = 317/360 (88%), Positives = 332/360 (92%) Query: 1 MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVSEVVLAINYQPEVM 60 MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV+EVVLAINYQPEVM Sbjct: 1 MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM 60 Query: 61 LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE 120 + FLKEFE K+GI ITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE Sbjct: 61 MTFLKEFEEKVGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE 120 Query: 121 MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESIGRVDRFVEKPKLFVGNKINAGIYLLN 180 MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEES G+V +FVEKPKLFVGNKINAGIYLLN Sbjct: 121 MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVQKFVEKPKLFVGNKINAGIYLLN 180 Query: 181 PSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGFWMDIGQPRDYITGXXXXXXXXXXX 240 PSVLD+IELRPTSIEKEVFPKIAAE KL+AMVLPGFWMDIGQPRDYITG Sbjct: 181 PSVLDKIELRPTSIEKEVFPKIAAENKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKN 240 Query: 241 XXXXXXXGAHIVGNVLVDESAKIGEGCLIGPDVAIGPGCVVEAGVRLSRCTVMRGVRIKK 300 GAHIVGNVLVDE+AKIGEGCLIGPDVAIGPGC++E+GVRLSRCTVMRGVRIK Sbjct: 241 SSSKLARGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIIESGVRLSRCTVMRGVRIKN 300 Query: 301 HACISSSIIGWHSTVGQWARVENMTILGKDVHVCDEIYSNGSVVLPHKKIKSSILKPEIV 360 HACISSSIIGWHSTVGQWARVENMTILG+DVHV DEIYSNG VVLPHK+IKSSILKPEIV Sbjct: 301 HACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILKPEIV 360 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv966263 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47838 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig16052 89 4e-20 >Contig16052 Length = 168 Score = 89.4 bits (220), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 89/164 (54%), Positives = 109/164 (66%), Gaps = 14/164 (8%) Query: 4 RKEKTDDQNGSKDKTKRQGSKSGEKAKESDSRKRSAHLDVKEDRKETEKFKRANVKAESI 63 RKE+ DD+NGS+ K K Q KES+SRKRS+H D KE R+ETE+ RA K + Sbjct: 3 RKERADDRNGSQVKVKEQS------VKESESRKRSSHADAKEGRRETERLHRAGAKEDKD 56 Query: 64 QKRERSNDEKEDRSRHKLASESGMHKXXXXXXXXXXXXXXKDNSVVSHTNASSDEASEDS 123 +KRER+ D++ DRSRHK +++S + + + SSDEAS+DS Sbjct: 57 RKRERTKDKEGDRSRHKHSTDS--------SRHKRRRSSSVGSRGRNSKDDSSDEASDDS 108 Query: 124 KRKLHSRKRNLSPSPTRSRIRQVSRSPHSKHSQRRHSPYSSFET 167 KRK HSR+RNLSPSP RSR RQVSRSPHSKHSQRRHSPYSS ET Sbjct: 109 KRKRHSRRRNLSPSPVRSRRRQVSRSPHSKHSQRRHSPYSSLET 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9548 (91 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51475 (202 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1146 (60 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3066260 (247 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv33091 (81 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17978 (673 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6436 356 e-100 >Contig6436 Length = 191 Score = 356 bits (913), Expect = e-100, Method: Compositional matrix adjust. Identities = 166/191 (86%), Positives = 179/191 (93%) Query: 482 MDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHMPLKICYPALENEEWRIIT 541 MDFRFFTLGNLWSI+SSLGT KQNEGILNLIEAKWDD VA MPLKICYPALE EEWRIIT Sbjct: 1 MDFRFFTLGNLWSIVSSLGTQKQNEGILNLIEAKWDDFVAQMPLKICYPALEYEEWRIIT 60 Query: 542 GSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVALAEERLSVDHWPEYYDTR 601 G DPKNTPWSYHNGGSWPTLLWQFTLACIKMGR ELA+KAVALAE+RLS+D+WPEYYDT+ Sbjct: 61 GGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAQKAVALAEKRLSMDNWPEYYDTK 120 Query: 602 NGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDYELLEICVCALSKTGRKKC 661 +GRFIGKQSRL+QTWTIAG+LTSKMLLENP+ ASLL WEEDYELLE CVCAL+KT RKKC Sbjct: 121 SGRFIGKQSRLHQTWTIAGYLTSKMLLENPDKASLLFWEEDYELLETCVCALNKTSRKKC 180 Query: 662 SRSAARSQIPV 672 SR AA+SQ+ V Sbjct: 181 SRFAAKSQVAV 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57824 (84 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36934 (203 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8066264 (279 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17705 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3610 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35614 (126 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv51521 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24500 (92 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16664 (142 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35865 (229 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31250 (88 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39436 (356 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12672 234 2e-63 >Contig12672 Length = 318 Score = 234 bits (596), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 133/329 (40%), Positives = 203/329 (61%), Gaps = 15/329 (4%) Query: 20 MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTL 79 M + CVTGA GF+ SW+V LL + + T+RDP+N K HL L KA +L L Sbjct: 1 MAVEKGRYCVTGAGGFLASWVVKLLLSKDSIIHGTLRDPSNDKHA-HLKKLDKASENLKL 59 Query: 80 WKADLADEGSFDEAIKGCTGVFHVATPMDFES-KDPENEVIKPTIEGMLGIMKSCAAAKT 138 +KADL D S AI+GC GVFHVA+P+ ++ +PE E+I+P ++G L ++K+C AK Sbjct: 60 FKADLLDYESLHTAIQGCDGVFHVASPVPYDPVPNPEVELIEPAVKGTLNVLKACLEAK- 118 Query: 139 VRRLVFTSSAGTV--NIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKY 196 V+R+VF SSA ++ N + Q V +E+CWSD E+CR+ K W Y +SKT AE A +Y Sbjct: 119 VKRVVFVSSAASLVMNPKWSQGQVLNETCWSDKEYCRSTK--NW-YCLSKTEAEYEALEY 175 Query: 197 AKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQ-FVHLDDLCN 255 A+ N +D +T+ PTL++GP + S++ S + + + E + S+ + + V + D+ Sbjct: 176 ARINGLDLVTVCPTLIMGPILQSTVNASTLVLIKLL--KEGYESLENKPRMIVDVRDVAE 233 Query: 256 AHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKK 315 A I ++E P+AEGRYIC++H+ DL + L+ YP Y+ P F V+E + SS+K Sbjct: 234 AVIMVYEKPEAEGRYICTAHNIKTTDLVEELKSIYPNYSYPKNFVEVEEQPR---LSSEK 290 Query: 316 LTDLGFEFKYSLEDMFTGAVDTCRAKGLL 344 L LG F+ L++ TG+V++ + GLL Sbjct: 291 LQRLGLSFR-PLKETLTGSVESYKEAGLL 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21069 (278 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8513 461 e-132 >Contig8513 Length = 286 Score = 461 bits (1185), Expect = e-132, Method: Compositional matrix adjust. Identities = 218/237 (91%), Positives = 227/237 (95%) Query: 1 MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ 60 MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ Sbjct: 1 MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ 60 Query: 61 KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESPLPVGRLVVQLADKAQVCT 120 KKIFKVDDHIGVAIAGLTADGRVLSRYMRSE INY++TYESPLPVGRLVVQLADKAQVCT Sbjct: 61 KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESPLPVGRLVVQLADKAQVCT 120 Query: 121 QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFGTFQ 180 QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF F Sbjct: 121 QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFT 180 Query: 181 NSSREDLIKDALFAIRETLQGEKLKSSICTVTVLGVGEPFHILDQETVQGLINAFEM 237 S+REDLIKDAL A RETLQGEKL+SSICT+ V+GVGEPFHILDQ+TVQ LI+AFE+ Sbjct: 181 GSTREDLIKDALIATRETLQGEKLRSSICTIAVVGVGEPFHILDQDTVQKLIDAFEI 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv345 (201 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39452 (143 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36906 (225 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13954 280 2e-77 >Contig13954 Length = 239 Score = 280 bits (716), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 144/238 (60%), Positives = 172/238 (72%), Gaps = 14/238 (5%) Query: 1 MRKPCCDKQDTNKGAWSKQEDQKLIDYIRKNGEGCWRTLPQAAGLLRCGKSCRLRWINYL 60 MRKPCC+K+ TNKGAWSKQEDQKLIDYI+ +GEGCWR+LP+AAGL RCGKSCRLRWINYL Sbjct: 1 MRKPCCEKEGTNKGAWSKQEDQKLIDYIKTHGEGCWRSLPKAAGLHRCGKSCRLRWINYL 60 Query: 61 RPDLKRGNFAEDEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLRRKLINMGI 120 RPD+KRGNF +DEE+LIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSH+R+KLI MGI Sbjct: 61 RPDIKRGNFEQDEEELIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGI 120 Query: 121 DPNNHRLSHNFPRPR------DPCTAATATSSGLNNHASPPVKSVGD--NDQTSDAGSCL 172 DPNNHRL+ PRP P ++ + S +N P+KS D + + S+A S L Sbjct: 121 DPNNHRLNQIIPRPNPQNDSVSPAATSSGSMSNINACTKTPLKSSDDQIDHRASEAASVL 180 Query: 173 DDNRR--ALPDLNLDVAITIPQPSVDTTEEAKK--HNEPKVSRELEPGPSS--TLLLF 224 +D + DLNLD+ I P+PS+ E K +RE+E TL+LF Sbjct: 181 EDETSGPSSRDLNLDLTIAFPEPSLQVEEGMPKLIKGSNTTAREIETNLQHLPTLVLF 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv39143 (189 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2866 (318 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig30395 422 e-120 >Contig30395 Length = 274 Score = 422 bits (1084), Expect = e-120, Method: Compositional matrix adjust. Identities = 200/278 (71%), Positives = 229/278 (82%), Gaps = 4/278 (1%) Query: 41 ISHEQMDAVEKLTKGHYRKCMEQRFKELVAAKALEGVQTEIKDMDWESTFFLRHLPVSNV 100 +S + +D V+K+TK HY+K MEQRFKE+VAAK L+ VQ+EI D+DWESTFFLRHLP SN+ Sbjct: 1 MSTDLLDTVDKMTKDHYKKTMEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNI 60 Query: 101 SDFPDLDEEYRKVMKDFAXXXXXXXXXXXXXXXXXXXXXXGYLKKAFHGSKGPNFGTKVS 160 S+ PDL+EEYRK MK+FA GYLKK F+GSKGPNFGTKVS Sbjct: 61 SEIPDLEEEYRKTMKEFAVELEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVS 120 Query: 161 NYPPCPKPDLIKGLRAHTDAGGIILLFQDDTVSGLQLLKDGQWVDVPPMRHSIVVNLGDQ 220 NYPPCPKPDLIKGLRAH+DAGGIILLFQDD VSGLQLLKDG+WVDVPPM HSIV+NLGDQ Sbjct: 121 NYPPCPKPDLIKGLRAHSDAGGIILLFQDDKVSGLQLLKDGEWVDVPPMHHSIVINLGDQ 180 Query: 221 LEVITNGKYKSVLHRVVAQTDGNRMSIASFYNPGNDAVIYPAPALLEKEAENDQVYPKFV 280 +EVITNGKYKSV+HRV+AQ+DG RMSIASFYNPGND+ I PAPA+LEK+ E+ YPKFV Sbjct: 181 IEVITNGKYKSVMHRVIAQSDGTRMSIASFYNPGNDSFISPAPAVLEKKTEDAPTYPKFV 240 Query: 281 FDDYMKLYSGLKFQAKEPRFEAMKNVEASVNMGPIATA 318 FDDYMKLYSGLKFQAKEPRFEAMK E++ P+ATA Sbjct: 241 FDDYMKLYSGLKFQAKEPRFEAMKAKEST----PVATA 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21962 (234 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24666258 (140 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4613 (177 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6829 187 1e-49 >Contig6829 Length = 173 Score = 187 bits (474), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 96/126 (76%), Positives = 108/126 (85%) Query: 48 LLQKSIPLAASVAILLWSNPANAGFLSGFSGIESVPGPELPQVDFLNKFNEENQKKYAEF 107 LLQ S+ LAAS AILL SNPA AGFLSG +G +SVPGPELPQ+DFL +FNEENQKKYAE Sbjct: 45 LLQSSVSLAASAAILLCSNPAEAGFLSGSTGKKSVPGPELPQIDFLKRFNEENQKKYAEN 104 Query: 108 DERFKSSPLLKELLERSKLNQEKNRKEIQDKYCIRGAEWGVGDCSVEGMSPADKDNFIAT 167 D RF+S+ LKELLE+SKLN+EKN KEIQDKYCIRGAEWGVGDCS EGM+P +KD FIA Sbjct: 105 DARFRSTQKLKELLEKSKLNKEKNSKEIQDKYCIRGAEWGVGDCSAEGMTPNEKDKFIAM 164 Query: 168 LKQKLG 173 LK+K G Sbjct: 165 LKEKAG 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4074 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig19101 93 2e-21 >Contig19101 Length = 400 Score = 93.2 bits (230), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 51/138 (36%), Positives = 76/138 (55%), Gaps = 3/138 (2%) Query: 1 MSQLLVELDGLHQRVDVTVIAATNRPDKIDPALLRPGRFDRLLYVGPPNESDRADIFHIH 60 + +LL +LDG Q V +I ATNRPD +DPALLRPGR DR + + PNE R +I IH Sbjct: 264 LMELLNQLDGFEQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIH 323 Query: 61 LCKIPFSSDVSIGELAFLTEGYTGADISLICREAAIAAIEDNLDASEITMEHLKTAIRQV 120 I ++ + L EG+ GAD+ +C EA ++AI D + E A+R++ Sbjct: 324 AAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDY--VIHEDFMKAVRKL 381 Query: 121 -QPSELQSYQELSTKFQR 137 + +L+S + F + Sbjct: 382 NEAKKLESSSHYNADFGK 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13570 (277 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8475 (88 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig27018 107 3e-26 >Contig27018 Length = 199 Score = 107 bits (268), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 59/84 (70%), Positives = 67/84 (79%), Gaps = 5/84 (5%) Query: 2 RFHQSGGCSDSPTVA-VHGCTRRSSFCLYTSNHENHHATSSSSMQRSVLNQAYSDEKLGG 60 R HQSG +SP V +HG TRRSSFCL SNHE+HH TS+SS+QRS+LNQAY DEKLG Sbjct: 15 RVHQSG---ESPCVGGIHGSTRRSSFCLSASNHESHH-TSTSSLQRSILNQAYMDEKLGV 70 Query: 61 VAREAKERLDERLRTQRKSEPTRN 84 AREAK RLDERLRTQRK +P R+ Sbjct: 71 EAREAKGRLDERLRTQRKPQPKRH 94 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv4344 (218 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48246 (109 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6654 (311 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig13481 523 e-150 >Contig13481 Length = 300 Score = 523 bits (1347), Expect = e-150, Method: Compositional matrix adjust. Identities = 248/294 (84%), Positives = 263/294 (89%) Query: 16 EGNRVVVVSALQFACTDDVPTNLNTAERLVRDAHRKGANIILIQELFEGYYFCQAQREDF 75 +G R VVVSALQFACTDDV TN+ TAERLVR AH KGANIILIQELFEG+YFCQAQREDF Sbjct: 3 KGKREVVVSALQFACTDDVATNVATAERLVRAAHAKGANIILIQELFEGHYFCQAQREDF 62 Query: 76 FQRAKPYKGHPTILRMQKLAKELGVVIPVSFFEEANNAHYNSIAIVDADGTDLGIYRKSH 135 FQRAKPYK HPTILRMQ LAKELGVVIPVSFFEEANNAHYNS+AI+DADG DLG+YRKSH Sbjct: 63 FQRAKPYKDHPTILRMQILAKELGVVIPVSFFEEANNAHYNSVAIIDADGADLGLYRKSH 122 Query: 136 IPDGPGYQEKFYFNPGDTGFKVFETKFAKIGVAICWDQWFPEAARAMVLQGAEILLYPTA 195 IPDGPGYQEKFYFNPGDTGFKVF+TKFA IGVAICWDQWFPEAAR +VLQGAEIL YPTA Sbjct: 123 IPDGPGYQEKFYFNPGDTGFKVFKTKFATIGVAICWDQWFPEAARCLVLQGAEILFYPTA 182 Query: 196 IGSEPQDTGLDSRDHWKRVMQGHAGANLVPLVASNRIGKEIIQTEHGNTEITFYGNSFIA 255 IGSEPQD GLDSRDHW+RVMQGHAGAN+VP+V SNRIGKEII+TEHG +EITFYGNSFIA Sbjct: 183 IGSEPQDGGLDSRDHWRRVMQGHAGANVVPVVTSNRIGKEIIETEHGKSEITFYGNSFIA 242 Query: 256 GPTGEIXXXXXXXXXXXXXXQFDLDKIKSKRYSWGIFRDRRPDLYKVLLTLDGS 309 GPTGEI QFDLDKIK KR+SWG+FRDRRPDLYKVLLT DGS Sbjct: 243 GPTGEIVATANDKEEAVLVAQFDLDKIKWKRHSWGVFRDRRPDLYKVLLTSDGS 296 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52540 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10364 408 e-116 >Contig10364 Length = 221 Score = 408 bits (1048), Expect = e-116, Method: Compositional matrix adjust. Identities = 192/194 (98%), Positives = 192/194 (98%) Query: 1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG 60 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG 60 Query: 61 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI 120 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI Sbjct: 61 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI 120 Query: 121 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDVNLHFV 180 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV Sbjct: 121 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV 180 Query: 181 ESPALAPPEVQIDM 194 ESPALAPPEVQ DM Sbjct: 181 ESPALAPPEVQFDM 194 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv13242 (216 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6580 283 2e-78 >Contig6580 Length = 269 Score = 283 bits (723), Expect = 2e-78, Method: Compositional matrix adjust. Identities = 140/185 (75%), Positives = 147/185 (79%), Gaps = 10/185 (5%) Query: 1 MESTDXXXXXXXXXXXXXFRFYPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWEL 60 MEST+ FRF+PTDEELVVHYLKKKA+S PLPV IIAEVDLYKFDPWEL Sbjct: 1 MESTNSSSGSQHPQLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWEL 60 Query: 61 PAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKAL 120 P+KA+FGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVL+S G KVGVKKAL Sbjct: 61 PSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKAL 120 Query: 121 VFYGGKPPKGIKTNWIMHEYRLADNKV--------NTKPPGCDMGNKKNSLRLDDWVLCR 172 VFYGGKPPKG KTNWIMHEYRL +N TKP D NKK SLRLDDWVLCR Sbjct: 121 VFYGGKPPKGTKTNWIMHEYRLVNNTTTTINMSSSTTKP--SDAANKKPSLRLDDWVLCR 178 Query: 173 IYXKN 177 IY KN Sbjct: 179 IYKKN 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv53586 (298 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16598 (128 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv60416 (266 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv28799 (443 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig12395 347 3e-97 >Contig12395 Length = 323 Score = 347 bits (889), Expect = 3e-97, Method: Compositional matrix adjust. Identities = 157/191 (82%), Positives = 174/191 (91%) Query: 92 MLADQLINRVEYMHSRGFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDLQTHKHIP 151 MLADQ+I R+E+ HS+GFLHRDIKPDNFLMGLGR+ANQVY IDFGLAK+YRD T++HIP Sbjct: 1 MLADQMITRIEFAHSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDATTNRHIP 60 Query: 152 YRENKNLTGTARYASVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYD 211 YRENKNLTGTARYAS NTHLG+EQSRRDDLESLGYVL+YFLRGSLPWQGLKA TKKQKYD Sbjct: 61 YRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKADTKKQKYD 120 Query: 212 KISEKKMLTPIEVLCKSYPSEFTSYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDY 271 KI EKK+ TPIEVLCKS+P EF SYFHYC SL F+ +PDY +LKRLFRDLF REGY+FDY Sbjct: 121 KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLFSREGYEFDY 180 Query: 272 VFDWTILKYPQ 282 VFDWTI+KY Q Sbjct: 181 VFDWTIIKYQQ 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv22451 (72 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61348 (70 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43883 (313 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5881 (299 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19291 (79 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25162 (112 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226764647 81 5e-18 >226764647 Length = 176 Score = 80.9 bits (198), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 34/42 (80%), Positives = 40/42 (95%) Query: 2 QCGSEMVASLWITEISSPFLHLRELLKELGYRDTDLNLTVDM 43 +CGSEMVA+LWITE+SSPFLH+RELLKELGYRD+DLNL D+ Sbjct: 120 KCGSEMVAALWITELSSPFLHIRELLKELGYRDSDLNLAADL 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27770 (96 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25266258 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30774 (167 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv38247 (359 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10738 500 e-143 >Contig10738 Length = 362 Score = 500 bits (1287), Expect = e-143, Method: Compositional matrix adjust. Identities = 227/358 (63%), Positives = 286/358 (79%) Query: 1 MVKSPEEEHPQKAFGWAARDPSGTLSPFHFSRRENGDEDVTVKILYCGVCHSDLHSVKNE 60 M K+PE+EHP KAFGWAARD SG LSPF+FSRR GDEDV K+LYCG+CH+DLH++KNE Sbjct: 1 MAKAPEQEHPVKAFGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNE 60 Query: 61 WGFTRYPIVPGHEIVGIVIQLGNNVKKFKMGDRVGVGVLVGSCKTCETCQQDLENYCPSM 120 WG + YP+VPGHEIVG V ++G+ V K K GD+VGVG +VG+C CE+C +LENYCP M Sbjct: 61 WGISLYPMVPGHEIVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKM 120 Query: 121 IFTYNSTSQDGTRTYGGYSDIVVVDQRYVLRIPDNMPLDAGAPLLCAGITVYSPMKYYGM 180 I TY S D T TYGGYSD +V ++RY++R P+N+PLDAGAPLLCAGITVYSP+KY+G+ Sbjct: 121 ILTYGSIYADRTVTYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGL 180 Query: 181 TEPXXXXXXXXXXXXXXXXXXXXXAFGLKVTVISTSPNKEDEAINKLGADCFLVSTNPEK 240 EP AFG KVTVISTSP+K+DEA+ +LGAD F+VS +P++ Sbjct: 181 AEPGKHVGIVGLGGLGHVGVKFAKAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQQ 240 Query: 241 VQAALGTMDYIIDTVSAIHSLGPLLAMLKLNGKLITVGLPDKPLELPIFPLVMGRKLIGG 300 +QAA+GT+D IIDTVSA H + PLL +LK +GKLI VG+P+KPL+L +FPL+MGRK + G Sbjct: 241 MQAAIGTLDGIIDTVSAAHPIVPLLGLLKPHGKLILVGVPEKPLDLHVFPLIMGRKSVAG 300 Query: 301 SDIGGIKETQEMLDFCAKHNITADIELIQMDYINTAMKRLSKSDVKYRFVIDVANSLS 358 S IGG+KETQEM+DF AKHNITAD+E+I MDY+NTAM+RL+K+DV+YRFVIDV N+L+ Sbjct: 301 SGIGGMKETQEMIDFAAKHNITADVEVISMDYVNTAMERLAKNDVRYRFVIDVGNTLA 358 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49187 (214 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61685 (73 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19425 (280 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27366265 (198 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27702 (449 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226742903 283 4e-78 >226742903 Length = 195 Score = 283 bits (724), Expect = 4e-78, Method: Compositional matrix adjust. Identities = 138/174 (79%), Positives = 143/174 (82%) Query: 113 EIVDLCLDRVRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTIY 172 EIVDLCLDR+RKLA NCTGLQGFLVFNAV VDYGKKSKLGFT+Y Sbjct: 19 EIVDLCLDRIRKLAYNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY 78 Query: 173 PSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRXXX 232 PSPQVST+VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNR Sbjct: 79 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 138 Query: 233 XXXXXXXXXXRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 286 RFDGA+NVD+TEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL Sbjct: 139 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv57944 (398 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv31386 (341 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8066257 (262 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21497 338 5e-95 >Contig21497 Length = 261 Score = 338 bits (867), Expect = 5e-95, Method: Compositional matrix adjust. Identities = 169/254 (66%), Positives = 197/254 (77%), Gaps = 4/254 (1%) Query: 8 REENVYMAKLAEQAERYEEMVEFMXXXXXXXXXXXXXXXXRNLLSVAYKNVIGARRASWR 67 RE VY AKLAEQAERY+EMVE M RNLLSV YKNVIGARRASWR Sbjct: 7 RENYVYTAKLAEQAERYDEMVEAMTKVAKLDVELTVEE--RNLLSVGYKNVIGARRASWR 64 Query: 68 IISSIEQKEESRGNEDHVAIIKDYRATIEAELSKICDGILSLLESHLIPSAVIAESKVFY 127 I+SSIEQKEE +GN+ +V+ IK+YR +E+ELS IC I+ +++ HLIPS ES VF+ Sbjct: 65 ILSSIEQKEEGKGNDQNVSRIKEYRQKVESELSSICSDIMRVIDEHLIPSCTAFESTVFF 124 Query: 128 LKMKGDYHRYLAEFKTGPGRKEAAESTLLAYKSAQDIALAELAPTHPIRLGLALNFSVFY 187 KMKGDY+RYLAEFKTG RKE A+ ++ AY++A A +L PTHPIRLGLALNFSVFY Sbjct: 125 YKMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFY 184 Query: 188 YEILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGD 247 YEILNSP+RAC+LAKQAFDEAISELDTL EESYKDSTLIMQLLRDNLTLWTSDI +D G+ Sbjct: 185 YEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGGE 244 Query: 248 DIK--EASKRESGE 259 DI+ + S + GE Sbjct: 245 DIQKVDGSAKPGGE 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24047 (193 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14066262 (475 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25664 902 0.0 >Contig25664 Length = 718 Score = 902 bits (2332), Expect = 0.0, Method: Compositional matrix adjust. Identities = 447/475 (94%), Positives = 457/475 (96%) Query: 1 MDFGRSKSKFQEVPETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLV 60 MDFGRSKSKFQEVPETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLV Sbjct: 244 MDFGRSKSKFQEVPETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLV 303 Query: 61 GPPGTGKTLLARAVAGEAGVPFFSCAASEFVELFVGVRASRVRDLFEKAKSKAPCIVFID 120 GPPGTGKTLLARAVAGEAG PFFSCAASEFVELFVGV ASRVRDLFEKAKSKAPCIVFID Sbjct: 304 GPPGTGKTLLARAVAGEAGTPFFSCAASEFVELFVGVGASRVRDLFEKAKSKAPCIVFID 363 Query: 121 EIDAVXXXXXXXXXXXNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPG 180 EIDAV NDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPG Sbjct: 364 EIDAVGRQRGAGMGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPG 423 Query: 181 RFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVDFEKIARRTPGFTGADLQNLMNEAAIL 240 RFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVDF+KIARRTPGFTGADLQNLMNEAAIL Sbjct: 424 RFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVDFDKIARRTPGFTGADLQNLMNEAAIL 483 Query: 241 AARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPV 300 AARRDLKEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPV Sbjct: 484 AARRDLKEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPV 543 Query: 301 AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTG 360 AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTG Sbjct: 544 AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTG 603 Query: 361 ASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAE 420 AS+DFMQVSRVARQMVERFGFSKKIGQVAIG GGNPFLGQQMSSQKDYSMATAD+VDAE Sbjct: 604 ASSDFMQVSRVARQMVERFGFSKKIGQVAIGASGGNPFLGQQMSSQKDYSMATADVVDAE 663 Query: 421 VRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA 475 VRELVE AYSRAK I+TTHIDILH LAQLL+EKETVDGEEFMSLFIDGKAEL+VA Sbjct: 664 VRELVETAYSRAKDIVTTHIDILHTLAQLLMEKETVDGEEFMSLFIDGKAELYVA 718 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv12480 (236 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2709 (221 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10364 419 e-119 >Contig10364 Length = 221 Score = 419 bits (1077), Expect = e-119, Method: Compositional matrix adjust. Identities = 201/221 (90%), Positives = 203/221 (91%) Query: 1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG 60 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG 60 Query: 61 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI 120 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI Sbjct: 61 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI 120 Query: 121 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV 180 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFV Sbjct: 121 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV 180 Query: 181 ESPALAPPEVHIDXXXXXXXXXXXXXXXSQPLPDDDDDAFE 221 ESPALAPPEV D +QPLPDDDD+AFE Sbjct: 181 ESPALAPPEVQFDMAAQQQHEAELAAAAAQPLPDDDDEAFE 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2810 (235 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28069 350 1e-98 >Contig28069 Length = 447 Score = 350 bits (897), Expect = 1e-98, Method: Compositional matrix adjust. Identities = 170/235 (72%), Positives = 197/235 (83%), Gaps = 4/235 (1%) Query: 1 MAVEAGNPYFRLGYNSLGAFATINHLHFQAYYLATPFPIEKAPTRKITTAGNGVKIFELL 60 MA EAG+PYFRLGYNSLGAFATINHLHFQAYYLA FPIEKAPT+KI+T VK+ ELL Sbjct: 217 MAAEAGSPYFRLGYNSLGAFATINHLHFQAYYLAVTFPIEKAPTKKISTLNAEVKVSELL 276 Query: 61 KYPVRGLVFEGGDTLQDLANTVADSCICLQDNNIPFNVLIADAGKRIFLFAQCYAEKQAL 120 YPVRGLVFEGG+TL+DL+ TV+D+CICLQ+NN+P+NVLI+D GKRIFL QCYAEKQAL Sbjct: 277 NYPVRGLVFEGGNTLEDLSYTVSDACICLQENNVPYNVLISDCGKRIFLLPQCYAEKQAL 336 Query: 121 GEVNQELLDTQVNPAVWEVSGHIVLKRKEDYEGASEQNAWRLLAEVSLSEERFQEVNALI 180 GEV+ E+LDTQVNPAVWE+SGH+VLKRK+DY+ AS++NAW+LLAEVSLSEERFQEVNALI Sbjct: 337 GEVSAEVLDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLSEERFQEVNALI 396 Query: 181 FEAIACGDDEKGNLTEDMIEEPDVTPPSHEDAGAINNSSYPAAMVAGKQECLVQQ 235 FE IA G++ NL ED P+V P SHE+ A N S AAMV QEC+V Q Sbjct: 397 FERIASGNNGNENLPED----PEVKPRSHEEVDATINKSSRAAMVGETQECIVLQ 447 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv34343 (364 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv20639 (244 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27166265 (169 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8306 230 1e-62 >Contig8306 Length = 209 Score = 230 bits (586), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 111/149 (74%), Positives = 128/149 (85%), Gaps = 1/149 (0%) Query: 1 MFLPILCIFSLILSS-HAAVQDFCVGDLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGN 59 M PIL FSL+LSS +AAVQDFCV DL AP+GPAGYSCK PA V VDDFVFSGLG+AGN Sbjct: 1 MIFPILFTFSLLLSSSNAAVQDFCVADLTAPDGPAGYSCKSPANVKVDDFVFSGLGVAGN 60 Query: 60 TSNLIKAAVTPAFAPQFPGLNGLGLSIARLDLAVGGVVPMHTPPGGSEVLLVTQGAICAG 119 T+N+IKAAVTPAFA QFPG+NGLG+S+ARLDLAVGGV+P HT PGGSEVL+V +G ICAG Sbjct: 61 TTNIIKAAVTPAFAAQFPGVNGLGISLARLDLAVGGVIPFHTHPGGSEVLIVIEGTICAG 120 Query: 120 FISSANTVYFKTLKKGDIMIFPQTICQLN 148 F+SSANTVY +TL+KGDIM+FPQ + Sbjct: 121 FVSSANTVYLQTLEKGDIMVFPQGLLHFQ 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59577 (186 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18266257 (230 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3156 (152 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48121754 221 5e-60 >48121754 Length = 106 Score = 221 bits (563), Expect = 5e-60, Method: Compositional matrix adjust. Identities = 104/106 (98%), Positives = 105/106 (99%) Query: 1 MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 MSTPARKRLMRDFKRLQQDPPAGISGAP DNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT Sbjct: 1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 Query: 61 EEYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 E+YPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv24641 (121 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19385 (57 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32731 (103 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv464 (382 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv59553 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9025 (428 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48380944 221 2e-59 >48380944 Length = 133 Score = 221 bits (563), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 111/135 (82%), Positives = 115/135 (85%), Gaps = 2/135 (1%) Query: 1 MGETRDNDAXXXXXXXXXXXXXKAPDSVTGKVNGEAAKKGYVGIHSSGFRDFLLKPELLR 60 MGETRD D KAPDS KVNGEA KKGYVGIHSSGFRDFLLKPELLR Sbjct: 1 MGETRD-DVYDEELVDYEEEEEKAPDSAA-KVNGEAPKKGYVGIHSSGFRDFLLKPELLR 58 Query: 61 AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVTGQVAALV 120 +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PV GQV+ALV Sbjct: 59 SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVSALV 118 Query: 121 LCHTRELAYQICHEF 135 LCHTRELAYQICHEF Sbjct: 119 LCHTRELAYQICHEF 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv66022 (324 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3516 (219 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10579 74 2e-15 >Contig10579 Length = 222 Score = 73.9 bits (180), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 4/116 (3%) Query: 6 LGDTIPNLEVETTHGR----TKLHDYIGDRWTIIFSHPGDFTPVCTTELGKMAAYTEEFA 61 +G+ P+ E E + KL +YIG ++ I+F +P DFT VC TE+ + EFA Sbjct: 80 VGNVAPDFEAEAVFDQEFVNVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFA 139 Query: 62 RREVKLLGLSCDDVQSHKEWIKDIEAYTPGSKVTYPIAADPKREIIKQLNMVDPDE 117 ++LG+S D V SH W++ + YP+ +D + I K ++ PD+ Sbjct: 140 ELNTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSYGVLIPDQ 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv61830 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30486 (188 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27563 (150 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25025 (183 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55974 (129 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10432 112 2e-27 >Contig10432 Length = 181 Score = 112 bits (280), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 54/110 (49%), Positives = 70/110 (63%), Gaps = 2/110 (1%) Query: 11 VTIDVHAAKDLINSGYRYLDVRTVEEFKKGHADVENILNIPYLFTTPEGRVKNPEFLEQV 70 ++ V A +L+ +G++YLDVRT EEF GHA +NIPYL+ G KN EFLEQV Sbjct: 70 TSVPVRVAHELLQAGHKYLDVRTPEEFSAGHAP--GAVNIPYLYKVGSGMTKNQEFLEQV 127 Query: 71 QFACSKEDHLIVGCQSGVRSLAATSVLVSAGFKDVKDIGGGYLAWVQNGL 120 K D +IVGCQ G RS+ A + L ++GF + DI GGY AW Q+GL Sbjct: 128 SSHFRKHDEIIVGCQLGKRSMMAATDLEASGFTGITDIAGGYAAWTQSGL 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv48158 (245 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226775327 78 2e-16 >226775327 Length = 100 Score = 77.8 bits (190), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 1/100 (1%) Query: 119 LKHCVGVNNSITSVLGPNTLAIHGFLDIEVENHSNNTTXXXXXXXXXXXXXXXXDSEGLT 178 +KHCV VNNS+ SVL P + A HGF+D+E+ + + + +G Sbjct: 1 MKHCVDVNNSVRSVLEPVS-ANHGFIDVELVDPICSVAKLSKKKKTYQKRKVQTELDGTA 59 Query: 179 IGMQDSCQQMEQLDSRMHTLDNCYVPQQDMQGMELGSREP 218 I +QDSCQQME + SR H LDNCY P Q+ + +L S P Sbjct: 60 IRLQDSCQQMELMKSRAHKLDNCYFPHQESERGQLNSISP 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30821 (246 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv40027 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11002 63 2e-12 >Contig11002 Length = 231 Score = 63.2 bits (152), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 34/58 (58%), Positives = 38/58 (65%) Query: 2 LDVVRANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPPCSFTPDEIDYLTAR 59 LDVVRA TF A ++ EV+VPVVGGHAGVTILPL SQ P + D I LT R Sbjct: 174 LDVVRAKTFYAGKANVNVAEVNVPVVGGHAGVTILPLFSQATPAANLPHDVILALTKR 231 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21575 (337 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv27480 (93 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 226756907 183 4e-49 >226756907 Length = 114 Score = 183 bits (465), Expect = 4e-49, Method: Compositional matrix adjust. Identities = 87/89 (97%), Positives = 89/89 (100%) Query: 1 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY 60 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY Sbjct: 22 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY 81 Query: 61 FQNTQGLIFVVDSNDRDRVVEARDELHKI 89 FQNTQGLIFVVDSNDRDRVVEARDELH++ Sbjct: 82 FQNTQGLIFVVDSNDRDRVVEARDELHRM 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8676 (391 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8715 107 3e-25 >Contig8715 Length = 275 Score = 107 bits (268), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 46/93 (49%), Positives = 67/93 (72%) Query: 295 NVSGWQAMFWASIIPLVIVFAVGTKLQAVLTKMALEITERHAVVQGIPLVQGSDKYFWFS 354 N G ++ W +PLV++ VGTKLQ ++TKM L+++ER VV+G PLV+ D FWF+ Sbjct: 3 NTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLKLSERGEVVRGTPLVEPGDHLFWFN 62 Query: 355 WPQLVLHLIHFVLFQNAFQITYFLWIWYSFWVE 387 P+L+L++IHFVLFQNAF + +F W WY F ++ Sbjct: 63 NPRLLLYIIHFVLFQNAFALAFFAWTWYEFGLK 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56231 (362 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig7236 488 e-140 >Contig7236 Length = 346 Score = 488 bits (1256), Expect = e-140, Method: Compositional matrix adjust. Identities = 235/334 (70%), Positives = 269/334 (80%), Gaps = 9/334 (2%) Query: 3 MKDGPVENGICSSESIHGGTDVWSSKESATASADHLVVMVHGILGSVTDWKFAAEQFVRI 62 M++G VENG+CSSES G VWSSKES +SADHLVVMVHGI+G+ DWKF AEQFV+ Sbjct: 12 MENGVVENGVCSSESATGSRYVWSSKESEYSSADHLVVMVHGIMGTAADWKFGAEQFVKT 71 Query: 63 LPDKVIVHRSERNASMLTLDGVDVMGERLAEEVIEVIKQKPEVRKISFVSHSVGGLVARY 122 LPDKVIVH SERN S LTLDGVDVMGERLAEEVIE+ ++KP +RKISF+ HSVGGLVARY Sbjct: 72 LPDKVIVHCSERNGSRLTLDGVDVMGERLAEEVIELTRKKPNLRKISFIGHSVGGLVARY 131 Query: 123 AIGRLYRP---------PRSENEDDPSANTCEENSRGTIYGLEAMNFITVATPHLGSRGN 173 AIGRLYRP P+SEN + S + CEE++R T+ GLE +NFITVATPHLGSRGN Sbjct: 132 AIGRLYRPGPPKSDNTEPKSENTEHSSPDGCEEDARSTLAGLEPLNFITVATPHLGSRGN 191 Query: 174 KQVPFLFGVPVFEKAATSVIHLIFRRTGRHLFLTDDDEGNPPLLRRMIEDCGELHFMSAL 233 KQVPFLFGVP FE+ A++VIHLIFRRTGRHLFL DDD+G PPLL+RMIEDC +FMSAL Sbjct: 192 KQVPFLFGVPAFERLASAVIHLIFRRTGRHLFLNDDDDGKPPLLKRMIEDCDGCYFMSAL 251 Query: 234 HSFTRRVIYSNVGYDHIVGWRTSSIRRNSELPKWEDVVNEKYPHIVFEEHCKACDAEQCE 293 SF RRV+YSNVGYDHIVGW+TS IRRNSELPKWE+ V+EKYPHIV+EEHCKA DAEQCE Sbjct: 252 RSFKRRVVYSNVGYDHIVGWKTSCIRRNSELPKWENTVDEKYPHIVYEEHCKAYDAEQCE 311 Query: 294 PSSXXXXXXXXXXXXXXXXXSCVSWEKVDVSFHA 327 P+S S +SWEK+DVSFH+ Sbjct: 312 PASAEDGGSGELEEELLKGLSRLSWEKIDVSFHS 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv25966261 (250 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10810 402 e-114 >Contig10810 Length = 250 Score = 402 bits (1034), Expect = e-114, Method: Compositional matrix adjust. Identities = 193/250 (77%), Positives = 207/250 (82%) Query: 1 MGKSYPTVSXXXXXXXXXXXXXLRGLIAEKNCAPIMLRIAWHSAGTFDVKTRTGGPFGTM 60 MGK YPTVS LRGLIAEKNCAP+MLRIAWHSAGT+D KT+TGGPFGTM Sbjct: 1 MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM 60 Query: 61 KKPEELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEVTGGPEIPFHPGRE 120 + P E +HGANNGLDIAVRLLEPIK+QFPI+SYADFYQLAGVVAVE+TGGP++PFHPGR+ Sbjct: 61 RCPAEQSHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRK 120 Query: 121 DKPEPPPEGRLPDATKGCDHLRQVFVTQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT 180 D PEPPPEGRLPDATKGCDHLR VF MGLSDKDIVALSG HTLGRCHKERSGFEGPWT Sbjct: 121 DAPEPPPEGRLPDATKGCDHLRDVFGKTMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180 Query: 181 SNPLIFDNSYFXXXXXXXXXXXXXXPSDKALLSDPAFRPLVEKYAADEDAFFEDYKEAHL 240 NPLIFDNSYF PSDKALL DP FRPLVEKYAADEDAFF DY EAH+ Sbjct: 181 PNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHM 240 Query: 241 KLSELGFADA 250 +LSELGFA+A Sbjct: 241 RLSELGFAEA 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv37379 (504 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24312 398 e-112 >Contig24312 Length = 482 Score = 398 bits (1022), Expect = e-112, Method: Compositional matrix adjust. Identities = 193/429 (44%), Positives = 271/429 (63%), Gaps = 12/429 (2%) Query: 80 DRIDMLPGQP-HVGFSQYGGYVTIDESKGKALYYYFAEAXXXXXXXXXXXWLNGGPGCSS 138 DR+ LPGQ ++ F+ + GYV ++E G+AL+Y+F EA WLNGGPGCSS Sbjct: 39 DRVADLPGQSFNLSFAHFSGYVPVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSS 98 Query: 139 LAYGAMQELGPFRVHSEGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDYRNGGDR 198 +AYG +E+GPF + ++GKTLY N Y+WN+VANVLF +SP GVGFSYSNT+SD + GD+ Sbjct: 99 IAYGMAEEIGPFHIEADGKTLYLNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSNGDK 158 Query: 199 KTAKDNYAFLVNWLERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKADGPIINLKG 258 +TA D+ FL+ W ERFP+YK RDFYI+GESY GHYVPQL+ I+ +N K +NLKG Sbjct: 159 RTANDSLTFLLQWFERFPQYKGRDFYITGESYGGHYVPQLSQAIVKYNLKTKEKTVNLKG 218 Query: 259 IIIGNAVINDETDELGMYQYFGSHALVSEKTIRQMEKHCNFSPGAASQSKECTKASDEXX 318 ++GNA+ +D D LG++Q+ S L+S++T + + C+F S C D Sbjct: 219 YMVGNALTDDYHDHLGVFQFMWSAGLISDQTYKLLNLLCDFQ-SFIHTSNSCDNVLDIAN 277 Query: 319 XXXXXXXXXXXXAPLC-FNTNLTVKPKK-------VTPEFDPCSDYYVYAYLNRADVQKA 370 P C N + + +K ++ ++DPC++ + Y N +VQKA Sbjct: 278 AELGNIDPYSIYTPSCPANVSQSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNLPEVQKA 337 Query: 371 LHANVTKLKYDWEPCSDVI-QNWTDSPSTIIPLLHEFMENGLRVWVFSGDTDGRVPVTST 429 LH + W CSDV+ W DSP T++ + E + +GLR+W+FSGD D +P+TST Sbjct: 338 LHIDPGHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVIPITST 397 Query: 430 MASIDTMKLSVKTPWHPWFVAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLIS 489 SID +KL PW W+ G+VGG+T+ Y G LTF +VRGAGH+VP +PK+AL+LI Sbjct: 398 RYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAG-LTFVSVRGAGHEVPLHKPKQALTLIK 456 Query: 490 HFLSGTPLP 498 FLSG+ +P Sbjct: 457 SFLSGSSMP 465 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv55708 (453 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44608 (373 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11014 64 4e-12 >Contig11014 Length = 227 Score = 63.9 bits (154), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 55/215 (25%), Positives = 88/215 (40%), Gaps = 38/215 (17%) Query: 85 EPNCFLQGHDGPAYDVKFYGDGEESLLLSCGDDGRICGWRWKEITQSEVHIPLQGNHVEP 144 +P QGH GP Y F G+ +LS D + W T+ ++ H P Sbjct: 11 KPYTLFQGHSGPVYSATFNPLGD--FILSSSADSTVRLWS----TKLNANLVCYKGHNYP 64 Query: 145 VLDLVNPQHKGPWGALSPVPENNAIAVNAQWGSVFAAAG-DSCAYCWDVEKSKIKMVFKG 203 V D+ SPV G FA+A D A W +++ + + G Sbjct: 65 VWDV----------QFSPV------------GHYFASASHDRTARIWSMDRIQPLRIMAG 102 Query: 204 HSDYLHCIIARNSSNQIITGSEDGTARIWDCQSGKCIQVIDAKKDKKPKEIFSCVSCIAL 263 H + C+ + N I TGS D T R+WD Q+G+C+++ + S V +A+ Sbjct: 103 HLSDVDCVQWHANCNYIATGSSDKTVRLWDVQTGECVRIFIGHR--------SMVLSLAM 154 Query: 264 DASESWLAYG-RGRSLSVWNLPACERVTRVSTHAS 297 ++A G ++ +W+L VT + H S Sbjct: 155 SPDGRYMASGDEDGAIMMWDLSTGRCVTPLMGHTS 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23856 (418 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig21057 388 e-109 >Contig21057 Length = 446 Score = 388 bits (996), Expect = e-109, Method: Compositional matrix adjust. Identities = 184/362 (50%), Positives = 272/362 (75%), Gaps = 4/362 (1%) Query: 43 RLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEE---VKRIQSVPLVIGQFMEMVDQN 99 RL L+R +++ ++EE+V + Q+ LK + +A+E+ V ++ P+ +G E++D+N Sbjct: 67 RLLKLERIKDYLLMEEEFVTN-QERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEELIDEN 125 Query: 100 NGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK 159 + IV S+ G YYV ILS ++++ L+P ++ +H ++V +L E D +S++ + Sbjct: 126 HAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKVEKA 185 Query: 160 PDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV 219 P +Y DIGG D Q QEI+EAVELPLTH ELY+ IGI PP+GV+LYG PGTGKT+LAKAV Sbjct: 186 PLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAV 245 Query: 220 ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT 279 AN T+A F+RVVGSE +QKYLG+GP++VR++FR+A + +P+I+FIDE+DA+ T R+DA + Sbjct: 246 ANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHS 305 Query: 280 GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR 339 G +RE+QR ++ELLNQ+DGFD +VKVI+ATNR ++LDPALLRPGR+DRKIEFPLPD + Sbjct: 306 GGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIK 365 Query: 340 QKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDF 399 +R +FQ+ T++M L+D+V+LE++V D+ S A+I AIC EAG+ A+R+ R + DF Sbjct: 366 TRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDF 425 Query: 400 EK 401 +K Sbjct: 426 KK 427 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30318 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv161 (95 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig28629 122 2e-30 >Contig28629 Length = 283 Score = 122 bits (305), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 52/94 (55%), Positives = 72/94 (76%) Query: 1 MIDIHSMQEFLSALSQAGDKLVIVEFYGTWCASCRALFPKLCKTAQDYPNIIFLKVNFDE 60 M++IHS QE + +L AGD+LV+V+FY C CRAL PK+C+ A+ PN IFLKVN++E Sbjct: 106 MVEIHSAQELVDSLKNAGDRLVVVDFYSPGCGGCRALHPKICQLAESNPNAIFLKVNYEE 165 Query: 61 NKSMCKSLNVKMLPCFHFYRGSDGLLESFSCSLA 94 +K+MC +LN+ +LP F FYRG+DG + SFSC+ A Sbjct: 166 HKTMCHALNIHVLPFFRFYRGADGRVCSFSCTNA 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv58658 (242 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv23575 (210 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24514 98 1e-22 >Contig24514 Length = 181 Score = 97.8 bits (242), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 49/100 (49%), Positives = 61/100 (61%), Gaps = 4/100 (4%) Query: 1 MRTLCDACESAAAILFCAADEAALCRACDEKVHMCNKLASRHVRVGLADPS--DVPRCDI 58 M+ CD C A +FC ADEAALC ACD +VH NKLAS+H R L PS + P CDI Sbjct: 1 MKIQCDVCNKDDASVFCTADEAALCDACDHRVHHANKLASKHHRFSLVHPSSKEFPVCDI 60 Query: 59 CENAPAFFYCEVDGTSLCLQCDMIVHVGGK--RTHGRYLL 96 C+ AF +C+ D LC +CD+ +H + R H RYLL Sbjct: 61 CQERRAFLFCQQDRAILCRECDLPIHNANEHTRKHNRYLL 100 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35193 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8116 (90 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8566262 (176 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv49777 (107 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21507 (209 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1891 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3623 (481 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24312 390 e-110 >Contig24312 Length = 482 Score = 390 bits (1001), Expect = e-110, Method: Compositional matrix adjust. Identities = 194/420 (46%), Positives = 260/420 (61%), Gaps = 15/420 (3%) Query: 74 LPGQPSGVLFKQYAGYVTVNELKGRNLFYYFAEAAEDPSSKPLLLWLNGGPGCSSLGVGA 133 LPGQ + F ++GYV VNE GR LFY+F EAAEDP SKP++LWLNGGPGCSS+ G Sbjct: 44 LPGQSFNLSFAHFSGYVPVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGM 103 Query: 134 MVEIGPFGVKPDGKTLYLRPYAWNKVANTLFLESPVGVXXXXXXXXXXXXXXXDKRTAQD 193 EIGPF ++ DGKTLYL PY+WN+VAN LF +SPVGV DKRTA D Sbjct: 104 AEEIGPFHIEADGKTLYLNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSNGDKRTAND 163 Query: 194 TYAFLINWFRRFPHYKNRDFYIMGESYAGFYIPELADTIIRRNMKADSSSIIHLKGIMIG 253 + FL+ WF RFP YK RDFYI GESY G Y+P+L+ I++ N+K + ++LKG M+G Sbjct: 164 SLTFLLQWFERFPQYKGRDFYITGESYGGHYVPQLSQAIVKYNLKTKEKT-VNLKGYMVG 222 Query: 254 NGIMNDMTDNRGFYDYLWSHALISDKTHQGLVEYCKFPD----SYECKKLEDHIELEVGL 309 N + +D D+ G + ++WS LISD+T++ L C F S C + D E+G Sbjct: 223 NALTDDYHDHLGVFQFMWSAGLISDQTYKLLNLLCDFQSFIHTSNSCDNVLDIANAELGN 282 Query: 310 IDFYNIYAPVC---IRSSNSSRKPKRHGG-----FDPCEADYVLRYLNLPQVQEALHANR 361 ID Y+IY P C + SN RK + G +DPC + + Y NLP+VQ+ALH + Sbjct: 283 IDPYSIYTPSCPANVSQSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNLPEVQKALHIDP 342 Query: 362 TKIPYAWEVCSSVIT-SWTDSPSTMFPIYKRLISSGLHILIYXXXXXXXXXXXXTRYSIN 420 P W CS V++ +W DSP T+ +YK LI SGL I ++ TRYSI+ Sbjct: 343 GHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVIPITSTRYSID 402 Query: 421 ALNLKVIRPWHPWSESTKVVGGYRVVYEGLTFATIRGAGHEVPRFQPRRAFALMESFVAG 480 AL L ++PW W + + VGG+ Y GLTF ++RGAGHEVP +P++A L++SF++G Sbjct: 403 ALKLPTVKPWRAWYDDGQ-VGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKSFLSG 461 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6066265 (200 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30299 (117 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv56365 (286 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv1787 (583 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv30250 (404 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29208 231 2e-62 >Contig29208 Length = 288 Score = 231 bits (588), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 121/285 (42%), Positives = 166/285 (58%), Gaps = 2/285 (0%) Query: 117 DSILGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGA 176 DS G F+ + V + + ++GK IK+VS R+P ++PWGD ++ V+E +G+F + A Sbjct: 1 DSTHGIFDGSISVVDNSTLEINGKEIKVVSKRDPAEIPWGDYGVEYVVESSGIFTTLEKA 60 Query: 177 GKHIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDEPIISNASCTTNCLAPFVKVLDQK 236 H + GAKKV+I+AP D P +VVGVN + Y + I+SNASCTTNCLAP KV+ ++ Sbjct: 61 ALHKKGGAKKVVISAP-SADAPMFVVGVNENTYKPNMDIVSNASCTTNCLAPLAKVIHEE 119 Query: 237 FGIIKGTMTTTHSYTGDQXXXXXXXXXX-XXXXXXXXNIVPTSTGAAKAVALVLPTLKGK 295 FGI++G MTT H+ T Q NI+P+STGAAKAV VLP L GK Sbjct: 120 FGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGK 179 Query: 296 LNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAGFRDSAEKELQGILSVCDEPLVSVDFR 355 L G+A RVPTPN K + E+V A R +A+ L+GIL +E +VS DF Sbjct: 180 LTGMAFRVPTPNVSVVDLTCRLEKSSSYEDVKATIRYAADGPLRGILGYTEEDVVSNDFV 239 Query: 356 CXXXXXXXXXXXXXXXGDDMVKVIAWYDNEWGYSQRVVDLADIVA 400 VK+++WYDNEWGYS RV+DL + +A Sbjct: 240 GDSRSSIFDAKAGLALSSSFVKLVSWYDNEWGYSTRVLDLIEHMA 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv43574 (197 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2868 (513 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig10162 625 0.0 >Contig10162 Length = 552 Score = 625 bits (1613), Expect = 0.0, Method: Compositional matrix adjust. Identities = 311/512 (60%), Positives = 384/512 (75%), Gaps = 34/512 (6%) Query: 34 TNSRWIVDEDGARVKLACVNWPSHQEAPVAEGLSNHPVDLISKRIASLGFNCVRLTLPLF 93 T+SRWIVDE G RVKLACVNW SH +A VAEGLS PVD I+KRIASLGFNCVRLT PL Sbjct: 31 TSSRWIVDESGQRVKLACVNWVSHLDAVVAEGLSKQPVDAIAKRIASLGFNCVRLTWPLL 90 Query: 94 LAIDQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLADNNMMVIL 153 LA +++LA++TVRQSFQ LGLLES++G Q+NNP+++DLPL AYQAVVS+L NN+MVIL Sbjct: 91 LATNETLAAVTVRQSFQSLGLLESISGIQSNNPALVDLPLLKAYQAVVSSLGSNNVMVIL 150 Query: 154 DSHFSEPSF-----HDNGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGMSLRNELRCPN 208 D+H S P + DNG FGD++FNPDLW+ GLTR+AT+F GV NVVGMSLRNELR P Sbjct: 151 DNHLSTPGWCCNNNDDNGFFGDKYFNPDLWITGLTRMATLFKGVSNVVGMSLRNELRGPK 210 Query: 209 QNVKDWYRYMQKGAEAVHSANPDVLVIISGLSDGTDLSFLLNQQLELTFTGKLVLEMHWH 268 QNV DWY+YMQ+GAEAVHSAN DVLVI+SGLS TDLSFL + + LTF GK V E+HW+ Sbjct: 211 QNVDDWYKYMQRGAEAVHSANADVLVILSGLSFDTDLSFLAKRPVSLTFAGKTVFEVHWY 270 Query: 269 GSRVGRAGETSNPNKVCGRVVDSIMRRGGVLLQQGWPLIFVSELGVD-------DNRHLN 321 G G+A + NPN+VCG+V +++ R+ G LL G PL FVSE GVD DNR+LN Sbjct: 271 GFSDGQAWKNGNPNQVCGQVYNNVKRKSGFLLDNGLPL-FVSEFGVDHRGTNVNDNRYLN 329 Query: 322 CFFGLAAELDFDWALWTL-------------EETNGLMNW------NSSFFQRISALQSP 362 CF AAE D D+ALWTL EE G++NW NSS QR+S LQSP Sbjct: 330 CFMAAAAEFDVDFALWTLVGSYYLRQGVVGMEEYYGILNWDWSDIRNSSLTQRLSVLQSP 389 Query: 363 LQGPDVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTKSEAWGYTPQKLLTVKGTYFC 422 LQGP +++ R HKIIFHP+TGLC+L+ PLKLGPC++S AW Y+ +K+LT+KGTYFC Sbjct: 390 LQGPGLAQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCSQSGAWAYSSRKVLTLKGTYFC 449 Query: 423 LQAVGLGKPAKLSIICTKPGSNWEIISDSKMYLSTKLGDGTRVCLDVDSSSTIVTDACKC 482 +QA L KPA + I+CT S W+IISDSK++L +K DGT VCLDVDSS+T+VT++C C Sbjct: 450 IQADKLNKPAAVGILCTTRNSQWDIISDSKLHLQSKTMDGTEVCLDVDSSNTVVTNSCNC 509 Query: 483 LGRGDMCDPGSQWFKVVDST--NITRRPILQI 512 L R CDPG+QWFK+VDST + + P+L++ Sbjct: 510 LSRDSSCDPGNQWFKLVDSTINSSPKSPMLEL 541 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3579 (237 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv36782 (137 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv18425 (124 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2612 171 5e-45 >Contig2612 Length = 248 Score = 171 bits (432), Expect = 5e-45, Method: Compositional matrix adjust. Identities = 88/102 (86%), Positives = 94/102 (92%) Query: 1 MPKIAFGRFDDSFSLASFKAYLAEFHSTILFVFAGVGSVMAYNKLTSDAALDPAGLVAVA 60 M IAFGRFDDSFSL S KAYLAEF ST+LFVFAGVGS +AYNKLTSDAALDPAGLVAVA Sbjct: 1 MAGIAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVA 60 Query: 61 VAHGFALFVAVAISANISGGHVNPAVTFGLVVGGQITILTGM 102 +AHGFALFVAV+I ANISGGHVNPAVTFGL +GGQITILTG+ Sbjct: 61 IAHGFALFVAVSIGANISGGHVNPAVTFGLALGGQITILTGI 102 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32211 (76 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv5147 (158 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2618 214 5e-58 >Contig2618 Length = 161 Score = 214 bits (545), Expect = 5e-58, Method: Compositional matrix adjust. Identities = 103/154 (66%), Positives = 122/154 (79%), Gaps = 2/154 (1%) Query: 6 RPVLVIGIDDSSHSFYALEWTLDHFFS--SPQTKPFKLVIVYARPPASSVVGFAGPGLPD 63 + V+VIG DDS YALEWTLDH F T PFKL+IV+A+P SSVVGF GP + Sbjct: 5 KQVMVIGADDSEEGHYALEWTLDHLFKPLGGDTAPFKLIIVHAKPSVSSVVGFVGPAGAE 64 Query: 64 IIAHVDSDLKKAAARIVDKAKQMCNSKSVEDVTVSVMEGDARSIICDAVNIHHASILVVG 123 ++ VD+DLKK AAR+ ++AK+ C SKSV DV V VMEGDAR+++C+AV HHASILVVG Sbjct: 65 VLPIVDADLKKMAARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHHASILVVG 124 Query: 124 SHGYGALKRAVLGSVSDYCAHHAHCTVMIVKKPK 157 SHGYGA+KRA+LGSVSDYCAHH HCTVMIVKKPK Sbjct: 125 SHGYGAIKRALLGSVSDYCAHHVHCTVMIVKKPK 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv9940 (456 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8054 356 e-100 >Contig8054 Length = 247 Score = 356 bits (913), Expect = e-100, Method: Compositional matrix adjust. Identities = 180/261 (68%), Positives = 200/261 (76%), Gaps = 16/261 (6%) Query: 198 IKGCAEDGESKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTSKVSEVQKPDYIHVR 257 +K CAE G+SKI D SK SEVQKPDYIHVR Sbjct: 1 MKSCAEKGDSKITEQTSTKNNDGESSGDTSK------------DNSKASEVQKPDYIHVR 48 Query: 258 ARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVE 317 ARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVE Sbjct: 49 ARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVE 108 Query: 318 FLSMKLAAVNPRLDFNIDNFLAKEVFPACAANFPTIGMSSEMTNPSYLHYDPIQQ-VATC 376 FLSMKLAAVNPRLDFNID+ AKE+FP CAANFPT+GMSSEMTN YL +P+QQ V++ Sbjct: 109 FLSMKLAAVNPRLDFNIDDLFAKEMFPTCAANFPTMGMSSEMTNSVYLQLNPMQQLVSSS 168 Query: 377 GVEMGINPAEIALRRTISAPVSIPDTFLD-SCFTQIQPSSTWDADLQNLYGPEFHQGRLM 435 G++MG+N ++ALRRTISAP SIP+ FLD SCFTQ QP++ WDADLQN++ EF QGR Sbjct: 169 GLDMGLNSTDLALRRTISAPSSIPEPFLDTSCFTQAQPTAIWDADLQNIFNVEFQQGR-S 227 Query: 436 SFPSQAAFTGPIDASNLKMEM 456 SF SQ FTG I+ SNLKMEM Sbjct: 228 SFQSQ-PFTGSIEDSNLKMEM 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv47129 (614 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25664 278 1e-76 >Contig25664 Length = 718 Score = 278 bits (712), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 165/451 (36%), Positives = 254/451 (56%), Gaps = 26/451 (5%) Query: 145 VKFTDVAGLGKIRLELEEIVKFFTHGEMYRRRGVKXXXXXXXXXXXXXXKTLLAKAVAGE 204 V F DVAG + +LEL+E+V F + + Y G K KTLLA+AVAGE Sbjct: 261 VTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGE 320 Query: 205 AGVNFFSISASQFVEIYVGVGASRVRALYQEAKENAPSVVFIDELDAVGRERGLIKGSGG 264 AG FFS +AS+FVE++VGVGASRVR L+++AK AP +VFIDE+DAVGR+RG G G Sbjct: 321 AGTPFFSCAASEFVELFVGVGASRVRDLFEKAKSKAPCIVFIDEIDAVGRQRGAGMGGGN 380 Query: 265 QERDATLNQLLVCLDGFEGRGNVITIASTNRPDILDPALVRPGRFDRKIYIPKPGIIGRI 324 ER+ T+NQLL +DGF G VI +A+TNRPD+LD AL+RPGRFDR++ + +P + GR+ Sbjct: 381 DEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRV 440 Query: 325 EILKVHARKKPMAEDVDYMAVGSMTDGMVGAELANIIEVAAINMMRDGRSEITTDDLLQA 384 +IL+VH+R K +A+DVD+ + T G GA+L N++ AAI R EI+ D++ A Sbjct: 441 KILQVHSRGKALAKDVDFDKIARRTPGFTGADLQNLMNEAAILAARRDLKEISKDEISDA 500 Query: 385 AQIEERGMLDRKER----SPEMWKRVAINEAAMAVVAVNFPDLKNIEFVTISPRAGRELG 440 ER + +++ S + K VA +EA A+V P+ + ++I PR G+ G Sbjct: 501 L---ERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPR-GQAGG 556 Query: 441 YVRMKMDHIKFKEGMLSRQSLLDHITVQLAPRAADEIWYGEDQLSTIWAETADNARSAAR 500 + + G+ SR L + + V L R A+E+ +G++ ++T + AR Sbjct: 557 LTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVAR 616 Query: 501 TFV--------LGGLSEKHQGLSSF----------WVADRINDIDLEALRILEVCYERAK 542 V +G ++ G + F + + +D E ++E Y RAK Sbjct: 617 QMVERFGFSKKIGQVAIGASGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAK 676 Query: 543 EILKQNRKLMDAVVDEPVQKKSLTKQEFFCL 573 +I+ + ++ + ++K+++ +EF L Sbjct: 677 DIVTTHIDILHTLAQLLMEKETVDGEEFMSL 707 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv8620 (351 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig29054 65 1e-12 >Contig29054 Length = 359 Score = 65.5 bits (158), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 35/106 (33%), Positives = 55/106 (51%) Query: 235 IHAFAREGEVDNLLKCIDNGVSVDLKDSEGRTPLHWAVDRGHLNLTELLLNHGADVNAKD 294 +H A G+V+ L + +G D +DSEGRT LH+A G + + LL GA V+A D Sbjct: 239 VHHTASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKCAQALLEAGARVDALD 298 Query: 295 HEGQSPLHYAVVCEREAIAEFLVKQNADINAMDNDGASPFELCESN 340 + LHYA R+ L++ A + + DG +P ++ + N Sbjct: 299 KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLN 344 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv14939 (456 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3617 (289 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7681 (153 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5266 154 5e-40 >Contig5266 Length = 105 Score = 154 bits (390), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 72/105 (68%), Positives = 91/105 (86%) Query: 46 MILVSRIKKLQEDLCSLKEQCQELLAAKQDLIDKARTTLVGNRSLLQRMQAPMGIPLASD 105 M LVSRIKK+QE+L +L++ C++LL+AKQDLIDKARTTLVGNR+ LQRM+ MG+ +D Sbjct: 1 MKLVSRIKKIQEELSTLEDHCRQLLSAKQDLIDKARTTLVGNRNQLQRMETSMGVFADAD 60 Query: 106 SDDPAYANFNQIIDEWTNQVRSRTGDVTHESESEDINKMLFSAIV 150 SDD A+ANFNQ+IDEWT QVRS+TGD +S+SEDIN++LFSAIV Sbjct: 61 SDDSAFANFNQVIDEWTAQVRSKTGDENRDSDSEDINQLLFSAIV 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv35730 (182 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv17866264 (310 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 48694241 128 9e-32 >48694241 Length = 105 Score = 128 bits (322), Expect = 9e-32, Method: Compositional matrix adjust. Identities = 64/103 (62%), Positives = 72/103 (69%) Query: 208 GFILFMYHSKWRERLPARPAFYKYITIMCCLNALALFACGLTGNGAGFGFWLYGLTMIFY 267 + L + ++ R L ARPAFY YI +M L ALA F CGL G GA FG WLY LT I Y Sbjct: 3 SYCLCISQNRERSYLAARPAFYNYIFVMFVLCALASFGCGLAGIGASFGIWLYNLTDICY 62 Query: 268 HAFYLPLLYITFLADFFQEEDLHLENVYYSEMKDAGFFDADWE 310 H YLP LY+ F+ADFFQEE LEN YYSEMKDAGFFDADW+ Sbjct: 63 HTLYLPSLYMIFVADFFQEESFLLENAYYSEMKDAGFFDADWD 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2078 (199 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig15758 115 7e-28 >Contig15758 Length = 278 Score = 115 bits (287), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 61/83 (73%), Positives = 63/83 (75%), Gaps = 1/83 (1%) Query: 94 NELFVGRVAMLGFAASLLGEAITGKGILAQLNLETGIPIYEAEPXXXXXXXXXXXXXXXX 153 NELFVGRVAM+GFAASLLGEAITGKGIL+QLNLETGIPIYEAEP Sbjct: 102 NELFVGRVAMIGFAASLLGEAITGKGILSQLNLETGIPIYEAEPLLLFFILFTLLGAIGA 161 Query: 154 XXDRGRFVDDDPPTGIEGAVIPP 176 DRGRFV DDPP GIEGAVIPP Sbjct: 162 LGDRGRFV-DDPPAGIEGAVIPP 183 Score = 70.1 bits (170), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 34/44 (77%), Positives = 38/44 (86%) Query: 94 NELFVGRVAMLGFAASLLGEAITGKGILAQLNLETGIPIYEAEP 137 NELFVGR+A LGFA SL+GE ITGKG LAQLN+ETG+PI E EP Sbjct: 206 NELFVGRLAQLGFAFSLIGEIITGKGALAQLNIETGVPISEIEP 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv7645 (492 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig8507 110 5e-26 >Contig8507 Length = 182 Score = 110 bits (275), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 50/103 (48%), Positives = 73/103 (70%) Query: 150 SGLSDTLKIHLQKVIETQPVMLFMKGSPEEPKCGFSRKVVEILREEKVKFGSFDILLDTE 209 + L+ LK L KV+ + V+LFMKG+ + P+CGFS V+ILR V F + +IL + Sbjct: 74 AALTPELKNTLDKVVTSHKVVLFMKGTKDFPQCGFSSTCVQILRSLNVPFETINILENEL 133 Query: 210 VREGLKKFSNWPTFPQLYCKGELLGGCDIAIAMHESGELKEVF 252 +R+GLK++S+WPTFPQLY +GE GGCDI + ++SGEL+E+ Sbjct: 134 LRQGLKEYSSWPTFPQLYIEGEFFGGCDITVDAYKSGELQELL 176 Score = 107 bits (268), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 49/97 (50%), Positives = 68/97 (70%) Query: 394 LEDRVRNLINSSPTMLFMKGTPDAPKCGFSSKVVDALRAENVSFGSFDILTDEEVRQGLK 453 L++ + ++ S +LFMKGT D P+CGFSS V LR+ NV F + +IL +E +RQGLK Sbjct: 80 LKNTLDKVVTSHKVVLFMKGTKDFPQCGFSSTCVQILRSLNVPFETINILENELLRQGLK 139 Query: 454 VFSNWPTFPQLYYKGELIGGCDIIMELRNNGELKSTL 490 +S+WPTFPQLY +GE GGCDI ++ +GEL+ L Sbjct: 140 EYSSWPTFPQLYIEGEFFGGCDITVDAYKSGELQELL 176 Score = 101 bits (252), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 47/102 (46%), Positives = 69/102 (67%) Query: 282 GLSVTLTSRLESLINSSPVILFMKGKPDEPRCGFSRKVVEILQQEKVDFGSFDILSDDEV 341 L+ L + L+ ++ S V+LFMKG D P+CGFS V+IL+ V F + +IL ++ + Sbjct: 75 ALTPELKNTLDKVVTSHKVVLFMKGTKDFPQCGFSSTCVQILRSLNVPFETINILENELL 134 Query: 342 RQGLKVHSNWSSYPQLYIKGELIGGSDIVLEMQKSGELARVL 383 RQGLK +S+W ++PQLYI+GE GG DI ++ KSGEL +L Sbjct: 135 RQGLKEYSSWPTFPQLYIEGEFFGGCDITVDAYKSGELQELL 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52045 (256 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig6365 447 e-128 >Contig6365 Length = 256 Score = 447 bits (1150), Expect = e-128, Method: Compositional matrix adjust. Identities = 216/257 (84%), Positives = 235/257 (91%), Gaps = 2/257 (0%) Query: 1 MSFTGPSV-SGGRTVKRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWFQLLETLPLP 59 MSFTGPSV SGGRT +RAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSW QLLE+LPLP Sbjct: 1 MSFTGPSVGSGGRTARRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLESLPLP 60 Query: 60 NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDDLEGLDASAAHVANLLSTEPADI 119 NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDD+EGLDASAAHVANLLSTEP DI Sbjct: 61 NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDDVEGLDASAAHVANLLSTEPDDI 120 Query: 120 KLGVGGFSMGAAIALYSATCFALGKYENGNLYPSNLSAVVGLSGWLPCAKTLGNKLERVE 179 KLG+GGFSMGAA ALYSATCF+ KY NGN YP NLSAVVGLSGWLPC+KTL KLE V+ Sbjct: 121 KLGIGGFSMGAATALYSATCFSTRKYGNGNQYPCNLSAVVGLSGWLPCSKTLSKKLE-VD 179 Query: 180 EAARRIASLPILLCHGRGDDVVPFKFGEKSSKALTSAGFRDLMFKEYDGLGHYTIPEEMD 239 EAARR AS+P+LLCHG+ DDVVP+KFGEKSS+ L+S GF+++ FK Y+GLGHYTIPEEMD Sbjct: 180 EAARRAASIPLLLCHGKSDDVVPYKFGEKSSQTLSSTGFQNVTFKSYNGLGHYTIPEEMD 239 Query: 240 EVCSWLTSKLALEGCSS 256 EVC+WL SKL L+G SS Sbjct: 240 EVCAWLRSKLGLDGTSS 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv16991 (380 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig11272 633 0.0 >Contig11272 Length = 412 Score = 633 bits (1633), Expect = 0.0, Method: Compositional matrix adjust. Identities = 295/373 (79%), Positives = 333/373 (89%), Gaps = 3/373 (0%) Query: 1 MSDDKEI--SAPVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK 58 + DDKE+ + VVDGN GHII TTIGG+NG+PKQTISYMAERVVG GSFG+VFQAK Sbjct: 34 IRDDKEMESTVAVVDGNGTEAGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAK 93 Query: 59 CLETGETVAIKKVLQDRRYKNRELQLMRTMDHPNVISLKHCFFSTTSRDELFLNLVMEYV 118 CLETGETVAIKKVLQD+RYKNRELQ MR +DHPNV+SLKHCFFSTT +DEL+LNLV+EYV Sbjct: 94 CLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYV 153 Query: 119 PETMYRVLKHYSNAKQRMPLIYVKLYTYQIFRGLAYIHSVPGVCHRDLKPQNLLVDPLTH 178 PET++RV+KHY+ QRMPLIYVKLYTYQIFR L+YIH GVCHRD+KPQNLLV+P TH Sbjct: 154 PETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNLLVNPHTH 213 Query: 179 QVKLCDFGSAKVLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQ 238 QVKLCDFGSAKVLVKGE NISYICSR+YRAPELIFGATEYT++ID+WS GCVLAELLLGQ Sbjct: 214 QVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQ 273 Query: 239 PLFPGENAVDQLVEIIKVLGTPTREEIRCMNPSYTDFRFPQIKAHPWHKVFHKRMPPEAI 298 PLFPGE+ VDQLVEIIKVLGTPTREEI+CMNP+YT+F+FPQIKAHPWHK+FHKRMPPEA+ Sbjct: 274 PLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAV 333 Query: 299 DLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPEL 357 DL SRLLQYSP+LRCTAL+A H FFD+LR+PN RLPNGR LPPLFNFK EL G E Sbjct: 334 DLVSRLLQYSPNLRCTALDALVHSFFDDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAET 393 Query: 358 VNKLIPEHVRRQI 370 + KL+PEH R+Q+ Sbjct: 394 LMKLVPEHARKQV 406 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv29350 (351 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv52599 (379 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19263 (166 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv3316 (531 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig9795 402 e-114 >Contig9795 Length = 400 Score = 402 bits (1034), Expect = e-114, Method: Compositional matrix adjust. Identities = 200/398 (50%), Positives = 262/398 (65%), Gaps = 2/398 (0%) Query: 133 MRAIQGAMIVASTLQIVLGFSGLWRNVTRFXXXXXXXXXXXXXGFGLYEFGFPGVAKCVE 192 MR IQG++IV+S L I +GFS W N TRF G GL+ GFP +A CVE Sbjct: 1 MRTIQGSLIVSSFLNIFIGFSKAWGNFTRFFSPIVIVPVVCVVGLGLFARGFPLLANCVE 60 Query: 193 IGLPQLIILILVSQYMPHVIHSGKNIFDRFAVIFTVVIVWIYAHLLTVGGAYNGAAPKTQ 252 IGLP LI+L++ QY+ + +I +RFA++ + +VW +A +LT GAYN A +T+ Sbjct: 61 IGLPMLILLVITQQYLRRALPRAHHILERFALLLCIALVWSFAAVLTEAGAYNNAKQQTK 120 Query: 253 ASCRTDRAGLIDAAPWIRIPYPFQWGAPTFDAGEAFAMMVTSFVALVESTGAFIAVSRFA 312 SCRTDR+ LI +APWI+ PYPFQWGAP F A F MM + V ESTG + A +R + Sbjct: 121 QSCRTDRSFLISSAPWIKFPYPFQWGAPIFRASHVFGMMGAAIVTSAESTGTYFAAARLS 180 Query: 313 SATHLPSSILSRGVGWQGIGILLSGLFGTVNGSSVSVENAGLLALTRVGSRRVVQISAGF 372 AT P+S++S+ +G QG+G+LL G+FG G++ SVEN GLL LT +GSRRVVQIS GF Sbjct: 181 GATPPPASVVSQSIGLQGVGMLLEGIFGAAVGTTASVENVGLLGLTHIGSRRVVQISTGF 240 Query: 373 MIFFSILGKFGAVFASIPAPIVAALYCLFFAYVGSGGLSFLQFCNLNSFRTKFILGFSIF 432 M FF+I GKFGA FASIP PI AA+YC+ F V + G++F+QF N NS R ++LG S+F Sbjct: 241 MFFFAIFGKFGAFFASIPLPIFAAMYCVLFGIVAAVGITFIQFANNNSLRNIYVLGLSLF 300 Query: 433 MGFSVPQYFNEFTAIRGYGPVHTSGRWFNDMINVPFSSEAFVAGCLAFLLDITLHRKDGS 492 +G S+PQYF T+ G GPV T G WF++++N FSS VA + LLD TL K Sbjct: 301 LGISIPQYFVSNTSPNGVGPVKTDGGWFDNILNTIFSSSPTVAIIVGTLLDNTLDAKYAV 360 Query: 493 VRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFPS 530 DRG WW F+S K D R+EEFYSLP + +Y P+ Sbjct: 361 --DDRGLAWWRPFQSRKGDARNEEFYSLPVRIREYIPT 396 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv21685 (220 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 53858449 161 7e-42 >53858449 Length = 131 Score = 161 bits (408), Expect = 7e-42, Method: Compositional matrix adjust. Identities = 85/129 (65%), Positives = 98/129 (75%), Gaps = 1/129 (0%) Query: 61 MAVSWSGAKRGDDVLDLCCGSGDLAFLLSERVGSDGKVLISQGSNYWLLHLDNTCSQKSA 120 MAVSWSGAK G+ VLDLCCGSGDLAFLLSE+VGS+GKV+ S L + KS Sbjct: 1 MAVSWSGAKMGETVLDLCCGSGDLAFLLSEKVGSNGKVIGLDFSKEQLSVASSRQKLKSK 60 Query: 121 TKTLSEHWWIEGDATKLPFSDCSFDAITMGYGLRNVLDRGKAMQEMFRVLKPGSRVSILD 180 L+ W +EGDAT+LPFSD FDAITM YGLRNV+D+ KAM+E+FRVLK GSRVSILD Sbjct: 61 ACYLNIEW-VEGDATELPFSDGHFDAITMAYGLRNVVDKHKAMEEIFRVLKAGSRVSILD 119 Query: 181 FNKSTKPSI 189 FNKST P + Sbjct: 120 FNKSTNPIV 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv19366264 (356 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv32155 (86 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv44223 (263 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv6766262 (451 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv351 (286 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig24121 168 8e-44 >Contig24121 Length = 439 Score = 168 bits (426), Expect = 8e-44, Method: Compositional matrix adjust. Identities = 85/258 (32%), Positives = 145/258 (56%), Gaps = 8/258 (3%) Query: 23 FDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPN 82 ++IG+ +G G F V AR + VALK+L K ++ + ++ Q++RE+E ++HPN Sbjct: 13 YEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKLIKHPN 72 Query: 83 ILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHV 142 +++LY + ++++++E+ GEL+ ++ E A Y L A+ YCH + V Sbjct: 73 VVQLYEVMGSKTKIFIVMEFVTGGELFDKIVNNGRMKEDEARRYFQQLINAVDYCHSRGV 132 Query: 143 IHRDIKPENLLVGAQGELKIADFGWSVHTFNRR-----RTMCGTLDYLPPEMVESVEHD- 196 HRD+KPENLL+ A G LK++DFG S + R T CGT +Y+ PE++ +D Sbjct: 133 YHRDLKPENLLLDAYGNLKVSDFGLSALSQQVRDDGLLHTTCGTPNYVAPEVLNDRGYDG 192 Query: 197 ASVDIWSLGVLCYEFLYGVPPFEAKEHSDTYRRIVQVDLKFPPKPIVSSTAKDLISQMLV 256 A+ D+WS GV+ + L G PF+ + Y++I + P P +S A LI+++L Sbjct: 193 ATADLWSCGVILFVLLAGYLPFDDSNLMNLYKKISAAEFTCP--PWLSFGAMKLIARILD 250 Query: 257 KDSSQRLPLHKLLEHPWI 274 + R+ + ++LE W Sbjct: 251 PNPMTRVTIAEILEDEWF 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Vv2430 (265 letters) Database: apple.as.orf 1580 sequences; 349,985 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig25482 303 2e-84 >Contig25482 Length = 263 Score = 303 bits (777), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 143/180 (79%), Positives = 162/180 (90%) Query: 85 PQESLSRHKYTNDCESAINEQINVEYNVSYAYHAMYAYFDRDNVALKGLANFFKESSLEE 144 PQ SL+R +YT++ E+AINEQINVEYNVSY YHA++AYFDRDNVALKGLANFFKESS EE Sbjct: 83 PQVSLARQRYTDESEAAINEQINVEYNVSYVYHALFAYFDRDNVALKGLANFFKESSEEE 142 Query: 145 REHAEKLMEYQNKRGGKVKLQSILMPHSEFDHPEKGDALHAMELALSLEKLTNEKLLHLH 204 REHAEKLMEYQNKRGG+VKL S++ +EFDH EKGDAL+AMELALSLEKLTNEKLL+LH Sbjct: 143 REHAEKLMEYQNKRGGRVKLHSVIAAPTEFDHAEKGDALYAMELALSLEKLTNEKLLNLH 202 Query: 205 SIADRSNDPQLADFIESEFLIEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLNGGVVA 264 +AD++NDPQL DFIESEFL EQVEAIKKI++YV QLRRVGKGHGVWHFDQ LL+ G A Sbjct: 203 KVADQNNDPQLMDFIESEFLAEQVEAIKKIADYVTQLRRVGKGHGVWHFDQYLLHEGDAA 262 Database: apple.as.orf Posted date: Mar 27, 2017 5:36 AM Number of letters in database: 349,985 Number of sequences in database: 1580 Lambda K H 0.323 0.131 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1580 Number of Hits to DB: 243,747,271 Number of extensions: 10011361 Number of successful extensions: 29975 Number of sequences better than 1.0e-10: 1481 Number of HSP's gapped: 28073 Number of HSP's successfully gapped: 1665 Length of database: 349,985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 135 (56.6 bits)