BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226787194 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1499 59 1e-11 >Contig1499 Length = 227 Score = 58.9 bits (141), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 11/126 (8%) Query: 14 VKGTINFVQEGDGPTTVTGCISGLKPGLHGFHVHAFGDTTNGCLSTGPHFNPNGKEHGAP 73 V G + F Q + SGL PG HG+ ++ FGD T G STG F+P+ + P Sbjct: 82 VFGVVRFAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAASTGKVFDPSTEGVNEP 141 Query: 74 EDEDRHAGDLGNVTVGDDGTATFTLIDKQIPLTGPHSVIGRAVVVHG--DPDDLGKGGHE 131 GDLG + ++ A FT + +++ + P +IGR++ V+G D D G Sbjct: 142 ------LGDLGTLDTDENRNAFFTGVKEKLRV--PE-LIGRSIAVYGTADKSDSGVAAAV 192 Query: 132 LSKSTG 137 +++S G Sbjct: 193 IARSAG 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5230 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14690 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19941 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27558 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226776838 (55 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32014 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4537 530 e-153 >Contig4537 Length = 586 Score = 530 bits (1365), Expect = e-153, Method: Compositional matrix adjust. Identities = 248/282 (87%), Positives = 270/282 (95%) Query: 1 MGQFEDCIKDCEKAVERGRELRSDFKMIAKALTRKGTAYVKMAKCSKDFEPAIESFQKAL 60 MGQ++DCIKDC+KAVERGRE+R+DFKMIAKALTRKGTA K AK SKD+EPAIE FQKAL Sbjct: 305 MGQYDDCIKDCDKAVERGREVRADFKMIAKALTRKGTAIAKTAKTSKDYEPAIEIFQKAL 364 Query: 61 TEHRNPDTLKKLNDAEKAKKDLEQQEYYDPKLADEEREKGNEYFKQQKYPEAIKQYTEAL 120 TEHRNPDTLKKLNDAEKAKKDLEQQEY+DPKLADEEREKGNE+FKQQKYPEAI+ YTEAL Sbjct: 365 TEHRNPDTLKKLNDAEKAKKDLEQQEYFDPKLADEEREKGNEFFKQQKYPEAIRHYTEAL 424 Query: 121 RRNPKDPKAYSNRAACYTKLGAMPEGLKDAEQCIELDPTFAKGYTRKGAVQFFMKEYEKA 180 RRNPKDPKAYSNRAACYTKLGAMPEGLKDAE+CIELDPTF+KGYTRKG VQ+FM+EYEKA Sbjct: 425 RRNPKDPKAYSNRAACYTKLGAMPEGLKDAEKCIELDPTFSKGYTRKGTVQYFMREYEKA 484 Query: 181 LETYQEGLKHNPSNQELLDGVRRCVEQINKASRGDLSPEELKERQAKGMQDPEVQNILQD 240 LETYQEGLKH+P NQ+LLDGVR+CVEQINKASRGDLS +ELKERQ KGMQDPE+QNIL D Sbjct: 485 LETYQEGLKHDPGNQDLLDGVRKCVEQINKASRGDLSADELKERQTKGMQDPEIQNILSD 544 Query: 241 PVMRQVLTDFQENPKAAQEHTKNPMVMSKIQKLVSAGIVQLR 282 PVMRQVL DFQENPKAAQEH+KNPMVM+KIQKLVSAGIVQ++ Sbjct: 545 PVMRQVLVDFQENPKAAQEHSKNPMVMAKIQKLVSAGIVQIK 586 Score = 88.2 bits (217), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 56/200 (28%), Positives = 97/200 (48%), Gaps = 16/200 (8%) Query: 92 LADEEREKGNEYFKQQKYPEAIKQYTEALRRNPKDPKAYSNRAACYTKLGAMPEGLKDAE 151 +ADE + KGN + Y AI +TEA+ P + YSNR+A Y L + L DA+ Sbjct: 1 MADEAKAKGNAAYSAGDYEAAITHFTEAINLAPTNHVLYSNRSASYASLNRYSDALSDAK 60 Query: 152 QCIELDPTFAKGYTRKGAVQFFMKEYEKALETYQEGLKHNPSNQELLDGVRRCVEQINKA 211 + +EL P + KGY+R GA + +++ A+ Y +GL+ +P+N L + + ++A Sbjct: 61 KTVELKPDWVKGYSRLGAAHHGLAQFDDAVSAYNKGLEIDPNNAALKEALAESKSARDRA 120 Query: 212 SR------------GD-LSPEELKERQAKGMQDPEVQNILQDPVMRQVLTDFQENPKAAQ 258 + GD S ++ AK DP + +Q P ++ + Q+NP Sbjct: 121 AARASRPPPSSNPFGDAFSGPQM---WAKLTADPSTRAFMQQPDFVSMMQEIQKNPTNLN 177 Query: 259 EHTKNPMVMSKIQKLVSAGI 278 + K+ VM + L++ + Sbjct: 178 LYLKDQRVMQALGVLLNVKL 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91038911 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91030313 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4047 205 9e-56 >Contig4047 Length = 175 Score = 205 bits (521), Expect = 9e-56, Method: Compositional matrix adjust. Identities = 101/125 (80%), Positives = 110/125 (88%) Query: 1 MEEVEEANKTAVESCHRVLSLLSQPQEQVQYRNLTVETGKAVSRFKKVVSILNTGLGHAR 60 MEEVEEANK AV SCHRVLSLLSQPQ++VQ+RNL VETGKAV RFKKVVS+LNTGLGHAR Sbjct: 1 MEEVEEANKAAVASCHRVLSLLSQPQDRVQFRNLEVETGKAVFRFKKVVSLLNTGLGHAR 60 Query: 61 VRKLKKLQIPFPERILLDNPISIADRPSKTPHFLQSSFPENPTQDLSLDVKSALCLGNPS 120 VRKLKKLQIPFPE +LLDNP D SKTPHFLQS F ENP+QDLSL V+++L LGNPS Sbjct: 61 VRKLKKLQIPFPESVLLDNPNCTTDHHSKTPHFLQSRFAENPSQDLSLGVRNSLSLGNPS 120 Query: 121 LELST 125 LELST Sbjct: 121 LELST 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10241 (311 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4306 219 2e-59 >Contig4306 Length = 275 Score = 219 bits (558), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 105/199 (52%), Positives = 140/199 (70%), Gaps = 2/199 (1%) Query: 94 EDMKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCPSTILGFQPGEAFIVR 153 E +K F+ F+ K+ ++++ Y LA GQ+PKFMV +C+DSRVCPS IL FQPGEAF+VR Sbjct: 69 EKLKSGFVHFRTEKFEKDVDLYGKLATGQSPKFMVFACSDSRVCPSHILNFQPGEAFVVR 128 Query: 154 NIANLVPSLESGP-SETNAALEFSVNSLKVENILVVGHSCCGGIRALMSM-DDEIEKSSF 211 NIAN+VP ++ S AA+E++V LKVENI+V+GHSCCGGI+ LMS+ DD S F Sbjct: 129 NIANMVPPFDTTKHSGVGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASDF 188 Query: 212 IQNWVVVGKDARSWTKAAASTLSFDQQCKHCEKESINRSLLNLLTYPWIEEKVKQGVLAV 271 I+NWV + A++ K++ LSF QC EKE++N SL NLLTYP++ E V LA+ Sbjct: 189 IENWVQICAPAKNKIKSSCGDLSFADQCTSLEKEAVNVSLGNLLTYPFVREAVVNNTLAL 248 Query: 272 HGGYYDFVECTFEKWTLDY 290 GG+YDFV FE W LD+ Sbjct: 249 KGGHYDFVGGGFELWDLDF 267 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14919 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89544682 125 6e-32 >89544682 Length = 225 Score = 125 bits (313), Expect = 6e-32, Method: Compositional matrix adjust. Identities = 56/78 (71%), Positives = 65/78 (83%) Query: 1 MKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCPSTILGFQPGEAFIVRNI 60 MK RFL FK K++ EH+QNLA+ Q PKFMVI+CADSRVCPS ILGFQPGEAF++RN+ Sbjct: 81 MKDRFLSFKKQKFLRESEHFQNLAQVQDPKFMVIACADSRVCPSNILGFQPGEAFMIRNV 140 Query: 61 ANLVPSLESGPSETNAAL 78 ANLVP E+G SETNAAL Sbjct: 141 ANLVPPFENGASETNAAL 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18766 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13308 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3144 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823645 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23118 (290 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2099 192 2e-51 >Contig2099 Length = 263 Score = 192 bits (488), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 107/209 (51%), Positives = 130/209 (62%), Gaps = 9/209 (4%) Query: 72 WYGPDRRIFLPSGLLDRSEIPEYLTGEVPGDYGYDPFGLGKKPEDFSKYQAYELIHARWA 131 WYGPDR +L E P YLTGE PGDYG+D GL PE F+K + E+IH+RWA Sbjct: 47 WYGPDRVKYLGP---FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWA 103 Query: 132 MLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPIN---LIFXXXXX 188 MLGA G + PE + G G EAVWFK GA + L+Y G ++ ++ Sbjct: 104 MLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQ 162 Query: 189 XXXXXXXXYYRITNGL--ELEDKLHPGGPFDPLGLAKDPDQAALLKVKEIKNGRLAMFSM 246 YRI G E+ED L+PGG FDPLGLA DP+ A LKVKE+KNGRLAMFSM Sbjct: 163 VVLMGAVEGYRIAGGPLGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSM 222 Query: 247 LGFFLQAYVTGEGPVENLSKHLSDPFGNN 275 GFF+QA VTG+GP+ENL+ HL+DP NN Sbjct: 223 FGFFVQAIVTGKGPLENLADHLADPVNNN 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748222 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9124 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7379 (589 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17732 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7542 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9154 (270 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig788 279 1e-77 >Contig788 Length = 267 Score = 279 bits (713), Expect = 1e-77, Method: Compositional matrix adjust. Identities = 129/151 (85%), Positives = 144/151 (95%) Query: 86 SPFAALVPSVFPPGTDPNVIACFQLADQDGSGFIDDKEMQRALSSYNQSFSLRTVHLLMY 145 SPFAALVPS FPPGTDPNV+ACFQ+ADQDGSGFIDDKE+Q+ALSSYNQSFS+RTVHLLMY Sbjct: 105 SPFAALVPSSFPPGTDPNVVACFQIADQDGSGFIDDKELQKALSSYNQSFSMRTVHLLMY 164 Query: 146 LFTQTNTRKIGPKEFAALFYSLQSWRGVFERFDRDRSGFIDANELRDALLSLGFAVSPVV 205 LFTQ+N+RKIGPKEF A+FYSLQ+WRG+FE+FDRDRSG ID+NELRDAL SLGF+VSP V Sbjct: 165 LFTQSNSRKIGPKEFTAVFYSLQNWRGIFEKFDRDRSGKIDSNELRDALGSLGFSVSPAV 224 Query: 206 LELLVSKFDKTGGKKRAIEYDNFIECCLTVK 236 L+LLVSKFDKTGG +AIEYDNFIECCLTVK Sbjct: 225 LDLLVSKFDKTGGHMKAIEYDNFIECCLTVK 255 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12568 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 105 2e-25 >Contig1161 Length = 148 Score = 105 bits (262), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 54/143 (37%), Positives = 79/143 (55%) Query: 13 KQLAKELKSLDESPPEGIKVGVNDDDFSIIYADIEGPAGTPYENGVFRMKLLLSWDFPHS 72 K++ KELK L + PP G +D A I GP +PY GVF + + D+P Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFK 63 Query: 73 PPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLIEPFPESALNEQA 132 PPK F TK+FHPNI +NG IC++ LK+ W+P+L + VL+ + LL +P P+ L + Sbjct: 64 PPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 123 Query: 133 GKMLLENYEEYARHARLYTGIHA 155 M + +Y AR +T +A Sbjct: 124 AHMYKTDRSKYETTARSWTQKYA 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21036 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25724 (190 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21854 (425 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13448 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414170 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12282 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29681 (323 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4715 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3566 169 5e-45 >Contig3566 Length = 175 Score = 169 bits (429), Expect = 5e-45, Method: Compositional matrix adjust. Identities = 86/156 (55%), Positives = 110/156 (70%), Gaps = 8/156 (5%) Query: 11 KKVMVAIDESEFSLYAFNWALENLRETIQS-SQLVVFTAQP-----IDFASTYAAS--YG 62 K VMVA+DESE S YA W ++NL+E+I + S L++F AQP I FA+ ++ Y Sbjct: 16 KPVMVAVDESECSHYALMWVIDNLKESINTNSPLLIFMAQPPPANNITFAAPLGSARMYC 75 Query: 63 AAPAQLVTSLLENHKKVALALLERAKEICAKHGIVPETVTEVGDPKVVICEAVEKHNIQL 122 + ++ ENH+K+ ALLERAK+ICA HG+ +TVTE+GD K IC AV KHN++L Sbjct: 76 PPTPEFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEIGDAKTAICAAVLKHNVKL 135 Query: 123 LVLGSHGRGGIQRAFLGSVSNYCVHNAKCPVLVVRK 158 LVLG G G I+RA LGSVSNYCV NAKCPVLVV+K Sbjct: 136 LVLGERGLGKIKRAILGSVSNYCVLNAKCPVLVVKK 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25624 (273 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10279 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig561 110 1e-27 >Contig561 Length = 371 Score = 110 bits (276), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 1/76 (1%) Query: 1 MAMEGSAIGFEGYEKRLEIAFFEPSIFLDPEGRGLRSLSKAQIDEFLEQAECTIVSSLSN 60 MA+ SAIGFEGYEKRLE+ FFEP +F DP+G GLRSLS+AQI+E L AECTIVSSL N Sbjct: 1 MAVPVSAIGFEGYEKRLEVCFFEPGLFADPKGMGLRSLSRAQINEILNPAECTIVSSLLN 60 Query: 61 DNVDSYVLXESSSLFI 76 D++DSYVL E SSLF+ Sbjct: 61 DDLDSYVLSE-SSLFV 75 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91042338 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8369 (469 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 74 1e-15 >Contig3037 Length = 313 Score = 74.3 bits (181), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 1/100 (1%) Query: 15 TWSQEEDDILRNQISTHGTENWAIIASKFKD-KTTRQCRRRWYTYLNSDFKKGGWSPEED 73 W++EED L + I HG W + + + + CR RW YL D K+G ++ EED Sbjct: 16 AWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTEEED 75 Query: 74 MLLCEAQKIFGNRWTEIAKVVSGRTDNAVKNRFSTLCKKR 113 L+ + + GN+W+ IA + GRTDN +KN ++T K++ Sbjct: 76 ELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRK 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46424661 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31777 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9947 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31437 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10162 (552 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3389 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4661 229 2e-62 >Contig4661 Length = 251 Score = 229 bits (583), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 121/233 (51%), Positives = 148/233 (63%), Gaps = 12/233 (5%) Query: 44 GRKLRVRSFT-ATKGSSSSFTVRAAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLS 102 G+ R +F T S+SSF V A + W PG P +L GSLPGD GFDPL L+ Sbjct: 28 GKLTREVAFRPVTSPSASSFKVEAKKGE-----WLPGLPSPGYLTGSLPGDNGFDPLALA 82 Query: 103 SDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLF 162 DP++LKW QAELV+ RWAMLG AG+ +PE LT IGI+N P WY AG+ EYF ++TLF Sbjct: 83 EDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIGIINVPKWYDAGKAEYFASSSTLF 142 Query: 163 VVELVLIGWAEGRRWADILKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEK 222 V+E +L + E RRW DI PGSVN DPIF L +VGYPGG+ F+PL + Sbjct: 143 VIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNFAP----- 196 Query: 223 IKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFASF 275 +E + KEI NGRLAMLA +G QH TG GP DNL HL+DP H TI + Sbjct: 197 TEEAKEKEIANGRLAMLAFLGFVVQHNVTGKGPFDNLVQHLSDPWHNTIVQTL 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91002989 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26624 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19021 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16810 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9402 (328 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15149 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5466 119 4e-30 >Contig5466 Length = 121 Score = 119 bits (299), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 53/112 (47%), Positives = 79/112 (70%) Query: 7 FKQEFSFDERLEESKSIIAKYPDRVPVIIERYSRTDLPEMEKKKFLVPRDMSVGQFIHIL 66 FK++ + + R E+ I KYP+RVPVI+E+ ++D+P+++KKK+LVP D++VGQF +++ Sbjct: 8 FKKQHALERRKAEALRIREKYPERVPVIVEKAVKSDVPDIDKKKYLVPADLTVGQFGYVV 67 Query: 67 SSRLHLTPGKALFVFVKNTLPQTAGRLDSIYETYKEDDGFLYMCYSSEKTFG 118 R+ L KA+F FV N LP A + +IYE K++DGFLYM YS E FG Sbjct: 68 RKRIKLGAEKAIFTFVNNVLPPQAALMSAIYEDNKDEDGFLYMTYSGENAFG 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26201 (339 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21994 (571 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13025 (290 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9578 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25993 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158354686 251 2e-69 >158354686 Length = 217 Score = 251 bits (641), Expect = 2e-69, Method: Compositional matrix adjust. Identities = 118/161 (73%), Positives = 129/161 (80%) Query: 1 MSFSFFKPSRPKTPQEVAKAINDSLSALDTQTXXXXXXXXXXXXXXXXNFTTMKCLLSGD 60 MSFSFFKPSRPKTPQEVAKAI+DSLSALD+QT NF M+C+L GD Sbjct: 1 MSFSFFKPSRPKTPQEVAKAISDSLSALDSQTVAEVKSLEKALEEVEKNFGIMRCMLVGD 60 Query: 61 GETEPNMDQVSQLALEICKEGVFDLLIHKLPILGWEARKDLVHCWSILMKQKVELTYCCA 120 GETE N +QVSQL EICKE V LL+HKLPILGWEARKDLVHCWSIL+KQKVE T+CC Sbjct: 61 GETEANTEQVSQLVFEICKEDVLALLVHKLPILGWEARKDLVHCWSILLKQKVEDTFCCE 120 Query: 121 EYMENHLELLDFLVVCYDNKEIALNCGSMLRDCIRFPALAK 161 +Y+ENH ELLDFLV YDNKEIALNCG+MLRDCIRFP LAK Sbjct: 121 QYIENHYELLDFLVASYDNKEIALNCGAMLRDCIRFPTLAK 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14204 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20845 (357 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28074 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48415811 (61 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27514 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20836 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5849 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49630969 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21241 (531 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990436 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29054 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4678 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14885 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18640 (328 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990659 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925542 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22158 (438 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3256 (523 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71819132 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21057 (446 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25765 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2984 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30550 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30199 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29839 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9815 (530 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6578 (273 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48281431 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18747 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2535 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265691 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31509 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418557 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21116 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486818 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8716 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32739 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226797885 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11372 (541 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 178 6e-47 >Contig1666 Length = 421 Score = 178 bits (452), Expect = 6e-47, Method: Compositional matrix adjust. Identities = 84/156 (53%), Positives = 104/156 (66%), Gaps = 1/156 (0%) Query: 5 SMNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTTD 64 S SL GFRF PTD EL+ YYL+ K+ G + I +D+ K EPWDLP S +++ D Sbjct: 5 SSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLKSRD 64 Query: 65 PEWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQIKSDKILIGMKKTLVFHIGRAPKG 124 EW+FF DRKY N R NRAT +GYWK TGKDR + +GMKKTLVFH GRAPKG Sbjct: 65 TEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHSSRAVGMKKTLVFHSGRAPKG 124 Query: 125 KRTNWVMHEYRATQKELDGTN-PGQSSFVLCRLFKK 159 RTNWVMHEYR +EL+ + ++VLCR+F+K Sbjct: 125 ARTNWVMHEYRLDNQELEKAGIVEKDAYVLCRIFQK 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48694241 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48402402 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48275638 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21155 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5847 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25185 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71923032 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3769 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7018 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3034 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2549 340 4e-96 >Contig2549 Length = 341 Score = 340 bits (872), Expect = 4e-96, Method: Compositional matrix adjust. Identities = 160/219 (73%), Positives = 184/219 (84%), Gaps = 1/219 (0%) Query: 1 MAPPEVPADVLQATSNSTTTGYSKRAFVTFLAGDADYVKGVVGLAKGLRKVKSEYSLVVA 60 MAP VPA V ++T+ + +RA+VTFLAG+ DYVKGVVGLAKGLRKV + Y LVVA Sbjct: 1 MAPELVPA-VPKSTALTRPATLPRRAYVTFLAGNGDYVKGVVGLAKGLRKVNTAYPLVVA 59 Query: 61 ILPDVPEEHREILRSQGCIVQEIEPIYPPENQIKFAMAYYVINYSKLRIWNFEEYSKMIY 120 +LPDVPE+HR IL SQGCIV+EIEP+YPPENQ +FAMAYYVINYSKLRIW F EY KMIY Sbjct: 60 VLPDVPEDHRRILESQGCIVREIEPVYPPENQTQFAMAYYVINYSKLRIWEFVEYDKMIY 119 Query: 121 LDADIQVYENIDHLFATPNGYFYAVMDCFCEKTWSHSPQHKIGYCQQCPDKVSWPADMGS 180 LD DIQVY+NIDHLF P+G FYAVMDCFCEKTWSH+PQ+KIGYCQQCP++V W ++G Sbjct: 120 LDGDIQVYDNIDHLFDLPDGNFYAVMDCFCEKTWSHTPQYKIGYCQQCPERVKWDFELGP 179 Query: 181 PPPLYFNAGMFVFEPSRLTYNSLLQTLQVVPPTPFAEQE 219 PP LYFNAGMFVFEPS LTY LL+TL+V P TPFAEQ+ Sbjct: 180 PPSLYFNAGMFVFEPSVLTYQDLLKTLRVAPTTPFAEQD 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24077 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16052 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17893 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28515 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22665 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10941 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21867 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7890 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6285 (393 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4725 751 0.0 >Contig4725 Length = 393 Score = 751 bits (1938), Expect = 0.0, Method: Compositional matrix adjust. Identities = 361/393 (91%), Positives = 373/393 (94%) Query: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLTQDPDSKVACETCTKTNMVMVFGEITTK 60 METFLFTSESVNEGHPDKLCDQISDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTK Sbjct: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTK 60 Query: 61 ANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFSKRPEEIGA 120 ANVDYEKIVRDTCR IGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHF+KRPEEIGA Sbjct: 61 ANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGA 120 Query: 121 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTIEYFNDK 180 GDQGHMFGYATDETPELMPL+HVLATKLGAKLTEVRKNGTCAWLRPDGKTQVT+EY N+ Sbjct: 121 GDQGHMFGYATDETPELMPLSHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTVEYHNEG 180 Query: 181 GAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 GAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPV+PEKYLDEKTIFHLNPSGRFVI Sbjct: 181 GAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVVPEKYLDEKTIFHLNPSGRFVI 240 Query: 241 GGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 GGPHGDAGLTGRKIIIDTY KDPTKVDRSGAYIVRQAAKSIVANGLAR Sbjct: 241 GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 Query: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKETFDFRPGMISINLDLKRGGNG 360 R +VQVSYAIGVPEPLSVFV++YGTGKIPDKEILKIVKE FDFRPGMI+INLDLKRGGN Sbjct: 301 RALVQVSYAIGVPEPLSVFVETYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNK 360 Query: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393 RFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQ+ Sbjct: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQS 393 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 149780162 (363 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5998 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158352771 156 3e-41 >158352771 Length = 100 Score = 156 bits (394), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 83/107 (77%), Positives = 87/107 (81%), Gaps = 7/107 (6%) Query: 1 MAMAKLVCFXXXXXXGISMAATQVMAKEQARNQLDSGGYGPGSLKSYQCPSQCTRRCSQT 60 MAMAKL+C GISMAA + + LDS YGPGSLKS QCPSQCTRRCS+T Sbjct: 1 MAMAKLLCLLLLALLGISMAA-------ETQYHLDSARYGPGSLKSSQCPSQCTRRCSKT 53 Query: 61 QYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP 107 QYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP Sbjct: 54 QYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP 100 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20464 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9001 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23297 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210147015 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4974 65 1e-13 >Contig4974 Length = 423 Score = 64.7 bits (156), Expect = 1e-13, Method: Composition-based stats. Identities = 36/101 (35%), Positives = 53/101 (52%), Gaps = 2/101 (1%) Query: 1 KPHTLFKRDGNDLTITQKISLAEALTGYTAQLTTLDGRNLTVPIT--NIISPTYEEVVKG 58 K H FKR +DL + +SL +AL G+ L LDGR L + ++ P + V Sbjct: 264 KEHPKFKRKMDDLFVEHSLSLTDALCGFQFVLNHLDGRQLLIKSNPGEVVKPDSFKAVND 323 Query: 59 EGMPIPKEPSKRGNLRIKFSIKFPTKLTSDQKSNIKRLLTS 99 EGMP+ + P +G L I FS+ FP L+ +Q ++ L S Sbjct: 324 EGMPMYQRPFMKGKLYIHFSVDFPETLSPEQVKALEAALPS 364 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12065 (328 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20463 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48279518 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20450 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 306 2e-86 >Contig1161 Length = 148 Score = 306 bits (785), Expect = 2e-86, Method: Compositional matrix adjust. Identities = 147/148 (99%), Positives = 148/148 (100%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRNKYETTARSWTQKYAMG 148 PEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRSKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263392 (55 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6519 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2426 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18072 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24889 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158365522 385 e-109 >158365522 Length = 211 Score = 385 bits (988), Expect = e-109, Method: Compositional matrix adjust. Identities = 184/190 (96%), Positives = 188/190 (98%) Query: 1 MEDGGVPKGTSSASLLKEAIHVISCGYEDKSEWGKEVGWIYGSVTEDILTGFKMHCHGWR 60 MEDGGVP GTSSASLLKEAIHVISCGYEDK+EWGKEVGWIYGSVTEDILTGFKMHCHGWR Sbjct: 22 MEDGGVPMGTSSASLLKEAIHVISCGYEDKTEWGKEVGWIYGSVTEDILTGFKMHCHGWR 81 Query: 61 SVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLKWLERFSY 120 SVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLK LERFSY Sbjct: 82 SVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLKSLERFSY 141 Query: 121 INSVVYPLTSIPLLAYCSLPAVCLLTGKFIVPEISNYASILFMALFLSIAATSILEMQWG 180 INSVVYPLTSIPL+AYCSLPAVCLLTGKFIVPEISNYASI+FMALFLSIAATS+LEMQWG Sbjct: 142 INSVVYPLTSIPLIAYCSLPAVCLLTGKFIVPEISNYASIIFMALFLSIAATSVLEMQWG 201 Query: 181 HVGIHDWWRN 190 HVGIHDWWRN Sbjct: 202 HVGIHDWWRN 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24501 (333 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16036 (366 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226750975 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783651 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23338 (512 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91045015 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743793 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9842 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15008 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig908 330 3e-93 >Contig908 Length = 216 Score = 330 bits (847), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 169/219 (77%), Positives = 186/219 (84%), Gaps = 3/219 (1%) Query: 1 MASASPMASQLKSNFTSPITTRPALLSPKGLSASPLKLFPSKRLSSFSIKAVQSDKQNFQ 60 MASA+PMASQLKS FTSP++ ALL+PKGLSASPLKLFPSKR SSF+IKA Q+DK FQ Sbjct: 1 MASAAPMASQLKSTFTSPVSR--ALLAPKGLSASPLKLFPSKRSSSFTIKATQTDKP-FQ 57 Query: 61 VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPFV 120 VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRG+EVGLAHG+LLVGPFV Sbjct: 58 VIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFV 117 Query: 121 KTGPLRNTPYXXXXXXXXXXXXVVILTLCLTIYGISSFKEGEPSSAPALTLTGRKKEPDQ 180 K GPLRNT VVIL++CLT+YGI+SFKEGEPS+AP+LTLTGRKKEPDQ Sbjct: 118 KAGPLRNTEVAGAAGSLAAAGLVVILSVCLTMYGIASFKEGEPSTAPSLTLTGRKKEPDQ 177 Query: 181 LQTAEGWSKXXXXXXXXXISGVTWAYFLLYVVNLPYFFK 219 LQTAEGW+K ISGVTWAYFLLYV+NLPY+ K Sbjct: 178 LQTAEGWAKFTGGFFFGGISGVTWAYFLLYVLNLPYYVK 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15454 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48262700 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8371 (374 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 201 4e-54 >Contig3037 Length = 313 Score = 201 bits (512), Expect = 4e-54, Method: Compositional matrix adjust. Identities = 85/128 (66%), Positives = 109/128 (85%) Query: 35 KTPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKQAGLLRCGKSCRLRWMNYLR 94 ++PCC K +G WT EED+ L +YI+ GEG WR+LPKQAGLLRCGKSCRLRW+NYLR Sbjct: 3 RSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLR 62 Query: 95 PSVKRGQIAPDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLSKKLISQGID 154 P +KRG +E++LI++LH LLGN+WSLIAGR+PGRTDNEIKNYWNTH+ +KL+++G+D Sbjct: 63 PDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRGLD 122 Query: 155 PRTHKPLN 162 P+TH+PLN Sbjct: 123 PQTHRPLN 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6945 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7236 (346 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418713 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9355 (475 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18180 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4660 68 1e-14 >Contig4660 Length = 151 Score = 68.2 bits (165), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 32/62 (51%), Positives = 42/62 (67%) Query: 8 SRLNPNAPLFIPAALRQVEDFSPEWWQLVTTSTWYHDYWLSQQGEDGFYDDTQNEVDNVA 67 S LNPNAP+F+P+A R VEDFS EWW LV +S W+ DYWL + D D ++V++ A Sbjct: 13 SSLNPNAPMFVPSAYRAVEDFSTEWWALVQSSPWFRDYWLQENFHDPQNDPFFSDVNDAA 72 Query: 68 DL 69 L Sbjct: 73 FL 74 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46601413 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27745 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283987 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6570 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7083 (374 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7180 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4218 219 7e-60 >Contig4218 Length = 191 Score = 219 bits (559), Expect = 7e-60, Method: Compositional matrix adjust. Identities = 104/175 (59%), Positives = 129/175 (73%), Gaps = 2/175 (1%) Query: 1 MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP 60 M+F GT QKC AC+KTVY V++L+AD +HK+CF+C HCKGTLKLSNY+S EGVLYC+P Sbjct: 1 MAFAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP 60 Query: 61 HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSP--SKAASMFSGTQDKCATCGKTAYPL 118 HF+QLFK TG+ +K+F+ K + P + P SKA+ MF GT+DKC C T YP Sbjct: 61 HFDQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAASKASGMFGGTRDKCFGCKNTVYPT 120 Query: 119 EKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHL 173 EKVTV YHK CFKC+HGGC I+PSNY A EG LYCKHH +QL +EKG+ + L Sbjct: 121 EKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHHTQLIREKGNLSQL 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31401 (310 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23254 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 109 2e-26 >158372667 Length = 230 Score = 109 bits (272), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 84/229 (36%), Positives = 117/229 (51%), Gaps = 23/229 (10%) Query: 54 YRAGIAEFIATFLFLYITILTVMGVVKSKSKCTTVGIQGIAWAFGGTIFALVYSTAGISG 113 +RA I EF+ TFLF++ + + M K + TTV + IA + A++ S ISG Sbjct: 18 WRALIVEFVTTFLFIFAGVGSAMATDKLGAD-TTVALFFIAITHA-LVVAVMISAGHISG 75 Query: 114 GHINPAVTFGLFLARKLSLTRAVFYIVMQTLGAIAGAAVVKGFEKSSTFELLGGGANSVN 173 GH+NPAVT GL ++L R+V Y + Q L A A ++K L GG + Sbjct: 76 GHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLK---------YLTGGLTTPI 126 Query: 174 HGYTKG----QGLGAEIIGTFVLVYTVFSA-TDAKRSARDSHVPILAPLPIGFAVFLVHL 228 H G QG+ EII TF L++TV++ D K+ + D L P GF V L Sbjct: 127 HSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDG----LGPTLTGFVVGANIL 182 Query: 229 ATIPVTGTGINPARSLGAAIIYNKRHAWDDHWIFWVGPFIGAALAALYH 277 A +G +NPARS G A++ W DHW++WVGP IG LA + Sbjct: 183 AGGAFSGASMNPARSFGPALV---SWDWTDHWVYWVGPLIGGGLAGFIY 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6839 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 110 6e-27 >158372667 Length = 230 Score = 110 bits (276), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 83/225 (36%), Positives = 118/225 (52%), Gaps = 15/225 (6%) Query: 54 YRAGIAEFIATFLFLYITILTVMGVVKSKSKCTTVGIQGIAWAFGGTIFALVYSTAGISG 113 +RA I EF+ TFLF++ + + M K + TTV + IA + A++ S ISG Sbjct: 18 WRALIVEFVTTFLFIFAGVGSAMATDKLGAD-TTVALFFIAITHA-LVVAVMISAGHISG 75 Query: 114 GHINPAVTFGLFLARKLSLTRAVFYIVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANSVA 173 GH+NPAVT GL ++L R+V Y + Q L A A ++K T + +S+A Sbjct: 76 GHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLKYLTGGLTTPI-----HSLA 130 Query: 174 HGYTKGQGLGAEIIGTFVLVYTVFSA-TDAKRSARDSHVPILAPLPIGFAVFLVHLATIP 232 G QG+ EII TF L++TV++ D K+ + D L P GF V LA Sbjct: 131 SGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDG----LGPTLTGFVVGANILAGGA 186 Query: 233 VTGTGINPARSLGAAIIYNKKHAWDDHWIFWVGPFIGAALAALYH 277 +G +NPARS G A++ W DHW++WVGP IG LA + Sbjct: 187 FSGASMNPARSFGPALV---SWDWTDHWVYWVGPLIGGGLAGFIY 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51237933 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28629 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22077 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14587 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31573 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 100 3e-24 >89552756 Length = 189 Score = 100 bits (250), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 61/159 (38%), Positives = 86/159 (54%), Gaps = 9/159 (5%) Query: 1 MALDAARGMNYLHNCTPVIVHRDLKSPNLLVD----RNWVVKVCDFGLSRMKNSTFLSSR 56 +A+DAA GM YLH IVH DLK NLLV+ + V K+ D GLS++K T +S Sbjct: 25 IAMDAAFGMEYLHGKN--IVHFDLKCENLLVNMRDPQRPVCKIGDLGLSKVKQQTLVSG- 81 Query: 57 STAGTAEWMAPEVL--RNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQH 114 GT WMAPE+L ++ EK DVYS+G+++WEL T +P+ M+ ++G + Sbjct: 82 GVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLTGDEPYTDMHCASIIGGIVNNT 141 Query: 115 RRXXXXXXXXXXXXXXXRKCWQTDPKLRPSFAEIMAILK 153 R CW ++P RPSF+EI L+ Sbjct: 142 LRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQKLR 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20380 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9938 (492 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5214 60 2e-11 >Contig5214 Length = 355 Score = 60.1 bits (144), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 2/104 (1%) Query: 279 LDLKPGQKVLDVGCGIGGGDFYMASNFDVEVIGIDLSVNMISFAL--EQSIGLKCAVEFE 336 +++KPGQ++LDVGCG+GG +A++ V+GI ++ + A + GL E Sbjct: 119 INVKPGQRILDVGCGVGGPMRAIAAHSRANVVGITINEYQVKRARLHNKKAGLDSLCEVV 178 Query: 337 VADCTKKTYPDNTFDVIYSRDTILHIQDKPALFRSFYEWLKPGG 380 + + +P+N+FD YS + H ++ + LKPG Sbjct: 179 CGNFLEMPFPENSFDGAYSIEATCHAPKLEEVYAEIFRVLKPGA 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6257 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121299 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25959 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55768772 (77 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4113 107 1e-26 >Contig4113 Length = 368 Score = 107 bits (267), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 53/71 (74%), Positives = 55/71 (77%) Query: 7 QDVQWLQTITSLPILVKGVLTAEDXXXXXXXXXXXXXXSNHGARQLDYVPSTIMALEKVV 66 +DVQWLQTIT LPILVKGVLTAED SNHGARQLDYVPSTIMALE+VV Sbjct: 215 KDVQWLQTITKLPILVKGVLTAEDARLSVQSGAAGIIVSNHGARQLDYVPSTIMALEEVV 274 Query: 67 KAAQGRIPCFL 77 KAAQGRIP FL Sbjct: 275 KAAQGRIPVFL 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12111 (588 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226782354 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32000 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9071 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29838 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11853 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7031 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226786909 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2976 122 6e-31 >Contig2976 Length = 136 Score = 122 bits (307), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 64/104 (61%), Positives = 69/104 (66%), Gaps = 4/104 (3%) Query: 20 HKPSAGAPSSTVLALPSLARKGRVSCSMEGK---KESNSNMA-KGGXXXXXXXXXXXXXX 75 HKPS GAPSST+LALPS+ KG++ CSME K KESNSN+ Sbjct: 20 HKPSVGAPSSTILALPSIGNKGKLRCSMEAKPPMKESNSNIGMSASLVAAALAATMSSPA 79 Query: 76 XXXLVDDRLSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFIYT 119 LVDDRLSTEGTGLPFGLSNNLLGWIL GVF LIW YF YT Sbjct: 80 AMALVDDRLSTEGTGLPFGLSNNLLGWILLGVFALIWTFYFTYT 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5682 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5093 280 6e-78 >Contig5093 Length = 250 Score = 280 bits (716), Expect = 6e-78, Method: Compositional matrix adjust. Identities = 151/223 (67%), Positives = 166/223 (74%), Gaps = 15/223 (6%) Query: 26 VIVMRKRGFSETESDISTD--ASTCVDLKLNLSNNSKETNSTGGKDGSAXXXXXXXXXXX 83 V++MRKR FSETES I+TD +S CVDLKLNLS SK+ +ST K S Sbjct: 30 VVMMRKRVFSETESQITTDDESSACVDLKLNLS--SKDGSSTAEKSKS---LMMNKNKEK 84 Query: 84 XLDFRASDXXXXXXXXXQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVK 143 +D A QVVGWPPVRSFRKNM +A + ST D ES+ + NA LVK Sbjct: 85 NVDLPAD--PAKPPAKAQVVGWPPVRSFRKNMLSAQKSSTTD-ESK-----AGGNAALVK 136 Query: 144 VSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGS 203 VSMDGAPYLRKVDL MYK+YP+LSDALAKMFSSFTIGNCGSQG DFMNERKLMD+LN S Sbjct: 137 VSMDGAPYLRKVDLNMYKTYPQLSDALAKMFSSFTIGNCGSQGTIDFMNERKLMDLLNDS 196 Query: 204 DYIPTYQDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLG 246 DYIPTY+DKDGDWMLVGDVPWEMFVESCKRLRIMK KEAVGL Sbjct: 197 DYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLA 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5936 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig258 165 2e-43 >Contig258 Length = 254 Score = 165 bits (417), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 97/228 (42%), Positives = 125/228 (54%), Gaps = 67/228 (29%) Query: 5 LNFKATELRLGLPGSSEEPENKKAAPSPPMAKNNKRASPDSAAEECSTSSDPIDV----- 59 +NF+ TELRLGLPG+ ++ + + S + KR ++ + + SS+ DV Sbjct: 21 INFEETELRLGLPGALKDGDQGVKSCS-----SGKRGFSETVDLKLNFSSENDDVSRSGR 75 Query: 60 -----------------PPTKTQVVGWPPIRSYRKNSLQLRE------------------ 84 P K QVVGWPP+RS+RKN + +++ Sbjct: 76 DGQVEIKKEKDASAAPAPRAKAQVVGWPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTSTS 135 Query: 85 -AYVKVSVDGAPYLRKIDLKVYNSYPELIKALEKMFNLANI------------------- 124 A+VKVS+DGAPYLRK+DLK+Y SY EL AL KMF+ I Sbjct: 136 AAFVKVSMDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGMKDFMNESKLID 195 Query: 125 --NGSDFAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIMKGSEARGLS 170 NGS++ P+YEDKDGDWMLVGDVPW MFV SCKRLRIMKGSEA GL+ Sbjct: 196 LLNGSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18903 (312 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9966 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4741 150 4e-39 >Contig4741 Length = 306 Score = 150 bits (380), Expect = 4e-39, Method: Compositional matrix adjust. Identities = 76/102 (74%), Positives = 83/102 (81%) Query: 1 MDPSDVKRARRMLXXXXXXXXXXXXKQAQMSELETQVGQLRVEHSGLLKRLTDVNQKYDN 60 MDP+DVKRARRML KQAQM++LETQ GQLRVE+S LLK+LTDVN KYDN Sbjct: 205 MDPADVKRARRMLSNRESARRSRRRKQAQMTDLETQAGQLRVENSALLKQLTDVNHKYDN 264 Query: 61 AAVDNRILRADIETLRAKVKMAEESVKRVTGINPLLLAMSNV 102 + VD RIL A+IETLRAKVKMAEESVKR TGINPLLLAMSNV Sbjct: 265 SVVDRRILEANIETLRAKVKMAEESVKRKTGINPLLLAMSNV 306 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5588 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27904 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814098 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6322 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7295 (679 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12743 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48274494 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263551 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2557 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24866 (313 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14336 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51095885 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19309 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20162 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28141 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10364 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89551566 358 e-101 >89551566 Length = 208 Score = 358 bits (919), Expect = e-101, Method: Compositional matrix adjust. Identities = 169/171 (98%), Positives = 169/171 (98%) Query: 24 TGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY 83 GKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY Sbjct: 8 AGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYY 67 Query: 84 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 143 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR Sbjct: 68 IHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 127 Query: 144 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQFDM 194 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQ DM Sbjct: 128 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDM 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26030 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24831 (317 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48487983 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29853 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5564 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10437 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3021 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8738 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46612315 (5 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25680 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71922057 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71819131 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12866 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 86591577 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25121 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6749 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7864 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8054 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6913 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9656 (171 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 158 1e-41 >89540794 Length = 177 Score = 158 bits (400), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 77/85 (90%), Positives = 83/85 (97%) Query: 1 MASAEIEFRCFVGGLAWATDNEALERAFSQYGEIIESKIINDRETGRSRGFGFVTFGSEQ 60 MASAEIEFRCFVGGLAWATDN+ALERAF+ +GEIIESKIINDRETGRSRGFGFVTF +E+ Sbjct: 1 MASAEIEFRCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEK 60 Query: 61 AMRDAIEGMNGQNLDGRNITVNEAQ 85 AMRDAIEGMNGQ+LDGRNITVNEAQ Sbjct: 61 AMRDAIEGMNGQDLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25486 (460 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14063 (580 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11077 (317 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1245 574 e-166 >Contig1245 Length = 358 Score = 574 bits (1479), Expect = e-166, Method: Compositional matrix adjust. Identities = 270/317 (85%), Positives = 289/317 (91%) Query: 1 MEEQVVQVLGSSHHVLSFARFAHRYGKKYESVEEMKLRYEIFLENKKLIRSTNRKGLSYT 60 +++Q VQVLG HV SFARFA RY KKYES+EEM+ R+EIF ENKKLIRSTNRKGLSY Sbjct: 42 LQDQFVQVLGHGCHVHSFARFAFRYEKKYESLEEMRRRFEIFAENKKLIRSTNRKGLSYK 101 Query: 61 LAVNRFADWSWEEFARHRLGAAQNCSATTKGNHKLTDAVLPESKNWKEEGIVTPVKDQGH 120 L VNRFADW+WEEF RHRLGAAQNCSATTKGNHKLTDAV P SKNW++EGIVTPVKDQGH Sbjct: 102 LGVNRFADWTWEEFQRHRLGAAQNCSATTKGNHKLTDAVPPLSKNWRDEGIVTPVKDQGH 161 Query: 121 CGSCWTFSTTGALEAAYVQAFGKQISLSEQQLVDCAGDFNNNGCNGGLPSQAFEYIKYNG 180 CGSCWTFSTTGALEAAY QAFGKQISLSEQQLVDCAG FNN GC+GGLPSQAFEY+KYNG Sbjct: 162 CGSCWTFSTTGALEAAYAQAFGKQISLSEQQLVDCAGAFNNFGCSGGLPSQAFEYVKYNG 221 Query: 181 GLDTEAAYPYVGVDGACKFSSENVGVQVVDSVNITLGAEEELKHAVAFVRPVSVAFQVVQ 240 GLDTE YPY DGACKFSSENVGVQV+DSVNITLG EE LKHAVAFVRPVS+AFQVV Sbjct: 222 GLDTEEGYPYTAKDGACKFSSENVGVQVLDSVNITLGDEEGLKHAVAFVRPVSIAFQVVS 281 Query: 241 SFRFYKSGVYTSDTCGSSSMDVNHAVLAVGYGVEDGVPFWLIKNSWGQSWGDNGYFKMEY 300 FR YKSGVYTS+TCG++ MDVNHAVLAVGYGVE+GVP+WLIKNSWGQSWGDNGYFKMEY Sbjct: 282 DFRLYKSGVYTSETCGNTPMDVNHAVLAVGYGVENGVPYWLIKNSWGQSWGDNGYFKMEY 341 Query: 301 GKNMCGVATCASYPVVA 317 GKNMCG+ATCASYPVVA Sbjct: 342 GKNMCGIATCASYPVVA 358 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16441 (288 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754158 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12583 (280 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2805 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2685 (53 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21182 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48389866 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595856 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265189 (68 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3052 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13812 (394 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32343 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10663 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3173 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46424042 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11014 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89551100 72 3e-15 >89551100 Length = 210 Score = 71.6 bits (174), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 43/157 (27%), Positives = 83/157 (52%), Gaps = 10/157 (6%) Query: 34 FILSSSADSTVRLWSTKLNANLVCYKGHNYP---VWDVQFSPVGHYFASASHDRTARIWS 90 + ++S D T+R W K CY+ YP V ++ +P + A+A + R++ Sbjct: 8 ILATASYDHTIRFWEAKGGR---CYRTIQYPDSQVNRLEITPDKRFLAAAGNPHI-RLFD 63 Query: 91 MDRIQPLRIMA--GHLSDVDCVQWHANCNYIATGSSDKTVRLWDVQTGECVRIFIGHRSM 148 ++ P +M+ H ++V V + + N++ +GS D TV++WD++ C R + R+ Sbjct: 64 VNSNSPQPVMSYDSHTNNVMAVGFQCDGNWMYSGSEDGTVKIWDLRAPGCQREY-ESRAA 122 Query: 149 VLSLAMSPDGRYMASGDEDGAIMMWDLSTGRCVTPLM 185 V ++ + P+ + SGD++G I +WDL+ C L+ Sbjct: 123 VNTVVLHPNQTELISGDQNGNIRVWDLTANSCSCELV 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6023 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20776 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4278 467 e-134 >Contig4278 Length = 257 Score = 467 bits (1202), Expect = e-134, Method: Compositional matrix adjust. Identities = 228/259 (88%), Positives = 247/259 (95%), Gaps = 2/259 (0%) Query: 1 MAATTGAVLNGLNSAAFLCGGKRSQALLSAATVGSKVGGASPTPKRFIVVAAAAKKSWIP 60 MAATTGA+LNGLNS FLCGGKRSQ+LLSA ++VGG+ PKRF+VVAAAAKKSWIP Sbjct: 1 MAATTGAMLNGLNST-FLCGGKRSQSLLSAGAA-ARVGGSVVAPKRFVVVAAAAKKSWIP 58 Query: 61 AVKGGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVG 120 AVKGGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAM AVVGIFVG Sbjct: 59 AVKGGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMTAVVGIFVG 118 Query: 121 QAWSGIPWFEAGADPSAISPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWS 180 QAWSG+PWF+AGADPSA++PFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWS Sbjct: 119 QAWSGVPWFQAGADPSAVAPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWS 178 Query: 181 KTSENFANSTGEQGYPGGKFFDPLGFAGSIQDGVYVPDSEKLERLKLAEIKHARLAMVAM 240 KT+ENF+N TGEQGYPGGKFFDPLG AG+I+DGVY+PD+EKLERL+LAEIKH+RLAM+AM Sbjct: 179 KTAENFSNFTGEQGYPGGKFFDPLGLAGTIKDGVYIPDTEKLERLQLAEIKHSRLAMLAM 238 Query: 241 LIFYFEAGQGKTPLGALGL 259 LIFYFEAGQGKTPLGALGL Sbjct: 239 LIFYFEAGQGKTPLGALGL 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14244 (369 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4974 111 5e-27 >Contig4974 Length = 423 Score = 111 bits (278), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 90/279 (32%), Positives = 133/279 (47%), Gaps = 16/279 (5%) Query: 74 GARFIVRAD-ADFYSVLGVSRNASKSEIKSAYRKLARSYHPDVNKEPGAETKFKEISNAY 132 G R ++D + +Y +LGVS+ AS ++K AY+K A HPD +P KFKE++ AY Sbjct: 4 GGRAPKKSDNSKYYEILGVSKTASPEDVKKAYKKAAIKNHPDKGGDP---EKFKELAQAY 60 Query: 133 EVLSDDEKRSLYDKYGEAGIKGAGMGTGDFSNPFDLFESLFEXXXXXXXXXXXXXXXXRG 192 EVLSD EKR +YD+YGE G+K G +PFD+F S Sbjct: 61 EVLSDPEKREIYDRYGEDGLKEEMQSGG--HDPFDIFSS----FFGGGGSPFGGMPGGSS 114 Query: 193 SRSRAVDGQDEYYNLVLNFKEAVFGVEKEIEISRLESCGTCNGSGAKPGTKASTCSTCGG 252 R G+D + L ++ ++ G K++ +SR C C G G+K G ++ C C G Sbjct: 115 RGRRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCKGKGSKSGA-STKCGGCQG 173 Query: 253 QGQVVQSARTPLGVFQQVM-TCSSCGGTGETSTP---CNTCSGDGRVRRTKRISLKVPAG 308 G V + QQ+ C+ C GTGET + C C G+ V K + + V G Sbjct: 174 TGMKVTIRHLGPSMIQQMQHACNECKGTGETISDKDRCGQCKGEKVVHEKKVLEVHVEKG 233 Query: 309 VDSGSRLRVRNEGNAGRRGGSPGDLFVIIDVISDPVLKR 347 + +G ++ E + + GD+ II P KR Sbjct: 234 MQNGQKITFPGEADEAPDTVT-GDIVFIIQQKEHPKFKR 271 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7194 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6720 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 84 7e-19 >Contig2005 Length = 422 Score = 83.6 bits (205), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 51/130 (39%), Positives = 74/130 (56%), Gaps = 12/130 (9%) Query: 9 TACVAILRNKQLFVANAGDSRCVISRKGQAYNLSRDHKPDLELEKERILKAGG---FIHA 65 TA VA++ +++ V+N GDSR V+ RKG A LS DHKPD E RI AGG + Sbjct: 237 TAVVAVVTPEKIIVSNCGDSRAVLCRKGAAVPLSSDHKPDRPDELLRIEAAGGRVIYWDG 296 Query: 66 GRVNGSLNLARAIGDMEFKQNKFLPDEKQIITACPDINTVELCDDDEFIVLACDGIWDCM 125 RV G L ++RAIGD +L K + + P++ ++ +DE ++LA DG+WD + Sbjct: 297 PRVLGVLAMSRAIGD------NYL---KPYVISEPEVTIMDRTAEDECLILASDGLWDVV 347 Query: 126 SSQQVVDFVR 135 S+ VR Sbjct: 348 SNDTACGVVR 357 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5669 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91027352 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15697 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11006 (402 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21532 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14904 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226751914 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1068 59 7e-12 >Contig1068 Length = 253 Score = 58.5 bits (140), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 27/38 (71%), Positives = 33/38 (86%) Query: 39 SLLVRNLRHDCRPEDLRGPFGRFGPLKDVYLPRDYYTG 76 SLLVRN+ DCRPE+LR PF RFG ++DVY+P+DYYTG Sbjct: 16 SLLVRNIPLDCRPEELRTPFERFGLVRDVYIPKDYYTG 53 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380225 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31677 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17858 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13301 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32324 (340 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5754 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9724 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8623 (321 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12008 (392 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8291 (342 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7292 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1557 103 7e-25 >Contig1557 Length = 209 Score = 103 bits (258), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 56/76 (73%), Positives = 59/76 (77%), Gaps = 1/76 (1%) Query: 1 MGEKEKVTIMVLKVDLGCHXXXXXXXXXXXXFPQIRDQIYDEKQNQVVIKVVCCSPEKIR 60 MGEK KVTIMVLKVDL C FPQIRDQ YDEK NQV+IKVVCCSPEKIR Sbjct: 1 MGEK-KVTIMVLKVDLQCEKCYKKVKKVLCKFPQIRDQTYDEKNNQVIIKVVCCSPEKIR 59 Query: 61 DKICCKGGGAIKSIEI 76 DK+CCKGGGAIKSI+I Sbjct: 60 DKLCCKGGGAIKSIDI 75 Score = 60.8 bits (146), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 36/74 (48%), Positives = 39/74 (52%), Gaps = 18/74 (24%) Query: 190 VNACCMDCYQXXXXXXXXXXXXXXXXXXIQYDGY-YGRPVYDSYGGG----NRSYCVTRP 244 V+ CCMDCY GY YG PVYDSYGGG SYC+TRP Sbjct: 149 VSECCMDCYGGHPGGPCQT-------------GYGYGGPVYDSYGGGRSYATSSYCMTRP 195 Query: 245 DCFSEENPSACTVM 258 DCF EENP AC +M Sbjct: 196 DCFGEENPQACAIM 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26979 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19649 (389 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5090 (224 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20048 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22793 (406 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1484 344 6e-97 >Contig1484 Length = 242 Score = 344 bits (882), Expect = 6e-97, Method: Compositional matrix adjust. Identities = 161/243 (66%), Positives = 196/243 (80%), Gaps = 1/243 (0%) Query: 164 MGDVLIGGKPTGFCAGGCFAIADXXXXXXXXXXXXXXKINQAIGASGVVSQECKAVVNQY 223 MGDVLI GK TGFCAGGC AIAD ++N AIGA+G+VSQECK VV +Y Sbjct: 1 MGDVLIDGKTTGFCAGGCAAIADSGTSLLVGPTTIITELNHAIGATGIVSQECKTVVAEY 60 Query: 224 GRTILDLLVAHEVQPKKVCSQIGVCTFDGTRSVSMGIESVVDEKNGKSSGILHDASCSAC 283 G TI+ +++A + QP+K+CSQIG+CTFDGTR VS+GI+SVVDE N KSS L DA CSAC Sbjct: 61 GDTIIKMILAKD-QPQKICSQIGLCTFDGTRGVSVGIKSVVDENNHKSSAGLSDAMCSAC 119 Query: 284 EMAVVWMQNELKKNITQDRILNYVNELCEKMPDTLGQSTVDCGKLSSMPPVSFTIGGRAF 343 EM VVWMQN+LK+N TQDRIL+YVN+LC+++P +G+S VDC LSSMP VSFTIGG+ F Sbjct: 120 EMTVVWMQNQLKQNQTQDRILDYVNQLCDRLPSPMGESAVDCAGLSSMPSVSFTIGGKQF 179 Query: 344 KLTSDEYILKVGEGAQAQCISGFTSLDIPRPRGPLWILGDIFMGRYHTVFDYGKMRVGFA 403 L ++Y+LKVGEG AQCISGFT+LD+P PRGPLWILGD+FMG+YHTVFD+GK R+GFA Sbjct: 180 DLAPEQYVLKVGEGEVAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVFDFGKERIGFA 239 Query: 404 DAA 406 +AA Sbjct: 240 EAA 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32840 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743283 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32423 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12536 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18148 (365 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2897 (435 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8750 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3762 256 1e-70 >Contig3762 Length = 261 Score = 256 bits (654), Expect = 1e-70, Method: Compositional matrix adjust. Identities = 129/236 (54%), Positives = 163/236 (69%), Gaps = 1/236 (0%) Query: 33 FGRNYMPTWAFDHIKYFNGGKEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSAGT 92 F +++ TW K N + + L LDK +G+GF+S+ YLFG MQIK+VPG+SAGT Sbjct: 24 FNQDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKSRNQYLFGKIDMQIKLVPGNSAGT 83 Query: 93 VTAYYLSSQNNEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAYHSY 152 VT+YYLSS + HDEIDFEFLGN +G PY L TNVFT GKG+REQ+ +LWFDPT +H+Y Sbjct: 84 VTSYYLSSLGSAHDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQQFYLWFDPTKDFHTY 143 Query: 153 AVLWNLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEKTDW 212 ++LWN I+F VD PIR FKN + G+ FP NQ M +YSSLWNADDWATRGGL KTDW Sbjct: 144 SILWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAMWIYSSLWNADDWATRGGLVKTDW 203 Query: 213 SKAPFIASYRGFHIDGCEASVEAKYCATQGKRWWDQKEF-QDLDAQQWRRLRWVRK 267 SKAPF ASYR F+ C S + C++ + F Q LDA R++WV++ Sbjct: 204 SKAPFTASYRNFNAQACIWSSGSSSCSSSPSGSSKEAWFTQSLDATGKGRMKWVQR 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992109 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4475 (443 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29010 (295 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51912285 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5844 244 2e-67 >Contig5844 Length = 161 Score = 244 bits (623), Expect = 2e-67, Method: Compositional matrix adjust. Identities = 119/148 (80%), Positives = 132/148 (89%) Query: 1 MDFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLTEFREPQ 60 MDFSKSSKNAL+WAI NL DKGDTL+IIHI N ESR+ LWA+SGSPLIPL+EFRE + Sbjct: 11 MDFSKSSKNALQWAIDNLVDKGDTLHIIHINNNKHDESRNVLWAKSGSPLIPLSEFRELE 70 Query: 61 IMKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGL 120 +MK YGV TDMEVLD LDTVSRQKEV ++TK+YWGDAREKLLQAVEDLKLDSLVMGSRGL Sbjct: 71 VMKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYWGDAREKLLQAVEDLKLDSLVMGSRGL 130 Query: 121 STIKRIVLGSVSNFVLTNASIPVTIVKD 148 T+KRIVLGSVSN+V+T A IPVTIVKD Sbjct: 131 GTLKRIVLGSVSNYVMTQAPIPVTIVKD 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48264770 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7407 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91034055 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158358249 249 5e-69 >158358249 Length = 174 Score = 249 bits (637), Expect = 5e-69, Method: Compositional matrix adjust. Identities = 118/176 (67%), Positives = 144/176 (81%), Gaps = 4/176 (2%) Query: 1 MTDVAESERRILVAVDEGEESMHALSWCLKNVAGQNSKDTLVLLHAKPPRAVFTALDGTG 60 M DVAE ERRILVAVDEGEESM+ALSWCL NV +SKDTL+L++ KPP+AV+ LDGTG Sbjct: 1 MADVAEKERRILVAVDEGEESMYALSWCLGNVV--SSKDTLILVYVKPPKAVYMPLDGTG 58 Query: 61 RREDPSAYLFSSDILAATEKYGADVADCVMEKARKMCKDL--QPDLKAETKVESGDPRDV 118 R + S Y+FSSD+ A E Y +VA+ V+EKA+ C+D+ + D+K ET++E+GDPRDV Sbjct: 59 RSQSSSGYMFSSDLYATMENYSNEVANSVIEKAKNKCRDVLQEQDVKVETRIENGDPRDV 118 Query: 119 ICQMVERVRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPKTNAGSK 174 IC +VE++ A +LVMGS GYG+IKRAFLGSVSNHCAQNV CPVLIVKKPKTN GSK Sbjct: 119 ICHLVEQLGAHILVMGSRGYGLIKRAFLGSVSNHCAQNVNCPVLIVKKPKTNNGSK 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8855 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158358249 237 3e-65 >158358249 Length = 174 Score = 237 bits (604), Expect = 3e-65, Method: Compositional matrix adjust. Identities = 115/176 (65%), Positives = 140/176 (79%), Gaps = 11/176 (6%) Query: 1 MTDVAESERRILVAVDEGEESMHALSWCLKNVAGQNSKDTLVLLHAKPPRAVFTALDGTA 60 M DVAE ERRILVAVDEGEESM+ALSWCL NV +SKDTL+L++ KPP+AV+ LDGT Sbjct: 1 MADVAEKERRILVAVDEGEESMYALSWCLGNVV--SSKDTLILVYVKPPKAVYMPLDGTG 58 Query: 61 -------YLFSSDILAATEKYGADVADCVMEKARKMCKDL--QPDLKAETKVESGDPRDV 111 Y+FSSD+ A E Y +VA+ V+EKA+ C+D+ + D+K ET++E+GDPRDV Sbjct: 59 RSQSSSGYMFSSDLYATMENYSNEVANSVIEKAKNKCRDVLQEQDVKVETRIENGDPRDV 118 Query: 112 ICQMVERVRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPKTNAGSK 167 IC +VE++ A +LVMGS GYG+IKRAFLGSVSNHCAQNV CPVLIVKKPKTN GSK Sbjct: 119 ICHLVEQLGAHILVMGSRGYGLIKRAFLGSVSNHCAQNVNCPVLIVKKPKTNNGSK 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19391 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5492 (304 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71921177 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21748 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8501 (517 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26973 (68 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19383 (68 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8507 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21722 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50889568 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54621652 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10848 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3802 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77981379 210 3e-57 >77981379 Length = 204 Score = 210 bits (535), Expect = 3e-57, Method: Compositional matrix adjust. Identities = 101/160 (63%), Positives = 114/160 (71%) Query: 3 IGGQPAGRIVMELDADTTPRTAENFRALCTGEKGVGRSGKPPHYKGSAFHRVIPGFMCQX 62 I G+PAGRIVM L P+TAENFRALCTGEKG+G+SGKP HYKGS FHR+IP FM Q Sbjct: 43 IAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSKFHRIIPSFMLQG 102 Query: 63 XXXXXXXXXXXESIYGAKFADENFNKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLDG 122 ESIYG KFADENF KHTGPG+LSMANAGP TNGSQFFI T T WLDG Sbjct: 103 GDFTLGDGRGGESIYGEKFADENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTTWLDG 162 Query: 123 KHVVFGQVVEGLDVVKNIEKVGSGQGRTSKPVVVADCGQL 162 +HVVFG+V+ G+DVV +E GS G V + D G+L Sbjct: 163 RHVVFGKVLSGMDVVYKVEAEGSQSGTPKSKVAIVDSGEL 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4196 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32983 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31477 (475 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21169 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32577 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23685 (328 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2870 498 e-143 >Contig2870 Length = 408 Score = 498 bits (1281), Expect = e-143, Method: Compositional matrix adjust. Identities = 262/323 (81%), Positives = 282/323 (87%), Gaps = 7/323 (2%) Query: 1 MESRVLSRATAFAP-LPCQRKPSHRENGAVSFVSA--RPIGAVSEGGNLIWGRQLRPALL 57 MESRVLSRATAFA +P RK S R AVSF ++ RPIGAVSEGGNLIWGRQLRPALL Sbjct: 1 MESRVLSRATAFASSVPSLRKSSPRHPAAVSFAASPRRPIGAVSEGGNLIWGRQLRPALL 60 Query: 58 LEASPI--KREILKPCLAAASSPAQGDSAGDAKVAPIGFFDKYPFILTGFFFFMWYFLNV 115 LEASP +R+ LKPC AAA+ DSAG+AK AP+GF KYP+++TGFFFFMWYFLNV Sbjct: 61 LEASPSPSRRDALKPCRAAAA--GGSDSAGEAKPAPVGFLGKYPWLVTGFFFFMWYFLNV 118 Query: 116 IFNIMNKKIYNYFPYPYFXXXXXXXXXXXYCLISWAVGLPKRAPIDANLLKLLIPVAVCH 175 IFNI+NKKIYNYFPYPYF YCLISWAVGLPKRAP+D+N LKLLIPVA CH Sbjct: 119 IFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLISWAVGLPKRAPMDSNQLKLLIPVAACH 178 Query: 176 ALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFVLGQSIPLSLWLSLAPVVIGVSMA 235 ALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQF+LGQSIPLSLWLSLAPVV+GVSMA Sbjct: 179 ALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFILGQSIPLSLWLSLAPVVLGVSMA 238 Query: 236 SLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIIALIVCIPPALIL 295 SLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIIAL C+PPALIL Sbjct: 239 SLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIIALFFCLPPALIL 298 Query: 296 EGPQLIKYGFNDAIAKVGLVKFV 318 EGPQL+K+GF DAIAKVGLVKF+ Sbjct: 299 EGPQLLKHGFADAIAKVGLVKFI 321 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12258 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17701 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20850 (307 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6580 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 162 2e-42 >Contig1666 Length = 421 Score = 162 bits (410), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 85/177 (48%), Positives = 106/177 (59%), Gaps = 21/177 (11%) Query: 9 GSQHPQ-LPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFG 67 G Q Q L PGFRFHPTDEELV +YLK+K A I+ VD+YK +PW+LP K+ Sbjct: 2 GRQSSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLK 61 Query: 68 --EQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGG 125 + EWYFFS DRKY N +R NRA GYWK TG D+PV S + VG+KK LVF+ G Sbjct: 62 SRDTEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHS--SRAVGMKKTLVFHSG 119 Query: 126 KPPKGTKTNWIMHEYRLVXXXXXXXXXXXXXXKPSDAANKKPSLRLDDWVLCRIYKK 182 + PKG +TNW+MHEYRL + K + D +VLCRI++K Sbjct: 120 RAPKGARTNWVMHEYRL----------------DNQELEKAGIVEKDAYVLCRIFQK 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2839 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28943 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27411 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2876 385 e-109 >Contig2876 Length = 258 Score = 385 bits (988), Expect = e-109, Method: Compositional matrix adjust. Identities = 181/237 (76%), Positives = 206/237 (86%) Query: 4 EREKHAYQAKLAEQAERYDEMIEEMKKVAKLDVELSVEERNLLSVGYKSVIGARRASWRI 63 ER+ + Y AKLAEQAERYDEM+E M KVAKLDVEL++EERNLLSVGYK+VIGARRASWRI Sbjct: 3 ERDNYVYTAKLAEQAERYDEMVEAMTKVAKLDVELTIEERNLLSVGYKNVIGARRASWRI 62 Query: 64 LSSIEQKEEAKGGEQNVKRIKEYRQRVEDELAKICHDILTVVDYHLLPSSSTGESTVFYH 123 LSSIEQKEE KG + NV RIKEYR +VE EL+ IC DI+ V+D HLLPS S ESTVF++ Sbjct: 63 LSSIEQKEEGKGNDINVSRIKEYRNKVEAELSSICSDIMRVIDEHLLPSCSGFESTVFFY 122 Query: 124 KMKGDYYRYLAEFKSGDDRKQAADHSLKAYLTAVDTAASELPPTHPIRLGLALNFSVFYY 183 KMKGDYYRYLAEFK+GDDRK+ AD S+KAY A A ++LPPTHPIRLGLALNFSVFYY Sbjct: 123 KMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYY 182 Query: 184 EILNSPERACHLAKKAFDETFAELDSIDQESSKDSTLIMQLLKDNLTLWTSDLPEGG 240 EILNSPERACHLAK+AFDE +ELD++ +ES KDSTLIMQLL+DNLTLWTSD+PE G Sbjct: 183 EILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDG 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226800151 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3273 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226787059 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26793 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16520 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13319 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig495 (44 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12748 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11602 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27013 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5929 208 2e-56 >Contig5929 Length = 184 Score = 208 bits (530), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 101/166 (60%), Positives = 121/166 (72%), Gaps = 3/166 (1%) Query: 27 VSDWSYGVSRRYQHVLDRTTPHVLYRWLACLAAALIYVLRVYLVQGFYVVSYXXXXXXXX 86 V+ W SR +Q+ LDR+TPH L+RWL LA A+IY+LRVY VQGFYVVSY Sbjct: 15 VAQWKRDFSRAFQYYLDRSTPHTLHRWLGTLAVAMIYILRVYYVQGFYVVSYGLGIYVLN 74 Query: 87 XXXXXXSPQVDPEIHDLSSSDGPSLPTRGSDEFRPFVRRLPEFKFWYSITKAFCIAFAMT 146 SP+VDPE+ L DG SLPT+G+DEFRPFVRRLPEFKFWYSITKAF IAF MT Sbjct: 75 LLIGFFSPKVDPELEVL---DGASLPTKGADEFRPFVRRLPEFKFWYSITKAFLIAFVMT 131 Query: 147 FFSAFDVPVFWPILLFYWVVLFVLTMRRQIVHMIKYKYVPFSFGKQ 192 F S DVPVFWPILL YW+VLFVLTM+RQ +H+I++++ P + Sbjct: 132 FISVLDVPVFWPILLCYWIVLFVLTMKRQNLHLIQFQFFPLQMETE 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824050 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25288 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57895818 118 5e-29 >57895818 Length = 106 Score = 118 bits (295), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 53/79 (67%), Positives = 67/79 (84%), Gaps = 1/79 (1%) Query: 168 LFLVNQENFHKNADKQSWKAIAELIPHEVPNIEKRRGKKDQEKKPGIQVIQGPKPGKPTD 227 +F+ +QE FH DK WKA+A+LIP+EVP IEKR G+KDQEKKP + V+QGPKPGKPT+ Sbjct: 1 MFVASQEKFHAEVDKNYWKAVADLIPNEVPAIEKR-GRKDQEKKPSVVVVQGPKPGKPTE 59 Query: 228 LSRLRQVLVKLKHKTPPHM 246 LSR+RQ+L+KLKH TPPH+ Sbjct: 60 LSRMRQILLKLKHNTPPHL 78 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28895 (337 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6390 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9090 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32643 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26167 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815213 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14342 (372 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780398 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32495 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4062 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9914 (643 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4630 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25232 (273 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 160 9e-42 >Contig2950 Length = 216 Score = 160 bits (404), Expect = 9e-42, Method: Compositional matrix adjust. Identities = 80/202 (39%), Positives = 123/202 (60%), Gaps = 13/202 (6%) Query: 85 KLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQER 144 K+VL+GD G GKS+L+ RF + +F +STIG F ++++ V+D VK +IWDTAGQER Sbjct: 14 KVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQER 73 Query: 145 YHSLAPMYYRGAAAAIIVYDLTNQASFERAKKWVLELKSQGNPNMVMALAGNKADLVEAR 204 Y ++ YYRGA A++VYD+T +FE ++W+ EL+ + N+V+ L GNKADL R Sbjct: 74 YRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLR 133 Query: 205 KVAAEDAQSYAQENGLFFLETSAKTADNVNDIFYEIAKRLPRV----------QPVQNPA 254 V+ EDA+++A+ FF+ETSA + NV + F E+ ++ +V P P Sbjct: 134 AVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQIYQVVSRKALEVGDDPAAVPK 193 Query: 255 GMVLVDRPSERVAS---SSCCS 273 G + + V++ + CCS Sbjct: 194 GQTINVGGKDDVSAIKKAGCCS 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9192 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54681722 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3874 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1749 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2866 65 8e-14 >Contig2866 Length = 330 Score = 65.1 bits (157), Expect = 8e-14, Method: Composition-based stats. Identities = 37/97 (38%), Positives = 51/97 (52%), Gaps = 3/97 (3%) Query: 2 CPKNV-DPDIA--IDMDPTTPRKFDNVYFQNLVEGKGLFTSDQVLYTDSRSQPTVRTWAK 58 CP + DP + D TP FDN Y++N+++ KGL D L TD R++P V+ AK Sbjct: 231 CPDAIPDPKAVQYVRNDRGTPMIFDNNYYRNILDNKGLMMVDHQLATDKRTKPYVKKMAK 290 Query: 59 NNAAFNQAFITAMTKLGRVGMKTGKNGNIRRDCSVFN 95 + F + F A T L TG G IR+ C+V N Sbjct: 291 SQDYFFKEFTRAFTILSENNPLTGDKGEIRQQCNVAN 327 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7893 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10742 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29083 (358 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239951 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21497 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2876 500 e-144 >Contig2876 Length = 258 Score = 500 bits (1288), Expect = e-144, Method: Compositional matrix adjust. Identities = 242/256 (94%), Positives = 248/256 (96%) Query: 6 ERENYVYTAKLAEQAERYDEMVEAMTKVAKLDVELTVEERNLLSVGYKNVIGARRASWRI 65 ER+NYVYTAKLAEQAERYDEMVEAMTKVAKLDVELT+EERNLLSVGYKNVIGARRASWRI Sbjct: 3 ERDNYVYTAKLAEQAERYDEMVEAMTKVAKLDVELTIEERNLLSVGYKNVIGARRASWRI 62 Query: 66 LSSIEQKEEGKGNDQNVSRIKEYRQKVESELSSICSDIMRVIDEHLIPSCTAFESTVFFY 125 LSSIEQKEEGKGND NVSRIKEYR KVE+ELSSICSDIMRVIDEHL+PSC+ FESTVFFY Sbjct: 63 LSSIEQKEEGKGNDINVSRIKEYRNKVEAELSSICSDIMRVIDEHLLPSCSGFESTVFFY 122 Query: 126 KMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYY 185 KMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYY Sbjct: 123 KMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYY 182 Query: 186 EILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGGED 245 EILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDG E+ Sbjct: 183 EILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGVEE 242 Query: 246 IQKVDGSAKPGGEDAE 261 QK D SAK GGEDAE Sbjct: 243 GQKADSSAKAGGEDAE 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18341 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11362 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25473 (444 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11952 (360 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23011 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6792 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15251 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5349 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20536 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30219 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8592 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8706 (404 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9954 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 72 3e-15 >Contig3804 Length = 391 Score = 72.4 bits (176), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 31/59 (52%), Positives = 38/59 (64%) Query: 24 HFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTXXXXXXXXXXXXXXFRGAKAKTNFPQ 82 +RG+R+RPWG++AAEIRDP K RVWLGTF+T RG KAK NFP+ Sbjct: 117 QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPE 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51564940 (67 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2870 68 1e-14 >Contig2870 Length = 408 Score = 67.8 bits (164), Expect = 1e-14, Method: Composition-based stats. Identities = 38/67 (56%), Positives = 38/67 (56%) Query: 1 LERVAPLTHAVGNVLKRXXXXXXXXXXXXNKISXXXXXXXXXXXXXXXXYSYLKAKIEEE 60 LERVAPLTHAVGNVLKR NKIS YSYLKAKIEEE Sbjct: 342 LERVAPLTHAVGNVLKRVFVIGFSIVIFGNKISTQTGIGTAIAIAGVAIYSYLKAKIEEE 401 Query: 61 KRQGKAA 67 KRQ KAA Sbjct: 402 KRQAKAA 408 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17453 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752406 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8189 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28412 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51241402 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21695 (895 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25190 (328 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 298 2e-83 >89552756 Length = 189 Score = 298 bits (764), Expect = 2e-83, Method: Compositional matrix adjust. Identities = 132/185 (71%), Positives = 160/185 (86%) Query: 128 MVNGSLRHVLLSKERHLDRRKRLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLKDPQR 187 MVNGSL+ L K+R +DRRKRLIIAMDAAFGMEYLH KNIVHFDLKC+NLLVN++DPQR Sbjct: 1 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 60 Query: 188 PICKVADFGLSKIKRNTLVTGGVRGTLPWMAPELLNGGSSKVSEKVDVFSFGIVLWEILT 247 P+CK+ D GLSK+K+ TLV+GGVRGTLPWMAPELL+G S V+EK+DV+SFGIV+WE+LT Sbjct: 61 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLT 120 Query: 248 GEEPYANMHYGAIIGGIVNNTLRPHVPPFCDSEWKLLMEQCWAADPVVRPSFTEITKRLR 307 G+EPY +MH +IIGGIVNNTLRP +P +CD EWK LME CW ++P RPSF+EI+++LR Sbjct: 121 GDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQKLR 180 Query: 308 VMTAA 312 M AA Sbjct: 181 NMAAA 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48417954 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226765933 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13466 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 68 6e-14 >89552756 Length = 189 Score = 68.2 bits (165), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 14/116 (12%) Query: 171 TLDWMQRVRIAVEAARGLEYLHEKVQPAIIHRDIRSSNVLL-FEDFK---AKIADFNLSN 226 T+D +R+ IA++AA G+EYLH K I+H D++ N+L+ D + KI D LS Sbjct: 16 TIDRRKRLIIAMDAAFGMEYLHGK---NIVHFDLKCENLLVNMRDPQRPVCKIGDLGLSK 72 Query: 227 QAPDMAARLHSTRVLGTFGYHAPEYAMTGQ---LTQKSDVYSFGVVLLELLTGRKP 279 L S V GT + APE ++G+ +T+K DVYSFG+V+ ELLTG +P Sbjct: 73 VK---QQTLVSGGVRGTLPWMAPEL-LSGKSHMVTEKIDVYSFGIVMWELLTGDEP 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5790 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15232 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13680 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29208 (288 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3406 248 4e-68 >Contig3406 Length = 450 Score = 248 bits (632), Expect = 4e-68, Method: Compositional matrix adjust. Identities = 140/288 (48%), Positives = 178/288 (61%), Gaps = 5/288 (1%) Query: 1 DSTHGIFDGSISVVDNSTLEINGKEIKVVSKRDPAEIPWGDYGVEYVVESSGIFTTLEXX 60 DS G F I +VDN T+ ++GK IKVVS RDP ++PW + G++ V+E +G+F Sbjct: 131 DSMLGTFKADIKIVDNETISVDGKPIKVVSNRDPLKLPWAEMGIDIVIEGTGVFVDGPGA 190 Query: 61 XXXXXXXXXXVVISAPS--ADAPMFVVGVNENTYKPNM-DIVSNASCTTNCLAPLAKVIH 117 V+I+AP+ AD P +VVGVNE Y ++ DIVSNASCTTNCLAP KV+ Sbjct: 191 GKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHSVADIVSNASCTTNCLAPFVKVLD 250 Query: 118 EEFGILEGLMXXXXXXXXXXXXXDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELN 177 EEFGI++G M D S +D R R A NI+P+STGAAKAV VLP+L Sbjct: 251 EEFGIVKGTMTTTHSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLK 309 Query: 178 GKLTGMAFRVPTPNVSVVDLTCRLEKSS-SYEDVKATIRYAADGPLRGILGYTEEDVVSN 236 GKL G+A RVPTPNVSVVDL + K + EDV R AADGPL+GIL + +VS Sbjct: 310 GKLNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFRKAADGPLKGILAVCDVPLVSV 369 Query: 237 DFVGDSRSSIFDAKAGLALSSSFVKLVSWYDNEWGYSTRVLDLIEHMA 284 DF SS D+ + + VK+V+WYDNEWGYS RV+DL +A Sbjct: 370 DFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA 417 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4719 (423 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226792919 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158378696 72 5e-16 >158378696 Length = 195 Score = 72.4 bits (176), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 2/79 (2%) Query: 13 DAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYIL-QRGSWD-DVFKVS 70 +F+ SGLY HQDI P YA +LLG++NT G + G+ G A TGY+L SW +F S Sbjct: 110 SSFAISGLYCTHQDISPEYASILLGITNTVGAVPGIVGVALTGYLLDSTHSWSMSLFIPS 169 Query: 71 VVLYIMGTLIWNLFSTGEK 89 + Y+ GT++W F++ + Sbjct: 170 IFFYLTGTIVWLAFASSKP 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56435546 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 60 9e-12 >89552756 Length = 189 Score = 59.7 bits (143), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 17/130 (13%) Query: 1 MENNSLANALFGPENRINLDWPTRVKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDG 60 M N SL L + I D R+ I A G+ +LH ++ IVH D+K N+L++ Sbjct: 1 MVNGSLKQFLQKKDRTI--DRRKRLIIAMDAAFGMEYLHGKN---IVHFDLKCENLLVNM 55 Query: 61 DLNP-----KISDFGLAKLYDEEKTHVSTKVAGTIGYMAPEYALLGH---LTYKADVYSF 112 +P KI D GL+K+ +++T VS V GT+ +MAPE L G +T K DVYSF Sbjct: 56 R-DPQRPVCKIGDLGLSKV--KQQTLVSGGVRGTLPWMAPEL-LSGKSHMVTEKIDVYSF 111 Query: 113 GVVALEIVSG 122 G+V E+++G Sbjct: 112 GIVMWELLTG 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21329 (398 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19474 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7882 (413 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752629 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32686 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3887 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7121 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5093 240 6e-66 >Contig5093 Length = 250 Score = 240 bits (612), Expect = 6e-66, Method: Compositional matrix adjust. Identities = 135/200 (67%), Positives = 148/200 (74%), Gaps = 15/200 (7%) Query: 26 VVVMRKRGFSETESKISTD--TSTCVDLKLNLSNSSKEANSTGGKDGIAVKSKTNKEKNN 83 VV+MRKR FSETES+I+TD +S CVDLKLNLS SK+ +ST K + +K NKEKN Sbjct: 30 VVMMRKRVFSETESQITTDDESSACVDLKLNLS--SKDGSSTAEKSKSLMMNK-NKEKN- 85 Query: 84 HXXXXXXXXXXXXXXXXQVVGWPPVRSFRKNMFTGVQKSSNDGESEQMNKGGNNNAVLVK 143 QVVGWPPVRSFRKNM + QKSS ES+ GGN A LVK Sbjct: 86 ---VDLPADPAKPPAKAQVVGWPPVRSFRKNMLSA-QKSSTTDESKA---GGN--AALVK 136 Query: 144 VSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGS 203 VSMDGAPYLRKVDL MYK+YP+LSDALAKMFSSFTIGNCGSQG DFMNE KLMD+LN S Sbjct: 137 VSMDGAPYLRKVDLNMYKTYPQLSDALAKMFSSFTIGNCGSQGTIDFMNERKLMDLLNDS 196 Query: 204 DYTPTYEDKDGDWMLVGDVP 223 DY PTYEDKDGDWMLVGDVP Sbjct: 197 DYIPTYEDKDGDWMLVGDVP 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22063 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29817 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812271 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21393 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26884 (260 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9236 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 95 2e-22 >Contig1161 Length = 148 Score = 95.1 bits (235), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 51/148 (34%), Positives = 78/148 (52%), Gaps = 3/148 (2%) Query: 1 MSSPSKRREM-DLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAY 59 M+S +E+ DL K + + + M + GP DS Y GGV+ + + P Y Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 60 PYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDP 119 P+K P + F K++HPN++ +GS+CLD++ + WSP + V + + LL PNP DP Sbjct: 61 PFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDP 118 Query: 120 LNGEAAALMMRDRPAYEQRVKEFCLKYA 147 L E A + DR YE + + KYA Sbjct: 119 LVPEIAHMYKTDRSKYETTARSWTQKYA 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30431 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10382 (351 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24860 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18960 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29178 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 83 4e-19 >Contig2005 Length = 422 Score = 83.2 bits (204), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 43/101 (42%), Positives = 60/101 (59%), Gaps = 10/101 (9%) Query: 1 MSRSIGDRYMKPWIIPDPEVVFVSREKEDECLILASDGLWDFITNQEACDIARRRILLWH 60 MSR+IGD Y+KP++I +PEV + R EDECLILASDGLWD ++N AC + R+ L Sbjct: 305 MSRAIGDNYLKPYVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTACGVV--RMCLRA 362 Query: 61 KKYSDTMS--------TERGEGTDPAAQSAAEYLSKLAMQK 93 +K S + G +D A A+ L+KLA+ + Sbjct: 363 QKTPGASSGGDVADGESSAGVNSDKACADASILLTKLALAR 403 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7674 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13087 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 80 1e-17 >Contig3804 Length = 391 Score = 79.7 bits (195), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 34/72 (47%), Positives = 49/72 (68%) Query: 16 KYKGVRKRKWGKWVSEIRLPNSRERIWLGSYDAPEKAARAFDAALFCLRGHTAKFNFPDN 75 +Y+G+R+R WGKW +EIR P R+WLG+++ E+AARA+DA +RG AK NFP+ Sbjct: 117 QYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEE 176 Query: 76 PPEISGGRSLSA 87 P S R++ A Sbjct: 177 APRASTKRAVKA 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19737 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21204 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6335 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18120 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4779 (606 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5899 (524 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12925 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48261349 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2672 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91044742 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158362734 199 8e-54 >158362734 Length = 188 Score = 199 bits (507), Expect = 8e-54, Method: Compositional matrix adjust. Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 2/126 (1%) Query: 82 LFTVLWVCRSRFGSQSAAVHSVRMEGSSSATVPSIVVYVTVPSREVGKKLAESLVREQLA 141 L LWV RS FGSQ+ A+ +GSSS TVPSIVVYVTVP++EVGKKLAESLVRE+LA Sbjct: 55 LLRELWVFRSNFGSQAKAMEG--PQGSSSTTVPSIVVYVTVPNKEVGKKLAESLVREKLA 112 Query: 142 ACVNLVPGIESVYQWKGEVQTDSEKLLIIKTRQSLFEGLTAHVKANHPYDVPEVIALPIN 201 ACVN+VPGI+SVYQW+GEVQTDSE+LLIIKTRQSLFE LT HVK+NHPYDVPEVIALPIN Sbjct: 113 ACVNIVPGIQSVYQWEGEVQTDSEELLIIKTRQSLFEALTEHVKSNHPYDVPEVIALPIN 172 Query: 202 AGSLPY 207 AGSL Y Sbjct: 173 AGSLNY 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25685 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15104 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31405 (317 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748637 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48408266 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9925 (465 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3798 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27037 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25063 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12120 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9746 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11115 (331 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7520 (419 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16098 (339 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2437 311 3e-87 >Contig2437 Length = 408 Score = 311 bits (797), Expect = 3e-87, Method: Compositional matrix adjust. Identities = 163/320 (50%), Positives = 211/320 (65%), Gaps = 6/320 (1%) Query: 1 GDRVKQWTTLNEPHSVSNNGFAVGSQAPGRCSYWQNRNCLGGDSAIEPYXXXXXXXXXXX 60 GDRVK W T+NEP+ + +G+ G+ APGRCS ++ NC G+SA E Y Sbjct: 91 GDRVKHWVTMNEPNGFAISGYGGGTFAPGRCSNYEG-NCTSGNSATESYTVAHHLLLAHS 149 Query: 61 XXVKVYKDKYQAFQKGLIGITLNTYWFVPASETK-EDKHAALRSLDFMFGWFMEPLTSGD 119 VK+YKDKYQA QKG IGIT+ T+W+ P + + A LRSLDFMFGWF P+ GD Sbjct: 150 AAVKIYKDKYQASQKGQIGITVVTHWWKPKYPAQLASRTATLRSLDFMFGWFANPIVHGD 209 Query: 120 YPQSMRSLVGNRLPVFTNEESMLLTGSFDFLGLNYYTARYSSNDVPDNSSLPASYVTDSH 179 YP+ MRS+VGNRLP FT ES + GS DFLGLNYYT+ Y+ D P +S+ S+ +D Sbjct: 210 YPEVMRSMVGNRLPKFTEAESKQIKGSLDFLGLNYYTSYYTE-DGPASSN--HSWTSDRQ 266 Query: 180 VKV-TIELNGVPIGPPTASDWLYVYPKGVYDLLLYIKKKYNDPLIYITESGVSEFNDPKL 238 V T + GV IG T DWLYVYPKG+ D+LLYIK+KYN+P I+ITE+G + + Sbjct: 267 VTASTTDKAGVLIGAATDLDWLYVYPKGIRDVLLYIKEKYNNPNIFITENGYAYGYNAST 326 Query: 239 SLQEALNDTNRVDYYYRHLCYVRAAIKNGSKVKGYIAWSLLDNFEWEIGYAVRFGINYVD 298 ++EA D R+ Y++ HL Y+ AIK+G +VKGY AWS D+FEW+ GY V FG+ VD Sbjct: 327 PIEEARKDNLRIRYHHDHLWYLLKAIKDGVQVKGYYAWSFFDDFEWDAGYTVGFGLTLVD 386 Query: 299 YNNGLKRYPKLSAHWFKSFL 318 + LKRY K SA+W+K FL Sbjct: 387 VKDNLKRYLKYSAYWYKMFL 406 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17391 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226742802 (45 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748171 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17314 (325 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10510 (330 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5162 99 4e-23 >Contig5162 Length = 448 Score = 98.6 bits (244), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 4/85 (4%) Query: 242 RIVRVPAISLKLA---DIPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERA 298 RIV+ P I ++ DI D Y WRKYGQK +KG+P+PR YYKC+S GCP RKHVERA Sbjct: 365 RIVKEPRIVVQTTSEIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTST-GCPVRKHVERA 423 Query: 299 LDDAAMLVVTYEGEHNHSLSVAETS 323 D ++ TYEG+HNH + A S Sbjct: 424 SHDMRAVITTYEGKHNHDVPAARGS 448 Score = 72.4 bits (176), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Query: 259 DDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDAAMLVVTYEGEHNHS 316 D Y+WRKYGQK +KGS +PR YYKC + CP +K VER+LD +V Y+G HNH+ Sbjct: 217 DGYNWRKYGQKQVKGSENPRSYYKC-TFPNCPTKKKVERSLDGQITQIV-YKGSHNHA 272 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226753563 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19280 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6064 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263478 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13107 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25792 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27485 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764350 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17999 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9623 (673 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2902 (228 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig98 457 e-131 >Contig98 Length = 472 Score = 457 bits (1176), Expect = e-131, Method: Compositional matrix adjust. Identities = 218/228 (95%), Positives = 220/228 (96%) Query: 1 MTVFWSSAAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETTYQIALAIKDEVEDLEKA 60 MTVFWSS AQSMTARPMKGMLTGPVTILNWSFVRNDQPR ETTYQIALAIKDEVEDLEKA Sbjct: 245 MTVFWSSTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKA 304 Query: 61 GISVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNSGVQDTTQIHTHMCYSNFNDII 120 GI+VIQIDEAALREGLPLRKSE A YLDWAVHSFRITN GVQDTTQIHTHMCYSNFNDII Sbjct: 305 GINVIQIDEAALREGLPLRKSEQAHYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDII 364 Query: 121 HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINK 180 HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINK Sbjct: 365 HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK 424 Query: 181 MLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 228 MLAVLETNILWVNPDCGLKTRKY EVKPALS MVAAAK LRTQLASAK Sbjct: 425 MLAVLETNILWVNPDCGLKTRKYAEVKPALSAMVAAAKQLRTQLASAK 472 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20530 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48390652 (64 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46607608 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5266 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5745 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9413 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25148 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20341 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226795738 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7498 (333 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3040 105 4e-25 >Contig3040 Length = 280 Score = 105 bits (261), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 83/298 (27%), Positives = 126/298 (42%), Gaps = 19/298 (6%) Query: 12 FLNTAIAGLFAVLLFSYYFIQKFRAATNSRXXXXXXXXXXXXXXXXXXXXXXSQLPHITL 71 FL AI L AV+LF F K S+ PH +L Sbjct: 2 FLIAAITLLVAVVLFRLLFSGK------SQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSL 55 Query: 72 GALVDKYGPIFTFNIGIHSALVINTWEAAKECFTTNDSIVSSRPATLGIKHLSYDFAMFG 131 L K+GP+ +G +V + A + T+D+ SSRP G K+++Y++ Sbjct: 56 AELAQKHGPLMHLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLV 115 Query: 132 FSPYGPYWRKIRKXXXXXXXXXXXXXXXKSVRVSEVEMRLKKLYKRWTERKDGGSSADIS 191 F PY P WR+ RK K VR EV + L + GS Sbjct: 116 FRPYSPRWRQFRKISSVHLFSGKALDDLKHVRQEEVAVLAHAL-------ANAGSKV--- 165 Query: 192 VEMKQWFGDLTLNVILRMIAEKRVLNVVNGNSNDEKEARAWQKAMREFFHLVGMFVLGDA 251 V + Q T+N + R++ +RV +G+ +D+ +A ++ + E L G+ +GD Sbjct: 166 VNLAQLLNLCTVNALGRVMVGRRVFG--DGSGSDDPKADEFKSMVVEMMVLAGVPNIGDF 223 Query: 252 IPWLWWLDLGGHQKAMKKTAKALDSIVMGWLEEHKQRRAKGQDQQDFMGVMLSVLDGA 309 IP L WLDL G MKK K D +M +E+HK+ D + +LS+ + A Sbjct: 224 IPCLEWLDLQGVASKMKKLHKRFDDFLMAIVEDHKKSTGTAA-HVDMLTTLLSLQEDA 280 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12106 (334 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3789 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19861 (370 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31805 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4146 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812193 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15327 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 92 2e-21 >89550571 Length = 226 Score = 92.4 bits (228), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 58/168 (34%), Positives = 91/168 (54%), Gaps = 5/168 (2%) Query: 4 KKVEMKRIENNTSRQVTFSKRRKGLLKKAYELSVLCDAEVAVIVFSQKGRIYEFSSSDMQ 63 KK+++++I+N +RQVT+SKRR+GLLKKA ELSVLCD E +VI+FS G++ E SSS + Sbjct: 7 KKIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSSTK 66 Query: 64 RTINRYHKHENGSGPTNKVEVEQYVQHLXXXXXXXXXXXXXXXXSQRKLLGNDLDSCPVE 123 I RY G ++Q L R++ G DL+ ++ Sbjct: 67 DVITRYESQTGDEG-----NLDQSSLDLQHDCIKLSNEIADKSRVLRQMNGEDLEGLNID 121 Query: 124 ELQEISSQLERSLRSISERKAQLYTEHMEQHKARERFLLQENAQLREE 171 ELQ + ++++ SL + + K + + +A+ L N QLR+E Sbjct: 122 ELQRLETKIDGSLNRVLQTKEENIIGEILALEAKGAELELANNQLRQE 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18565 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26462 (338 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5729 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11429 (321 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48386554 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27915 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10166 (230 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48391848 (61 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8351 (612 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32119 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1884 58 2e-11 >Contig1884 Length = 315 Score = 58.2 bits (139), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 37/57 (64%) Query: 71 TEKEREISGEDAVCCICLAKYADDDELRELPCLHVFHVECVDKWLKINASCPLCKSE 127 TE++ + GE+A CCIC +D+++ELPC H FH C+ WL + SCP+C+ E Sbjct: 222 TEEKLKKLGEEAECCICKENLVVNDKMQELPCKHTFHPPCLKPWLDEHNSCPICRHE 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2613 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30148 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13560 (238 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17501 (39 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7849 (333 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14765 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22425 (431 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825516 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22065 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1068 64 6e-13 >Contig1068 Length = 253 Score = 64.3 bits (155), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 33/76 (43%), Positives = 48/76 (63%) Query: 17 SLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFAFVRYKYQDEAHKAVEK 76 SLLV NI ++L F+++G V DV+IP+D TG+ RGFAFV++ EA +A Sbjct: 16 SLLVRNIPLDCRPEELRTPFERFGLVRDVYIPKDYYTGEPRGFAFVQFVDSYEAAEAQYH 75 Query: 77 LDGRVVDGREIMVQFA 92 ++G++ GREI V A Sbjct: 76 MNGKIFAGREISVVLA 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11175 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158379466 286 8e-80 >158379466 Length = 226 Score = 286 bits (733), Expect = 8e-80, Method: Compositional matrix adjust. Identities = 131/219 (59%), Positives = 165/219 (75%) Query: 56 IKTQVSQLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLIT 115 I V++LIG+TP+VYLN + +GC A IA K EM +P +S+KDR SMI DAE KGLIT Sbjct: 8 IAKDVTELIGKTPLVYLNHIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKGLIT 67 Query: 116 PGETTLIEPTSGNMGISMAFMAAMKGYKMVLTLPSYTSLERRVCMRCFGADLILTDPTKG 175 PG++ LIEPTSGN GI +AFMAA K Y++++T+P+ S+ERR+ +R FGA+L+LTDP KG Sbjct: 68 PGQSVLIEPTSGNTGIGLAFMAAAKQYRLIITMPASMSIERRIILRAFGAELVLTDPAKG 127 Query: 176 MGGTVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMXXXXXX 235 M G V+KA ++L TPNA+MLQQF NPAN KVH+ETTGPEIWE T G++D FV Sbjct: 128 MKGAVQKAEEILAKTPNAYMLQQFENPANPKVHYETTGPEIWEGTGGKIDAFVSGIGTGG 187 Query: 236 XXXXXXQYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSI 274 +YLK KNP+V++YGVEP ES VL GGKPGPH I Sbjct: 188 TITGAGKYLKEKNPSVKLYGVEPVESPVLTGGKPGPHKI 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32802 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20614 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25574 (534 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22156 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 110 1e-26 >158372667 Length = 230 Score = 110 bits (274), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 86/239 (35%), Positives = 119/239 (49%), Gaps = 20/239 (8%) Query: 28 DPAELAKWSFYRALIAEFXXXXXXXXXXXXXXIGYKSQTELDNCGGVGTLGIAW-AFGGM 86 +E AK +RALI EF G S D G T+ + + A Sbjct: 8 STSEAAKPEVWRALIVEFVTTFLFIFA------GVGSAMATDKLGADTTVALFFIAITHA 61 Query: 87 IFVLVYCTAG-ISGGHINPAVTFGLCLARKVSPVRAVLYMVAQSLGAIAGVALVKAIQKS 145 + V V +AG ISGGH+NPAVT GL ++ R+VLY + Q L A A L+K + Sbjct: 62 LVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLKYLTGG 121 Query: 146 YYTKYGGGANSLSDGYSTGVGLAAEIIGTFVLVYTVF-SATDPKRSARDSHVPVLAPLPI 204 T +SL+ G G+ EII TF L++TV+ + DPK+ + D L P Sbjct: 122 LTTPI----HSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDG----LGPTLT 173 Query: 205 GFAVFIVHLATIPITGTGINPARSLGPAVIFNQDKAWDDQWIFWVGPFIGAAIAAFYHQ 263 GF V LA +G +NPARS GPA++ + D W D W++WVGP IG +A F ++ Sbjct: 174 GFVVGANILAGGAFSGASMNPARSFGPALV-SWD--WTDHWVYWVGPLIGGGLAGFIYE 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12962 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17147 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22807 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1068 195 2e-52 >Contig1068 Length = 253 Score = 195 bits (496), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 94/102 (92%), Positives = 98/102 (96%) Query: 35 KEQNNGSLLVRNIPLDCRAEELRAPFERYGEVRDVYIPKDYYTGEPRGFAFIQFVDSYEA 94 +EQNNGSLLVRNIPLDCR EELR PFER+G VRDVYIPKDYYTGEPRGFAF+QFVDSYEA Sbjct: 10 REQNNGSLLVRNIPLDCRPEELRTPFERFGLVRDVYIPKDYYTGEPRGFAFVQFVDSYEA 69 Query: 95 AEAQYHMNGKIFAGREISVVVAAETRKRPEEMRQRTRVREPS 136 AEAQYHMNGKIFAGREISVV+AAETRKRPEEMRQRTRVR PS Sbjct: 70 AEAQYHMNGKIFAGREISVVLAAETRKRPEEMRQRTRVRGPS 111 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5939 (292 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 421 e-120 >Contig2005 Length = 422 Score = 421 bits (1083), Expect = e-120, Method: Compositional matrix adjust. Identities = 214/297 (72%), Positives = 227/297 (76%), Gaps = 8/297 (2%) Query: 2 TSVCGRRRDMEDAVSIHPSFLQKENPESNGTHFYGVFDGHGCSHVALKCKDRLYEIVKQE 61 TSVCGRRRDMEDAVSIHP + +S+G HFYGV+DGHGCSHVALKCKDRL+EIVKQ+ Sbjct: 128 TSVCGRRRDMEDAVSIHPKLFN-DGSDSDGCHFYGVYDGHGCSHVALKCKDRLHEIVKQD 186 Query: 62 LETEGESVQWKDAMERSFLKMDEEVQEGNLKAQSSNCRCELQTPQCDAVGSXXXXXXXXP 121 LE++ VQWKD MERSF KMDEEVQ GN Q+ NCRCELQTPQCDAVGS P Sbjct: 187 LESQ-RVVQWKDTMERSFSKMDEEVQAGNRALQNPNCRCELQTPQCDAVGSTAVVAVVTP 245 Query: 122 EKIVVSNCGDSRAVLCRSGAAVPLSSDHKPDRPDELVRIEAAGGRVIYWDGARVLGVLAM 181 EKI+VSNCGDSRAVLCR GAAVPLSSDHKPDRPDEL+RIEAAGGRVIYWDG RVLGVLAM Sbjct: 246 EKIIVSNCGDSRAVLCRKGAAVPLSSDHKPDRPDELLRIEAAGGRVIYWDGPRVLGVLAM 305 Query: 182 SRAIGDNYLKPYVISEPEVTVTDRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQTA 241 SRAIGDNYLKPYVISEPEVT+ DRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQ Sbjct: 306 SRAIGDNYLKPYVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQKT 365 Query: 242 ASQS------ELXXXXXXXXXXXXXXXXILLTKLALARQXXXXXXXXXXXLRRPGRS 292 S + ILLTKLALARQ LRR RS Sbjct: 366 PGASSGGDVADGESSAGVNSDKACADASILLTKLALARQSSDNVSVVVVDLRRHVRS 422 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6728 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27027 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29186 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21228 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 79 2e-17 >89540794 Length = 177 Score = 79.0 bits (193), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 34/76 (44%), Positives = 53/76 (69%) Query: 44 KLFIGGVSYQTDDQSLREAFQKYGEVVDARIIMDRESGRSRGFGFVTFTSNXXXXXXXXX 103 + F+GG+++ TD+ +L AF +GE+++++II DRE+GRSRGFGFVTF++ Sbjct: 9 RCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEKAMRDAIEG 68 Query: 104 XDGQELHGRRVRVNYA 119 +GQ+L GR + VN A Sbjct: 69 MNGQDLDGRNITVNEA 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6269 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14104 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10171 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24080 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1991 71 6e-15 >Contig1991 Length = 284 Score = 70.9 bits (172), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 63/210 (30%), Positives = 86/210 (40%), Gaps = 32/210 (15%) Query: 47 DVRIRIKAVGICGSDVHYLRTMKCADFEVKEPMVIGHECAGIVDKVGSEVKHLVPGDRVA 106 +VR+RI +C +D + T D E P ++GHE AGIV+ VG V + PGD V Sbjct: 36 EVRVRILYTALCHTDAY---TWGGKDPEGLFPCILGHEAAGIVESVGEGVTTVQPGDHVI 92 Query: 107 VEPGISCSRCQQCKGGQYNLC-------------------------PDMKFFATPPVHGS 141 C C+ CK G+ NLC P F T Sbjct: 93 PCYQAECGECKFCKSGKTNLCGKVRAATGVGVMMSDRQSRFSINGKPIYHFMGTSTFSQY 152 Query: 142 LANQIVHPADLCFKLP-ENVSLEEGAMCEPLSVGVHACRRANVGPETTVLIIGAGPIGLV 200 V A + K P E V L + P +G A V + V I G G +GL Sbjct: 153 TVVHDVSVAKIDPKAPLEKVCLLGCGV--PTGLGA-VWNTAKVEAGSIVAIFGLGTVGLA 209 Query: 201 SVLAARAFGAPRIVIMDMDDKRLAMAKSLG 230 A+ GA RI+ +D+D K+ +AK+ G Sbjct: 210 VAEGAKTAGASRIIGVDIDSKKFDIAKNFG 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9795 (400 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925660 (214 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5162 84 6e-19 >Contig5162 Length = 448 Score = 84.0 bits (206), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 38/84 (45%), Positives = 59/84 (70%), Gaps = 3/84 (3%) Query: 130 LKISRVYVRTDASDTRLIVKDGYQWRKYGQKVTRDNPSPRAYYKCSFAPSCPVKKKVQKS 189 +K R+ V+T + I+ DGY+WRKYGQKV + NP+PR+YYKC+ + CPV+K V+++ Sbjct: 367 VKEPRIVVQTTSEID--ILDDGYRWRKYGQKVVKGNPNPRSYYKCT-STGCPVRKHVERA 423 Query: 190 AENPCVLVATYEGEHNHMHPESRA 213 + + ++ TYEG+HNH P +R Sbjct: 424 SHDMRAVITTYEGKHNHDVPAARG 447 Score = 75.1 bits (183), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 40/94 (42%), Positives = 54/94 (57%), Gaps = 9/94 (9%) Query: 117 QEYSCKKPREHANLKI-SRVYVRTDASDTRLIVKDGYQWRKYGQKVTRDNPSPRAYYKCS 175 Q ++ E+ N S YVR SD DGY WRKYGQK + + +PR+YYKC+ Sbjct: 189 QSFNAAPKSEYTNCSTHSTQYVREQKSD------DGYNWRKYGQKQVKGSENPRSYYKCT 242 Query: 176 FAPSCPVKKKVQKSAENPCVLVATYEGEHNHMHP 209 F P+CP KKKV++S + + Y+G HNH P Sbjct: 243 F-PNCPTKKKVERSLDGQITQIV-YKGSHNHAKP 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14309 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6611 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9638 (311 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9983 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18841 (355 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54620195 (55 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2940 (312 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9199 (466 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8274 (386 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1991 170 1e-44 >Contig1991 Length = 284 Score = 170 bits (431), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 106/285 (37%), Positives = 143/285 (50%), Gaps = 10/285 (3%) Query: 12 QVITCKAVVCWGVGEAWKVEEIEVEPPKRSEVRVKMLYASLCHTDILISKGH-PIPLFPR 70 QVITCKA V W + +E+++V PP+ EVRV++LY +LCHTD G P LFP Sbjct: 6 QVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVRILYTALCHTDAYTWGGKDPEGLFPC 65 Query: 71 VLGHEGVGVVESIGEDVRNINGGDVVIPTFVSXXXXXXXXVSGKTNMC--LKNPLPFSGL 128 +LGHE G+VES+GE V + GD VIP + + SGKTN+C ++ + Sbjct: 66 ILGHEAAGIVESVGEGVTTVQPGDHVIPCYQAECGECKFCKSGKTNLCGKVRAATGVGVM 125 Query: 129 MPDGTSRMSVAGQKLYHLFSCSTLSEYMVVNVNYLLKLPGISTTSPSLPHASFLSCGFST 188 M D SR S+ G+ +YH ST S+Y VV+ + K I +P L L CG T Sbjct: 126 MSDRQSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAK---IDPKAP-LEKVCLLGCGVPT 181 Query: 189 GFGAPWKEAKVEKGSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKNERKKGKGEAFGMT 248 G GA W AKVE GS D + +K + FG+T Sbjct: 182 GLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKTAGASRIIGVDIDSKKFDIAKNFGVT 241 Query: 249 DFINPDDDGDCKSVSELIKHSTAGMGVDYCFECTGFAPFINEALE 293 +F+NP D K + +++ T G GVDY FEC G + ALE Sbjct: 242 EFVNPKDHE--KPIQQVLVDLTDG-GVDYSFECIGNVSVMRAALE 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824541 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040105 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815077 (113 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15446 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121754 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3413 137 1e-35 >Contig3413 Length = 153 Score = 137 bits (346), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 58/106 (54%), Positives = 79/106 (74%), Gaps = 1/106 (0%) Query: 2 STPARKRLMRDFKRLQQDPPAGISGAP-QDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 S+ A+ RLM D K + +PP G S +P D+N+ +W+A IFGPD+TPW+GG F L L F+ Sbjct: 3 SSSAQLRLMSDLKTIINEPPEGCSASPMSDDNLFVWSATIFGPDETPWEGGVFSLRLTFS 62 Query: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 E YP KPP VRF S MFHPN+Y DG++C+DI+Q+ WSP ++V+ IL Sbjct: 63 ERYPEKPPRVRFTSEMFHPNVYHDGALCMDIIQDAWSPCHNVSTIL 108 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29024 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32258 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746664 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226774769 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6115 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4754 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10827 (320 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4986 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3379 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48286303 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25772 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8555 (367 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121400 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20782 (358 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226808433 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6029 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20067 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig150 201 1e-54 >Contig150 Length = 131 Score = 201 bits (512), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 97/133 (72%), Positives = 108/133 (81%), Gaps = 2/133 (1%) Query: 1 MSWQTYVDDHLMCDIDGQGQHLTAAAIIGLDGSVWAKSSSFPQFKPEEMTGINKDFEEPG 60 MSWQ YVDDHL+CDIDG HL +AAI+G DGSVWA+SS+FP+FKPEE+T I KDF+EPG Sbjct: 1 MSWQAYVDDHLLCDIDGN--HLASAAIVGHDGSVWAQSSNFPKFKPEEITAIMKDFDEPG 58 Query: 61 HLAPTGLHLGGTKYMVIQGEPGAVIRXXXXXXXXXXXXXXQALVFGIYEEPVTPGQCNMV 120 LAPTGLHL GTKYMVIQGE GAVIR QALVFGIYEEP+TPGQCNM+ Sbjct: 59 TLAPTGLHLAGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118 Query: 121 VERLGDYLVDQGL 133 VERLGDYL+DQGL Sbjct: 119 VERLGDYLIDQGL 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48488286 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7228 (400 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31538 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31941 (280 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489292 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226785200 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29065 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53859309 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71818683 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21408 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26510 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 68 4e-14 >89540794 Length = 177 Score = 68.2 bits (165), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 34/77 (44%), Positives = 49/77 (63%), Gaps = 3/77 (3%) Query: 17 KVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFVTFREAEAAMRACVD 76 + FVGGLAW T + +++ F FG+I+E+ +I D+ TGRS+G+GFVTF E AMR ++ Sbjct: 9 RCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSN-EKAMRDAIE 67 Query: 77 A--APVIDGRRANCNLA 91 +DGR N A Sbjct: 68 GMNGQDLDGRNITVNEA 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32071 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1666 163 1e-42 >Contig1666 Length = 421 Score = 163 bits (412), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 81/160 (50%), Positives = 103/160 (64%), Gaps = 8/160 (5%) Query: 16 LPPGFRFHPTDEELVNHYLCRKCASQPLAVPIIREIDLYKFDPWQLPEMALYGEK--EWY 73 L PGFRFHPTDEELV +YL RK A + I +D+YK +PW LP + + EWY Sbjct: 9 LAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAISVVDIYKIEPWDLPGKSKLKSRDTEWY 68 Query: 74 FFSPRDRKYPNGSRPNRAAGTGYWKATGADKHIG-KPKALGIKKALVFYAGKAPKGIKTN 132 FFS DRKY N SR NRA GYWK TG D+ + +A+G+KK LVF++G+APKG +TN Sbjct: 69 FFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHSSRAVGMKKTLVFHSGRAPKGARTN 128 Query: 133 WIMHEYRLANVDRSAAAAKKNQNLRLDDWVLCRIYNKKGS 172 W+MHEYRL N + A + D +VLCRI+ K G+ Sbjct: 129 WVMHEYRLDNQELEKAGI-----VEKDAYVLCRIFQKSGT 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3455 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226808946 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9602 (808 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12739 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6823 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19045 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18573 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12900 (322 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226799534 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28541 (531 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28491 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3203 204 6e-55 >Contig3203 Length = 204 Score = 204 bits (518), Expect = 6e-55, Method: Compositional matrix adjust. Identities = 105/169 (62%), Positives = 134/169 (79%), Gaps = 4/169 (2%) Query: 1 MKRFGSSESLGALVSNFPSKEEGKLA-KDKYGYSKEFQAMLDSLEQEDIGEE---MSGKK 56 MKR GSS+SLGAL+S P+ + + ++ + YS++FQ+MLD L++E EE ++ KK Sbjct: 1 MKRLGSSDSLGALISICPTTTADEHSPRNNHVYSRDFQSMLDGLDEEGCVEESGHVAEKK 60 Query: 57 RRLSSEQVKALERSFEVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQLERDY 116 RRLS EQVKALE++FEVENKLEPERKVKLA+ELGLQPRQVA+WFQNRRARWKTKQLERDY Sbjct: 61 RRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDY 120 Query: 117 SALKADYDGLKHNYDSLERQNKALAEKLSQLKAKLCTEGAESNGSAKEQ 165 LKA+YD LK ++DSL+ N+AL +++ +LKAK E ESN S KE+ Sbjct: 121 GVLKANYDSLKISFDSLQHDNQALHKEIKELKAKFQEENTESNHSVKEE 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19141 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3819 (362 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13719 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2976 126 5e-32 >Contig2976 Length = 136 Score = 126 bits (317), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 67/106 (63%), Positives = 71/106 (66%), Gaps = 4/106 (3%) Query: 18 LVHKPSVGAPSSTVLALPSLARKGRVSCSMEGK---KESNXXX-XXXXXXXXXXXXXXXX 73 LVHKPSVGAPSST+LALPS+ KG++ CSME K KESN Sbjct: 18 LVHKPSVGAPSSTILALPSIGNKGKLRCSMEAKPPMKESNSNIGMSASLVAAALAATMSS 77 Query: 74 XXXXXLVDDRLSTEGTGLPFGLSNNLLGWILFGVFGLIWTFYFIYT 119 LVDDRLSTEGTGLPFGLSNNLLGWIL GVF LIWTFYF YT Sbjct: 78 PAAMALVDDRLSTEGTGLPFGLSNNLLGWILLGVFALIWTFYFTYT 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32118 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5558 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8275 (380 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1991 322 2e-90 >Contig1991 Length = 284 Score = 322 bits (826), Expect = 2e-90, Method: Compositional matrix adjust. Identities = 155/283 (54%), Positives = 194/283 (68%) Query: 3 STAGLVIPCTAAVAWEAGKPLVMERVEVAPPQAMEVRVKIKYTSLCHTDLYFWEAKGQTP 62 +T G VI C AAVAWE KPLV+E V+VAPPQA EVRV+I YT+LCHTD Y W K Sbjct: 2 ATQGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVRILYTALCHTDAYTWGGKDPEG 61 Query: 63 LFPRIFGHEASGIXXXXXXXXXXXXXXDHVLPVFTGECGDCAHCKSEESNMCDLLRINTD 122 LFP I GHEA+GI DHV+P + ECG+C CKS ++N+C +R T Sbjct: 62 LFPCILGHEAAGIVESVGEGVTTVQPGDHVIPCYQAECGECKFCKSGKTNLCGKVRAATG 121 Query: 123 RGVMLSDEKPRFSINGTPINHFVGTSTFSEYTVIHSGCLAKINPLAPLDIVCILSCGITT 182 GVM+SD + RFSING PI HF+GTSTFS+YTV+H +AKI+P APL+ VC+L CG+ T Sbjct: 122 VGVMMSDRQSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCGVPT 181 Query: 183 GLGATLNVAKPKKGSSVAIFXXXXXXXXXXXXXRISGASRIIGVDRNPKRFEEAKKFGVN 242 GLGA N AK + GS VAIF + +GASRIIGVD + K+F+ AK FGV Sbjct: 182 GLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKTAGASRIIGVDIDSKKFDIAKNFGVT 241 Query: 243 EFVNPKDHDKPVQEVIAEMTNGGADRSIECTGNINAMISAFEC 285 EFVNPKDH+KP+Q+V+ ++T+GG D S EC GN++ M +A EC Sbjct: 242 EFVNPKDHEKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALEC 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6548 (451 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27547 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15188 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71826098 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3518 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486536 (83 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25668 (535 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226742903 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1900 311 2e-87 >Contig1900 Length = 451 Score = 311 bits (797), Expect = 2e-87, Method: Compositional matrix adjust. Identities = 156/174 (89%), Positives = 156/174 (89%) Query: 19 EIVDLCLDRIRKLAYNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVY 78 EIVDLCLDRIRKLA NCTGLQGFLVFNAV VDYGKKSKLGFTVY Sbjct: 113 EIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY 172 Query: 79 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 138 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS Sbjct: 173 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 232 Query: 139 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 192 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL Sbjct: 233 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 286 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2543 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2950 125 2e-31 >Contig2950 Length = 216 Score = 125 bits (313), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 59/160 (36%), Positives = 94/160 (58%) Query: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 K+VL+GD G GK++L+ RF +F +STIG F T+ + +++ +K IWDTAGQER Sbjct: 14 KVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQER 73 Query: 72 YHSLAPMYYRGXXXXXXXYDITSMDSFLRAKKWVLEVQRQANPTLIMFLAGNKADLEDKR 131 Y ++ YYRG YD+T +F ++W+ E++ + +++ L GNKADL R Sbjct: 74 YRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLR 133 Query: 132 KVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKL 171 V E+ + +A+ F+ETSA + NV F E+ ++ Sbjct: 134 AVSVEDAKAFAERENTFFMETSALESMNVENAFSEVLTQI 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1247 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29234 (344 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158362347 69 5e-14 >158362347 Length = 220 Score = 68.6 bits (166), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 60/221 (27%), Positives = 100/221 (45%), Gaps = 23/221 (10%) Query: 2 VLEDHCRAGPRNVVISGSTRGLGKALAREFLLSGDRVVVASRSPESVQATVRELEENLRE 61 V+ G R V+I+G ++GLG+ALA E G V+ SRS + + + EL + Sbjct: 3 VVASQAANGGRTVLITGVSKGLGRALAVELAKRGHTVIGCSRSQDKLTSLQSELSSD--- 59 Query: 62 GINSAGGLSKNLKHAKVVGVACDVCEAGDVQKLANFAVSELGHIDIWINNAGANKGFRPL 121 H + +A DV +Q+LA + + G DI +NNAG L Sbjct: 60 ------------NH---LFLAADVSSNSSIQELARIVMEKKGVPDIIVNNAGVINSNNKL 104 Query: 122 LQFTDEDIKQIVSTNLVGSILCTREAMRIMMNQAKG---GHIFNMDGAGSGGSSTPLTAV 178 + ++ ++ TN+ G R + +M+ + G I NM +G G S A Sbjct: 105 WEVPADEFDGVIDTNVKGVANVLRHFIPLMLKRDPAPATGIIVNMS-SGWGRSGAAHVAP 163 Query: 179 YGSTKCGLRQLQSSLLKECKGSKVGVHTASPGMVLTDLLLS 219 Y ++K + L S+ KE + + +PG++ TD+L+S Sbjct: 164 YCASKWAVEGLTRSVAKELP-KDMAIVALNPGVIHTDMLVS 203 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761285 (46 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4244 (308 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6365 (256 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22441 (367 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57896440 66 3e-13 >57896440 Length = 244 Score = 65.9 bits (159), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Query: 119 DYYEILGVERSCTVEDVRKAYRKLSLKVHPDKNKA--PGAEEAFKSVSKAFQCLSNQESR 176 DYY++L VE+S T ++++KAYRKL++K HPDKN AE FK +S+A++ LS+ + R Sbjct: 4 DYYKLLQVEKSATEDELKKAYRKLAMKWHPDKNPTNKKEAETKFKQISEAYEVLSDPQKR 63 Query: 177 KKYDVMGSD 185 YD G + Sbjct: 64 AIYDQYGEE 72 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5233 (79 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7103 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6932 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3765 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6950 (358 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19889 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5264 70 9e-15 >Contig5264 Length = 447 Score = 70.1 bits (170), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 53/195 (27%), Positives = 93/195 (47%), Gaps = 2/195 (1%) Query: 1 MPICDVIKSSSQGQVSACGKLEAGALRSGFKVLVMPSGESGTVRLLERDSQACAIARAGD 60 +P+ DV K G V G++E G ++ G V P+G + V+ +E +A A GD Sbjct: 236 LPLQDVYKIGGIGTV-PVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGD 294 Query: 61 NVAVTLQGIDGGRVMAGGVLCH-PSFPVAVAKHLELKVLVLDVTTPILIGSQLEFHIHHA 119 NV ++ + + G V + P A + +V++++ I G H + Sbjct: 295 NVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTS 354 Query: 120 KEAARVVKISSLLDPKTGKVTRKAPRCLTAKQSAVVEVILHAPVCVEEFSNSRALGRAFL 179 A + +I + +D ++GK K P+ L S +V+++ P+ VE FS LGR + Sbjct: 355 HIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGRFAV 414 Query: 180 RALGSTIAVGVVTRI 194 R + T+AVGV+ + Sbjct: 415 RDMRQTVAVGVIKNV 429 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28976 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2074 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380944 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24201 (434 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19252 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig479 105 1e-25 >Contig479 Length = 158 Score = 105 bits (262), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 48/85 (56%), Positives = 67/85 (78%), Gaps = 1/85 (1%) Query: 42 TCPKDTLKLGACVDLLG-LVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALGLN 100 TCP+D LKLG C ++L L+N+ IG+PP CC L++GL+DLEAA+CLCT I+A+ LG+N Sbjct: 74 TCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGIN 133 Query: 101 MEVPVALSLLVSACQKTVPPGFKCE 125 + +P+ALSLL++AC VP GF+C Sbjct: 134 LNIPIALSLLLNACGNQVPRGFQCS 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27035 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6103 (363 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9892 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4888 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27130 (494 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22262 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig119 491 e-141 >Contig119 Length = 300 Score = 491 bits (1264), Expect = e-141, Method: Compositional matrix adjust. Identities = 236/287 (82%), Positives = 256/287 (89%) Query: 1 MPFVKSQKSRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60 M F+K+ K RAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI Sbjct: 1 MAFIKASKPRAYFKRFQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60 Query: 61 VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE 120 VAQI+S++I+GDLVLA+AY+HELP YGL VGLTNYAA+YCTGLLLARR LKKLEMD+EYE Sbjct: 61 VAQIISSTISGDLVLASAYSHELPRYGLHVGLTNYAASYCTGLLLARRTLKKLEMDEEYE 120 Query: 121 GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFXXXXXXXXXXXXIPHSEKRFA 180 GN+EATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVF +PHSEKRFA Sbjct: 121 GNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFA 180 Query: 181 GFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYK 240 GFSKDSK LDAE HRKYIYGGHVAAYM TL EDEPEKYQTHFSEYIKKGIEA+ IEELYK Sbjct: 181 GFSKDSKSLDAETHRKYIYGGHVAAYMGTLIEDEPEKYQTHFSEYIKKGIEAEGIEELYK 240 Query: 241 KVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF 287 KVHAAIRADP KKT K PK+HKR+NLKKLT++ERK KL+ERL AF Sbjct: 241 KVHAAIRADPLEKKTAKPEPKQHKRFNLKKLTYEERKNKLIERLNAF 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9171 (496 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9060 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20202 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9543 (535 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158350521 103 2e-24 >158350521 Length = 226 Score = 103 bits (258), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 68/227 (29%), Positives = 117/227 (51%), Gaps = 22/227 (9%) Query: 31 NKYAFACAILA----SMTSILLGYDIGVMSGAAIYIKDD-------LKISDVEVEVLLGI 79 + Y+ A+L ++ +L GYDIG S A I ++ +S VE+ ++ Sbjct: 4 DNYSVLAAVLPFLFPALGGLLYGYDIGATSCATISVESATLSGVSWYDLSSVEIGLITSG 63 Query: 80 LNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGVG 139 +LIGS A +D +GRR+ ++ + ++ +GA++ A + ++ GR V GIG+G Sbjct: 64 SLYGALIGSVLAFNIADIIGRRWELISSAIVYLIGAIVTALAPDLPIMVIGRVVFGIGIG 123 Query: 140 YALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPTHL--GWRLMLG 197 A+ AP+Y AE +P+ RG L S E F I+LG V+ Y L + GWR M G Sbjct: 124 LAMHAAPMYIAETAPSQIRGRLISLKEFF----IVLGMVAGYGIGSLLVSIVGGWRYMYG 179 Query: 198 VGAIPSIFLAVGVLAMPESPRWLVMQGRLGDATRVLDKTSDSKEESM 244 ++ + +G+ +PESPRW++++ G +D K+ ++ Sbjct: 180 ASVPLAVIMGIGMWWLPESPRWILLRAIQGKG-----NMNDLKQNAI 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48275353 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4775 171 2e-45 >Contig4775 Length = 399 Score = 171 bits (432), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 80/99 (80%), Positives = 84/99 (84%) Query: 18 EEEPPRSPQSXXXXXXXXXXXXNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEY 77 E+E PR+PQS NSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEY Sbjct: 27 EDEGPRTPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPVEY 86 Query: 78 IQCDISDPDDAKTKLSPLTDVTHIFYVTWTNRSTDAENC 116 IQCD+SD DDAK KLSPLTDVTHIFYVTWTNRST+AENC Sbjct: 87 IQCDVSDADDAKGKLSPLTDVTHIFYVTWTNRSTEAENC 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32502 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9661 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226779444 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91029865 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17724 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10799 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 246 9e-68 >158372667 Length = 230 Score = 246 bits (628), Expect = 9e-68, Method: Compositional matrix adjust. Identities = 133/234 (56%), Positives = 161/234 (68%), Gaps = 6/234 (2%) Query: 3 IRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVAAA 62 + IA G E P+ RA + EF++T +F+FAG GS MA KL D T L A Sbjct: 1 MAKIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKLGAD---TTVALFFIA 57 Query: 63 LAHAFGLFVAVTISA-NISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGLL 121 + HA L VAV ISA +ISGGH+NPAVT G GG+I+L R +LYWI QLL A +C LL Sbjct: 58 ITHA--LVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLL 115 Query: 122 KLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIGF 181 K +T G TT SL+ GVG ++EI++TF L++TVYAT +DPKKGS+ + P GF Sbjct: 116 KYLTGGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGF 175 Query: 182 IVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYE 235 +VGANILAGGAF GASMNPA SFGPALVSW W +HWVYW GPLIG G+AG IYE Sbjct: 176 VVGANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYE 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13441 (361 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5205 189 2e-50 >Contig5205 Length = 347 Score = 189 bits (481), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 105/218 (48%), Positives = 119/218 (54%), Gaps = 7/218 (3%) Query: 1 MGEKKESPKNDGEXXXXXXXXXXXXGLNIFIFKTDIHCEGCAKKIKRAVKNFEGVEQVKT 60 MGEK E KN+GE G N ++KTD+HCEGCAKKIKRAVKNF GVEQVKT Sbjct: 1 MGEKVEGAKNEGEKKAADAGKKVDDGSNTVVYKTDMHCEGCAKKIKRAVKNFPGVEQVKT 60 Query: 61 DSAANKLTVTGKVDPAGXXXXXXXXXXXXVDLVSPQXXXXXXXXXXXXXXXXXXXXXXXX 120 D+ ANKLTVTGK+DPA VDLVSPQ Sbjct: 61 DAGANKLTVTGKMDPAALKARLEEKIKKKVDLVSPQ-------PAKKEGGGGGGDKKADE 113 Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAVVLKIRLHCEGCMQKMKSKISKFKGVNN 180 S V LKIRLHCEGC+QKM+SKI K+KGV+ Sbjct: 114 KSEKPSEKKAEEKKPADKKPIEKEAAAPKESTVPLKIRLHCEGCIQKMRSKILKYKGVST 173 Query: 181 VSFDASKDLVTVKGFMDVKELVPYLKEKFRRAVEVVPP 218 VSFD +KDLVTV G MD K LVPYL EKF+R V+V+ P Sbjct: 174 VSFDMAKDLVTVVGTMDTKTLVPYLSEKFKRPVDVIAP 211 Score = 103 bits (256), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 48/74 (64%), Positives = 53/74 (71%), Gaps = 2/74 (2%) Query: 288 MSKMEXXXXXXXXXXXXXXDEGHVYNHNKFVMEAQAHQAHISQGSSSHGYAVPMEHYPAP 347 ++KME D GHVYNHNKFVMEAQ HQAH++QG YA+PMEHYPAP Sbjct: 276 VNKMEYSGYPYAASTSYWYDPGHVYNHNKFVMEAQEHQAHVNQGYGH--YAMPMEHYPAP 333 Query: 348 QMFSDENPNGCSVM 361 QMFSDENPNGCSVM Sbjct: 334 QMFSDENPNGCSVM 347 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25555 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32102 (494 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226797160 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26338 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1760 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2684 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14168 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48735581 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48269198 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 61752123 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2536 (365 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23103 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6183 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48382362 (218 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10579 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23352 (437 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4512 796 0.0 >Contig4512 Length = 440 Score = 796 bits (2057), Expect = 0.0, Method: Compositional matrix adjust. Identities = 382/440 (86%), Positives = 407/440 (92%), Gaps = 3/440 (0%) Query: 1 MATAVSTIGSVNRAPPNLNGXXXXXXXXXXTFLGSSLKKVNSRFTNSKVSSGSLRIVAS- 59 MATAVST+G+VNRA +LNG +F+GSSLKKVNSRF +SKVSSGS +IVA+ Sbjct: 1 MATAVSTVGAVNRALLSLNGSSGNASVPSSSFMGSSLKKVNSRFPSSKVSSGSFKIVAAE 60 Query: 60 --VDEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYIST 117 +DED QT+KD+WKGLAFD SDDQQDITRGKG VD+LFQAP G GTH AIMSSY+YIST Sbjct: 61 SEIDEDTQTNKDKWKGLAFDESDDQQDITRGKGMVDTLFQAPMGDGTHMAIMSSYDYIST 120 Query: 118 GLRQYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCEL 177 GLR YN DN DG+YIAPAFMDKLVVHITKNFM LPNIK+PLILGIWGGKGQGKSFQCEL Sbjct: 121 GLRTYNMDNMKDGFYIAPAFMDKLVVHITKNFMNLPNIKIPLILGIWGGKGQGKSFQCEL 180 Query: 178 VFAKMGISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGRL 237 VFAKMGISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGR+ Sbjct: 181 VFAKMGISPIMMSAGELESGNAGEPAKLIRQRYREAADIIRKGKMCALFINDLDAGAGRM 240 Query: 238 GGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIIVTGNDFSTLYAPLIRD 297 GGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPI+VTGNDFSTLYAPLIRD Sbjct: 241 GGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPIVVTGNDFSTLYAPLIRD 300 Query: 298 GRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEV 357 GRMEKFYWAPTREDRIGVC GIF++D+V DIVKLVDTFPGQSIDFFGALRARVYDDEV Sbjct: 301 GRMEKFYWAPTREDRIGVCTGIFKADSVPDSDIVKLVDTFPGQSIDFFGALRARVYDDEV 360 Query: 358 RKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYL 417 RKWI+GVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLAD+YL Sbjct: 361 RKWISGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADQYL 420 Query: 418 SEAALGDANSDAMNTGTFYG 437 SEAALGDAN+DA++ GTFYG Sbjct: 421 SEAALGDANADAIDRGTFYG 440 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7985 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210147361 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283069 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12672 (318 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54682321 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27484 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10209 (443 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24958 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30274 (59 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14289 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26728 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265854 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1166 82 1e-18 >Contig1166 Length = 136 Score = 81.6 bits (200), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 48/99 (48%), Positives = 59/99 (59%), Gaps = 2/99 (2%) Query: 25 AGLQFPVGRIARFLKAGKYAE-RVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKNRIV 83 AG+QFPVGRI R LK A RVGA A GNA++D K RI Sbjct: 35 AGIQFPVGRIHRQLKQRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRIT 94 Query: 84 PRHIQLAVRNDEELSKLLGAVTIANGGVMPNIHQNLLPK 122 PRH+QLA+R DEEL L+ TIA GGV+P+IH++L+ K Sbjct: 95 PRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINK 132 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9627 (473 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158350521 76 4e-16 >158350521 Length = 226 Score = 75.9 bits (185), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 55/177 (31%), Positives = 93/177 (52%), Gaps = 10/177 (5%) Query: 50 YEFGCCAGYSSPTESAIQEDLS---LSLSEYSMFGSILTFGAMVGAITIGPIADFLGRKG 106 Y+ G + + ESA +S LS E + S +GA++G++ IAD +GR+ Sbjct: 27 YDIGATSCATISVESATLSGVSWYDLSSVEIGLITSGSLYGALIGSVLAFNIADIIGRRW 86 Query: 107 ALRVSCAFCVAGWLAIYFSKAAWSLDIGRLLTGYGMGAFSYVVPIFVAEIAPKNLRGRLT 166 L S + G + + + IGR++ G G+G + P+++AE AP +RGRL Sbjct: 87 ELISSAIVYLIGAIVTALAPDLPIMVIGRVVFGIGIGLAMHAAPMYIAETAPSQIRGRLI 146 Query: 167 AANQLMIVTGVSASFIIGVLV-----SWRTLALIGLIPCAVTL-LGLFFIPESPRWL 217 + + IV G+ A + IG L+ WR + +P AV + +G++++PESPRW+ Sbjct: 147 SLKEFFIVLGMVAGYGIGSLLVSIVGGWRYMYGAS-VPLAVIMGIGMWWLPESPRWI 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4847 (293 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27856 (545 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32864 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25908 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13779 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9935 (521 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2751 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46601835 (113 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19101 (400 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226777607 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48391514 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2584 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31992 (566 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5193 144 1e-36 >Contig5193 Length = 545 Score = 144 bits (364), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 139/545 (25%), Positives = 230/545 (42%), Gaps = 52/545 (9%) Query: 29 FNVNNLTVTRLCQNQSITVVNESYPGPTIYAREGDTLIIHVLNQSPYNITIHWHGIYQLL 88 +NV + L Q ++N +PGP I + D LII+V N + W+GI Q Sbjct: 35 WNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDNLIINVFNSLDEPFLLSWNGIQQRH 94 Query: 89 SAWADGPAYVTQCPIPPGQSYTYKFNITGQEGTLWWHAHISWLRATV-HGALIIHPKAGQ 147 +++ DG Y T CPIPPG++ TY + Q G+ ++ +++ +A G + I + Sbjct: 95 NSFQDG-VYGTTCPIPPGRNLTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRILSRPRI 153 Query: 148 SFPFPKPAKEVPIILGDWYSGNVVDIEQEGLSKGIAPNLSNAYTINGLPGDLYDCSQNQT 207 PFP P+ + +++GDWY N ++ L +G + ING NQ Sbjct: 154 PVPFPDPSGDYTVLIGDWYKSNHTTLKAH-LDRGKKLPFPDGILINGR-------GPNQ- 204 Query: 208 YQLSVVRGKTYLLRLINAALNTQLFFKIANHNMTVVAIDASYTTPYDTDVVVIAPGQTTD 267 + L+ +GKTY LR+ N L L F+I +H M +V ++ ++T + + GQ+ Sbjct: 205 FSLTFEQGKTYRLRISNVGLQHSLNFRIQDHKMKLVEVEGTHTLQTTYSSLDVHVGQSYS 264 Query: 268 ILVKFNQLNGSYYMAATPYASADDTVGFDNSTTRGIIVYKGYTSSTPIMPPMPNPHDTPL 327 +LV +Q YY+ + S TT GI+ Y G + + P+P + Sbjct: 265 VLVTADQPGHDYYIVVSSRFSTPIL------TTTGILHYSG--AGGQVSGPIPGGPTIQI 316 Query: 328 ------AHKFFTNLTGLPGGPHWVPVPRKVDEHMFVTVGVNLAMCPENTTCQGLFNNRFS 381 A TNLT GP P P+ + +NL + G N + Sbjct: 317 DWSLNQARSIRTNLTA--SGPR--PNPQGSYHYGL----INLTKTYILASAAGQVNGKQR 368 Query: 382 ASMNNESFMAPTNTSMLEAHFNNVNGVYTRDFPNEPPVKFDYTDTNLSLDLSLIFAPKST 441 +N+ SF+ P +T + A + ++GV+ ++ P T NL LD S++ A Sbjct: 369 YGINSVSFV-PADTPLKLADYFKISGVFRVGSVSDRP-----TGGNLYLDTSVLGA---- 418 Query: 442 KVKTLKFNSTVQLVFQNTAFLAIENHPMHLHGFDFHVLAQGFGNYDPINDPKKFNFVNPQ 501 + + V++VFQN + HL G+ F V+ G + + +N + Sbjct: 419 -----DYRTFVEIVFQNDEDIV---QSYHLDGYQFFVVGMDGGKWTTASR-NGYNLRDAV 469 Query: 502 VRNTIGVPVGGWAVIRFRANNPGIWYVHCHLDVHLPWGLAMAFEVENGGTPESTLPPPPL 561 R+T V W I +N G+W + G + V T P P Sbjct: 470 ARSTTQVYPFSWTAIYLSLDNVGMWNLRTEFWARQYLGQQLYLRVYTSSTSIRDEYPIPR 529 Query: 562 DLPKC 566 + C Sbjct: 530 NARLC 534 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13962 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8306 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6579 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig839 268 1e-74 >Contig839 Length = 152 Score = 268 bits (684), Expect = 1e-74, Method: Compositional matrix adjust. Identities = 130/152 (85%), Positives = 135/152 (88%) Query: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 MSLVANEEFQHILRV+NTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVDMNKRAGELS Sbjct: 1 MSLVANEEFQHILRVMNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60 Query: 61 AAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 A E++ LM IVANPRQFKIPDWFLNRKKDYKDG+YSQVV+NALDMKLRDDLERLKKIRNH Sbjct: 61 AQEIENLMHIVANPRQFKIPDWFLNRKKDYKDGKYSQVVANALDMKLRDDLERLKKIRNH 120 Query: 121 RGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 152 RGLRHYWGLRVRGQH SKKR Sbjct: 121 RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6779 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32493 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46991714 (56 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5463 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 15184581 (68 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27776 (419 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13992 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25110 (205 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig934 138 2e-35 >Contig934 Length = 283 Score = 138 bits (348), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 62/85 (72%), Positives = 76/85 (89%) Query: 20 IETGTKLYISNLDYGVSNEDIKELFSEVGDLKRYGVHYDRSGRSKGTADVVFSRRTDAAA 79 IE GTKLY+SNL YGV+NEDI+ELFSE+G+LKRY VH+D++GR G+A+VV++RR+DA A Sbjct: 96 IEIGTKLYVSNLHYGVTNEDIRELFSEIGELKRYAVHFDKNGRPSGSAEVVYTRRSDAFA 155 Query: 80 AVKRYNNVQLDGKPMKIEIVGTNIG 104 A+KRYNNV LDGKPMKIEIVG N G Sbjct: 156 ALKRYNNVLLDGKPMKIEIVGVNEG 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32822 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7248 (582 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2090 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7350 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226784615 (123 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226796879 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239938 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6224 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28069 (447 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1985 266 2e-73 >Contig1985 Length = 156 Score = 266 bits (679), Expect = 2e-73, Method: Compositional matrix adjust. Identities = 124/148 (83%), Positives = 137/148 (92%), Gaps = 1/148 (0%) Query: 1 MMLRIKRVPTVVSNYQKDEAEEGARRVEGCGRNCLNQCCIPGAKLPLYAFKKRNVNNGDT 60 MML+IKRVPTVVSNYQKDEA+EG RR GCGRNCLN+CCI GAKLPLYAFKK+N + G+ Sbjct: 1 MMLKIKRVPTVVSNYQKDEADEG-RRAGGCGRNCLNKCCISGAKLPLYAFKKQNNSPGEK 59 Query: 61 GVPGHDKREPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQYGFIAQLNEGRHL 120 G GH+K++ PVAFLDSL+LGEWEDRMQ+GLFRYDVTACETKVIPGQ+GFIAQLNEGRHL Sbjct: 60 GFSGHEKQDAPVAFLDSLVLGEWEDRMQKGLFRYDVTACETKVIPGQFGFIAQLNEGRHL 119 Query: 121 KKRPTEFRVDKVLQPFDSSKFNFTKVGQ 148 KKRPTEFRVDKVLQPFD SKFNFTKVG+ Sbjct: 120 KKRPTEFRVDKVLQPFDGSKFNFTKVGK 147 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21954 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3278 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24131 (311 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3643 112 2e-27 >Contig3643 Length = 279 Score = 112 bits (280), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 83/241 (34%), Positives = 109/241 (45%), Gaps = 30/241 (12%) Query: 54 GPLLSGK-ITINLIWYGNFKPSQKAIVXXXXXXXXXXXXXKTPQPSVAAWWQTTEKYYHL 112 GP+LS I I LIWYG + QK ++ P PSVA WW+T Y Sbjct: 2 GPVLSSHPINIYLIWYGRWSLPQKLLIKDFLLSISTTA---APSPSVAEWWRTVSLY--- 55 Query: 113 TXXXXXXXXXXXXXGRQILDQSYSLGKSLT---TKQIVALAAK-----GDQKNAINVVLT 164 T + D YS GK+LT +Q++ A + D K+ I +VLT Sbjct: 56 TDQTGANVSRSVVVAGEHADVKYSQGKALTRLSVQQVIGNAVRSAPFPADHKHGIYLVLT 115 Query: 165 SADVAVDGFCMNRCGTHGSASGSFKTGHTKGSKNSKFAYIWVGNSETQCPGQCAWPFHQP 224 S DV + FC CG H S G+T Y W+GNS QCP CA+PF P Sbjct: 116 SDDVTMQDFCRAVCGFHYFTFPSM-VGYT-------LPYAWIGNSAKQCPEVCAYPFALP 167 Query: 225 IY----GPQSPPLVAPNNDVGLDGMVINLASLMAGTATNPFGNGYFQGP-AEAPLEASSA 279 Y GP + L PN DVG+DGM+ + +A ++NP N ++ G AP E Sbjct: 168 AYMGGGGPGA--LSPPNKDVGVDGMISVIGHELAELSSNPLVNAWYAGEDPTAPTEIGDL 225 Query: 280 C 280 C Sbjct: 226 C 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32276 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55698874 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8357 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31382 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31382 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8447 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812304 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13975 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5524 345 1e-97 >Contig5524 Length = 241 Score = 345 bits (886), Expect = 1e-97, Method: Compositional matrix adjust. Identities = 167/241 (69%), Positives = 193/241 (80%), Gaps = 4/241 (1%) Query: 1 MASSECCSNPPALNPSSGSGHVEKLGGFDSYVTGSPDSKLAVLLVHDAFGYEAPKARMLA 60 M+ +CCSNPP LNP+SGSGHVEKLGG DSY+TGSPDSKLA++LV D FGY+AP R LA Sbjct: 1 MSGPQCCSNPPTLNPTSGSGHVEKLGGLDSYLTGSPDSKLAIVLVSDIFGYDAPNLRKLA 60 Query: 61 DKIAAAGFIVVLPDFFNRDPF----NGDLASIPVWIKAHAPDKTIEDAKLVIEALKSKGV 116 DKIAAAGF V+PDFF DP+ +G L S+P W+K H DK ED K+VIEALKSKGV Sbjct: 61 DKIAAAGFFAVVPDFFYGDPYVPAADGSLDSLPAWLKGHGADKGFEDVKVVIEALKSKGV 120 Query: 117 SAIGAVGFCWGGKGVVELAKHDFIQAAVLCHPSFVTLDDIKAVKVPISVLGAEIDQLTPP 176 AIGAVGFCWG K VVELAK DFIQAAVL HPSFVTLDDIKAVKVPIS+LGAEID+++PP Sbjct: 121 CAIGAVGFCWGAKVVVELAKGDFIQAAVLAHPSFVTLDDIKAVKVPISILGAEIDRMSPP 180 Query: 177 EVVKQFEEVLTAKPEIKSHVKIFPKIAHGWTLRYNXXXXXXXXXXXXXHQDLLGWFLEHI 236 E+VKQFEE LTAK EIKSHVKIFPK++HGWT+RY+ H+D+L WF+ H+ Sbjct: 181 ELVKQFEEALTAKSEIKSHVKIFPKVSHGWTVRYDVSDKEAVKPAEEAHKDMLDWFVNHV 240 Query: 237 K 237 K Sbjct: 241 K 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31917 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48487994 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5524 96 6e-23 >Contig5524 Length = 241 Score = 95.5 bits (236), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 52/83 (62%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Query: 1 KGFEDAKPVLEALKSKGVSAIGAAGFCWGAKVVVELSKHALIQAAVLCHPSLVTVDDIKG 60 KGFED K V+EALKSKGV AIGA GFCWGAKVVVEL+K IQAAVL HPS VT+DDIK Sbjct: 103 KGFEDVKVVIEALKSKGVCAIGAVGFCWGAKVVVELAKGDFIQAAVLAHPSFVTLDDIKA 162 Query: 61 -KIPVVIFRKYLIHYWNKKLVSH 82 K+P+ I + +LV Sbjct: 163 VKVPISILGAEIDRMSPPELVKQ 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10594 (408 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27400 (266 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91022484 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5239 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57896440 117 6e-29 >57896440 Length = 244 Score = 117 bits (292), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 5/96 (5%) Query: 15 FEDWGPG----NGPKKAAAIVRTLPCTLEELYNGATKKLKISRDVLGASGRKSTVEEVLT 70 F +G G +GP+KA+ + R LPC+LEELY G TKK+KISR++ ASGR VEE+LT Sbjct: 150 FSSFGEGRPMSHGPRKASPLERKLPCSLEELYKGTTKKMKISREIADASGRTMPVEEILT 209 Query: 71 IEIKPGWKKGTKITFQEKGPDTRRGVIPADIVFIVD 106 IE+KPGWKKGTKITF EKG + IPAD+VFI+D Sbjct: 210 IEVKPGWKKGTKITFPEKG-NEHPNEIPADLVFIID 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7028 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17486 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91034490 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10810 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24129 (370 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2264 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31892 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21945 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6378 (299 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1568 252 2e-69 >Contig1568 Length = 297 Score = 252 bits (643), Expect = 2e-69, Method: Compositional matrix adjust. Identities = 160/304 (52%), Positives = 179/304 (58%), Gaps = 19/304 (6%) Query: 5 LGFWVVEVKAGEPLKVVPEESSVIHLSQATLGELKKGGDQCVIHVKVGNQKLVLANLSSD 64 + FW VEVKAGEP+KV P+ +V+HLSQA LGE KK D VI+ K QKLVL +L Sbjct: 1 MEFWGVEVKAGEPMKVKPDLGNVVHLSQACLGEAKKAADSVVIYGKAKEQKLVLGHLIPS 60 Query: 65 KIPQIPFDLVFDKEFELSHNLKSGSVHFCGYQTCLA------XXXXXXXXXXXXXXLPLN 118 +IPQ+ FDLVFD+EFELSHN K+GSVHF GYQ+ + LP+ Sbjct: 61 QIPQLSFDLVFDEEFELSHNWKNGSVHFAGYQSVMGDDDDNSSEYDSSDSEEEEEELPVI 120 Query: 119 FTDNGKVVAAKPAPPKTNAVKPESSGKQKVNIVEPIKXXXXXXXXXXXXXXXXXXXXXXX 178 T+NGKV AKPA K NAVKPESSGKQKV I EP K Sbjct: 121 ATENGKVENAKPASAKNNAVKPESSGKQKVKIEEPTKDEVDEDESASDMDDSMDSDDMD- 179 Query: 179 XXXMLGAXXXXXXXXXXXXXXXTPTPKK-NSKKRPNES-TPKTPVSAKKAK--QVTPQKT 234 TP PKK SKKR S + KTPVSAKKAK TPQKT Sbjct: 180 ------DSDDESEDDSDEEDEETPAPKKPESKKRAQVSESAKTPVSAKKAKIDTTTPQKT 233 Query: 235 DGKKGAHTATPHPAKKGGKTPATSDKSKPQTPKSAGGDHSCKPCNKSFNSDGALSSHKKA 294 D KKG HT TPHPAKK GKTPAT DKSK QTPKSAGG+ S C+K+F SDGAL SH KA Sbjct: 234 DAKKGGHTDTPHPAKK-GKTPAT-DKSKAQTPKSAGGNFSWGSCSKAFGSDGALQSHNKA 291 Query: 295 KHGA 298 KH A Sbjct: 292 KHSA 295 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27175 (545 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig168 (522 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4717 149 4e-38 >Contig4717 Length = 244 Score = 149 bits (375), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 84/192 (43%), Positives = 116/192 (60%), Gaps = 7/192 (3%) Query: 100 PSVKELGHHAGYYRLPRSNAASMFYLFFES-RTNKNNPVVIWLTGGPGCSS-ELALFYEN 157 P VK +AGY + ++ ++FY FFE+ +T ++ P+V+WL GGPGCSS E Sbjct: 48 PPVK-FDQYAGYVTVNETHGRALFYWFFEAVKTPQDKPLVLWLNGGPGCSSIGYGASEEL 106 Query: 158 GPFRIQKNLS--LTWNDYGWDKASNILFVDQPVGTGFSYTTNSADIRHDEEGVS-NDLYD 214 GPF QK L +N Y W+ A+N+LF++ PVG GFSYT + DI + ++ D + Sbjct: 107 GPFFPQKGAKPKLKYNPYTWNNAANLLFLESPVGVGFSYTNTTKDISQLGDTITAEDSHK 166 Query: 215 FLQEFFTQHPQFAKNDFYITGESYAGHYVPALASRVHKGNK-AKEGTHINLKGFAIGNGL 273 FL +F + PQ+ +DFYITGESY GHYVP L+ V+ NK A + T+IN KGF IGN Sbjct: 167 FLINWFKRFPQYKSHDFYITGESYGGHYVPQLSELVYDRNKNASKETYINFKGFMIGNAA 226 Query: 274 TNPEIQYKAYSD 285 + E K D Sbjct: 227 IDDETDQKGLID 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21943 (420 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4974 605 e-175 >Contig4974 Length = 423 Score = 605 bits (1561), Expect = e-175, Method: Compositional matrix adjust. Identities = 313/422 (74%), Positives = 334/422 (79%), Gaps = 7/422 (1%) Query: 3 GRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLS 62 GRAPKKSDN++YYEILGVSK+ASP+D+KKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLS Sbjct: 5 GRAPKKSDNSKYYEILGVSKTASPEDVKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLS 64 Query: 63 DPEKREIYDQYGEDALKEXXXXXXXXXHDPFDIXXXXXXXXXXXXXXXXXXXXXXXX--- 119 DPEKREIYD+YGED LKE HDPFDI Sbjct: 65 DPEKREIYDRYGEDGLKEEMQSGG---HDPFDIFSSFFGGGGSPFGGMPGGSSRGRRQRR 121 Query: 120 -EDVVHALKVSLEDLYLGTSKKLSLSRNVLCSKCNGKGSKSGASLKCSGCQGSGMKVSIR 178 EDVVH LKVSLEDLYLGTSKKLSLSRNVLCSKC GKGSKSGAS KC GCQG+GMKV+IR Sbjct: 122 GEDVVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCKGKGSKSGASTKCGGCQGTGMKVTIR 181 Query: 179 HLGPSMIQQMQHACNECKGTGETISDRDRCTQCXXXXXXXXXXXXXXXXXXGMQNGQKIT 238 HLGPSMIQQMQHACNECKGTGETISD+DRC QC GMQNGQKIT Sbjct: 182 HLGPSMIQQMQHACNECKGTGETISDKDRCGQCKGEKVVHEKKVLEVHVEKGMQNGQKIT 241 Query: 239 FPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGR 298 FPGEADEAP+TVTGDIVF+IQQKEHPKFKRK +DLFVEH+LSLT+ALCGFQFVL HLDGR Sbjct: 242 FPGEADEAPDTVTGDIVFIIQQKEHPKFKRKMDDLFVEHSLSLTDALCGFQFVLNHLDGR 301 Query: 299 QLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLSPEQVKALEAA 358 QLLIKSNPGEVVKPDSFKA+NDEGMPMYQRPFMKGKLYIHF+V+FPE+LSPEQVKALEAA Sbjct: 302 QLLIKSNPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVDFPETLSPEQVKALEAA 361 Query: 359 LPGKPSASQLTDMEVDECEETTLHDVNXXXXXXXXXXXXXXXXXXXXXXMPGGAQRVQCA 418 LP + S+ QLTDME+DECEETTLHDVN MPGGAQRVQCA Sbjct: 362 LPSRASSQQLTDMELDECEETTLHDVNMEEEMRRKQHQAHSEAYDEDDDMPGGAQRVQCA 421 Query: 419 QQ 420 QQ Sbjct: 422 QQ 423 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13021 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4163 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2565 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10760 (403 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig982 748 0.0 >Contig982 Length = 534 Score = 748 bits (1931), Expect = 0.0, Method: Compositional matrix adjust. Identities = 346/399 (86%), Positives = 375/399 (93%) Query: 1 MGNAFLLQGGDCAESFKEFNANNIRDTFRILLQMGVVLMFGGQMPVVKVGRMAGQFAKPR 60 MGNAFLLQGGDCAESFKEF+ANNIRDTFR++LQMGVVLMFGGQM VVKVGRMAGQFAKPR Sbjct: 133 MGNAFLLQGGDCAESFKEFSANNIRDTFRVMLQMGVVLMFGGQMNVVKVGRMAGQFAKPR 192 Query: 61 SDSFEEKDGVKLPSYRGDNVNGDAFDLQSRTPDPQRLIRAYCQSAATLNLLRAFATGGYA 120 S + EEK+G+ LP Y+GDN+NG+AFD +SR PDPQRLIRAYCQSAATLNLLR+FATGGYA Sbjct: 193 SAAVEEKNGITLPVYKGDNINGEAFDEKSRIPDPQRLIRAYCQSAATLNLLRSFATGGYA 252 Query: 121 AMQRVTQWNLDFTEHSEQGDRYRELASRVDEALGFMTAAGLTIDHPIMTTTEFWTSHECL 180 AMQRVTQWNLDF EHSEQGDRY+ELA RVDEALGFM+AAGLT+DHPIM TTEFWTSHECL Sbjct: 253 AMQRVTQWNLDFAEHSEQGDRYQELAHRVDEALGFMSAAGLTVDHPIMRTTEFWTSHECL 312 Query: 181 LLPYEQSLTRLDSTSGLYYDCSAHMLWVGERTRQLDGAHIEFLRGVANPLGIKVSDKMDP 240 LPYEQ+LTR DSTSGL+YDCSAHMLW GERTRQLDGAH+EFLRG++NP+G+KVS+ MDP Sbjct: 313 HLPYEQALTREDSTSGLFYDCSAHMLWCGERTRQLDGAHVEFLRGISNPIGVKVSNTMDP 372 Query: 241 NELVKLIEILNPQNKAGRITVITRMGAENMRVKLPHLIRAVRRAGQIVTWVSDPMHGNTI 300 +LV LIEILNP NK GRIT+I RMGAENMRVKLPHLIRAVR+AGQIVTWV DPMHGNTI Sbjct: 373 KDLVNLIEILNPTNKPGRITIICRMGAENMRVKLPHLIRAVRQAGQIVTWVCDPMHGNTI 432 Query: 301 KAPCGLKTRPFDAIRAEVRAFFDVHEQEGSHPGGVHLEMTGQNVTECIGGSRTVTFDDLS 360 KAPCGLKTRPFDAI AEVRAFFDVHEQEGSHPGG+HLEMTGQNVTECIGGSRTVTFDDLS Sbjct: 433 KAPCGLKTRPFDAILAEVRAFFDVHEQEGSHPGGIHLEMTGQNVTECIGGSRTVTFDDLS 492 Query: 361 SRYHTHCDPRLNASQSLELAFIIAERLRKRRIKSQNPLA 399 SRYHTHCDPRLNASQ+LELAFIIAERLRKRRI +Q L+ Sbjct: 493 SRYHTHCDPRLNASQALELAFIIAERLRKRRIGTQRLLS 531 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10288 (79 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11716 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig491 (109 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12174 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11104 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226784313 (64 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig120 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10854 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20988 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12973 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18043 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56430564 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11290 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48289683 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9025 (213 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486593 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7482 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23598 (52 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24142 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27809 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16472 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 221848062 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22837 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32625 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51293454 (68 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27725 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812619 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2437 85 2e-19 >Contig2437 Length = 408 Score = 84.7 bits (208), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 44/99 (44%), Positives = 57/99 (57%), Gaps = 1/99 (1%) Query: 4 PPMIITENGMDDPNKRFIPLEKALNDEKRITFHRDYLSNLSAAIRQDNCDVRGYFVWSLL 63 P + ITENG P+E+A D RI +H D+L L AI+ D V+GY+ WS Sbjct: 309 PNIFITENGYAYGYNASTPIEEARKDNLRIRYHHDHLWYLLKAIK-DGVQVKGYYAWSFF 367 Query: 64 DNWEWNMGYTVRFGLYYVDYKKNLTRIPKTSVQWFRTLL 102 D++EW+ GYTV FGL VD K NL R K S W++ L Sbjct: 368 DDFEWDAGYTVGFGLTLVDVKDNLKRYLKYSAYWYKMFL 406 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239599 (64 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7788 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4792 476 e-137 >Contig4792 Length = 259 Score = 476 bits (1225), Expect = e-137, Method: Compositional matrix adjust. Identities = 236/264 (89%), Positives = 242/264 (91%), Gaps = 10/264 (3%) Query: 1 MXXXXXXXTLLRTTPFLGQSRGPSFNTLKDVVPMGTGKYTMGNDLWYGPDRVKYLGPFSA 60 M TLLR P+ N+L+DVVPMG GKYTMGN+LWYGPDRVKYLGPFSA Sbjct: 6 MAAAASSSTLLR----------PNTNSLRDVVPMGPGKYTMGNELWYGPDRVKYLGPFSA 55 Query: 61 QTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWVR 120 QTPSYL GEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGA GCITPEVLEKWVR Sbjct: 56 QTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGAFGCITPEVLEKWVR 115 Query: 121 VDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVILMGLVEGFRINGLDGV 180 VDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLG QV+LMGLVEGFRINGLDGV Sbjct: 116 VDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGSQVLLMGLVEGFRINGLDGV 175 Query: 181 GEGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEN 240 GEGN+LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEN Sbjct: 176 GEGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEN 235 Query: 241 LLDHLDNPVANNAWVYATKFVPGS 264 LLDHLDNPVANNAWVYATKFVPGS Sbjct: 236 LLDHLDNPVANNAWVYATKFVPGS 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51098750 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5249 (345 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9610 (418 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51561065 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226763001 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18983 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6600 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3439 131 2e-33 >Contig3439 Length = 200 Score = 131 bits (330), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 63/90 (70%), Positives = 70/90 (77%), Gaps = 5/90 (5%) Query: 1 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRXXXXXXXXXXXXSLIDQRIKEHLGN 60 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVR SLIDQ+IKE +G Sbjct: 1 MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRQYYQQFEEQQNQSLIDQKIKELIGQ 60 Query: 61 SAAYGGQPYGQIGAAYNQHLMAQPRLPGMP 90 +AA YGQ+GAAYNQHLMA+PR+P +P Sbjct: 61 NAA-----YGQVGAAYNQHLMARPRMPILP 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20959 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21511 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2618 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3566 110 5e-27 >Contig3566 Length = 175 Score = 110 bits (274), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 60/166 (36%), Positives = 95/166 (57%), Gaps = 15/166 (9%) Query: 3 AGKQVMVIGADDSEEGHYALEWTLDHLFKPLGGDTAPFKLIIVHAKPXXXXXXGFVGPAG 62 +G++ +++ D+SE HYAL W +D+L + + ++ L+I A+P F P G Sbjct: 13 SGEKPVMVAVDESECSHYALMWVIDNLKESINTNSP---LLIFMAQPPPANNITFAAPLG 69 Query: 63 A---------EVLPIVDADLKKMAARVTERAKEFCASKSVT-DVVVEVMEGDARNVLCEA 112 + E + + +K+ + ERAK+ CAS VT V E+ GDA+ +C A Sbjct: 70 SARMYCPPTPEFTNNMQENHRKLTTALLERAKDICASHGVTAKTVTEI--GDAKTAICAA 127 Query: 113 VERHHASILVVGSHGYGAIKRALLGSVSDYCAHHVHCTVMIVKKPK 158 V +H+ +LV+G G G IKRA+LGSVS+YC + C V++VKKP+ Sbjct: 128 VLKHNVKLLVLGERGLGKIKRAILGSVSNYCVLNAKCPVLVVKKPQ 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7125 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158357974 103 2e-25 >158357974 Length = 97 Score = 103 bits (258), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 59/102 (57%), Positives = 67/102 (65%), Gaps = 5/102 (4%) Query: 1 MARSFSNAKFLSVLVVDGFSSSISRRXXXXXXXXXXXXXXXXXXXTNPRSVNITKKNSGE 60 MARSFSNAK LS LV S++I+RR + RSVN+ KK SGE Sbjct: 1 MARSFSNAKLLSALV----SNTIARRGYAAGSPGLAAVRGEVAAASVTRSVNLEKK-SGE 55 Query: 61 EKVGSTFKVSWVPDPKTGVYGPENGTAKIDAAELRAALLKKH 102 +KVGS FKVSWVP+PKTGVYGPEN +ID AELR ALLKKH Sbjct: 56 DKVGSVFKVSWVPNPKTGVYGPENRADEIDVAELRNALLKKH 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51240999 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28471 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18742 (277 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46602678 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48940805 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26077 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9979 (342 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4729 102 3e-24 >Contig4729 Length = 303 Score = 102 bits (255), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 86/288 (29%), Positives = 131/288 (45%), Gaps = 42/288 (14%) Query: 30 MRILVTGGAGFIGSHLVDKLMENEKNEVIVADNYFTGSKDNLKKWIGHP---RFEL---- 82 M I + G GFIGSHL +KLM ++V+ D Y K L+ GHP R + Sbjct: 18 MTICMIGAGGFIGSHLCEKLMAETPHKVLALDVYNDKIKHLLEPSDGHPWSDRIQFHRLN 77 Query: 83 IRHDV-TEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILL 141 I+HD E L+ D +LA +P Y P+ TI +N I L ++ R++ Sbjct: 78 IKHDSRLEGLIKTSDLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIH 137 Query: 142 TSTSEVYG---------------DPLIHPQTEN----YWGNVNPIGVRSCYDEGKRVAET 182 ST EVYG DP + EN +G++ R Y K++ E Sbjct: 138 FSTCEVYGKTIGSFLPKDSPLRQDPEYYLLKENDSPCIFGSIE--KQRWSYACAKQLIER 195 Query: 183 LMFDYHRQHGIEIRIARIFNTYGPRMNIDDG---------RVVSNFIAQAIRNDPLTVQA 233 L++ ++G+E I R FN GPRM+ G RV++ F +R +PL + Sbjct: 196 LIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRREPLKLVD 255 Query: 234 PGTQTRSFCYVSDMVDGLIRLMQG---DNTGPINIGNP-GEFTMLELA 277 G R+F Y+ D +D ++ +++ N N+GNP E T+ +L Sbjct: 256 GGESQRTFVYIKDAIDAVMLMIENPARANGHIFNVGNPNNEVTVRQLG 303 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56433206 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51240017 (71 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9527 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2700 382 e-109 >Contig2700 Length = 202 Score = 382 bits (981), Expect = e-109, Method: Compositional matrix adjust. Identities = 185/201 (92%), Positives = 189/201 (94%) Query: 47 MSAEWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILV 106 MSAEWMPG+PRPPYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILV Sbjct: 1 MSAEWMPGQPRPPYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILV 60 Query: 107 PEALGLGNWVKAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPE 166 PEALGLGNWVKAQEWAA+PGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPE Sbjct: 61 PEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPE 120 Query: 167 KKKYPGGAFDPLGYSKDPXXXXXXXXXXXXNGRLALLAFVGFVVQQSAYPGTGPLENLAT 226 KKKYPGGAFDPLGYSKDP NGRLALLAFVGFVVQQSAYPGTGPLENLAT Sbjct: 121 KKKYPGGAFDPLGYSKDPKKFEEYKVKEVKNGRLALLAFVGFVVQQSAYPGTGPLENLAT 180 Query: 227 HLADPWHNNIGDVIIPKGILP 247 HLADPWHNNIGD+IIPKG+LP Sbjct: 181 HLADPWHNNIGDIIIPKGLLP 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71812892 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26368 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11002 (231 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18726 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14855 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10804 (576 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4283 827 0.0 >Contig4283 Length = 582 Score = 827 bits (2137), Expect = 0.0, Method: Compositional matrix adjust. Identities = 432/590 (73%), Positives = 466/590 (78%), Gaps = 26/590 (4%) Query: 1 MCKVSKDKLSPSNFIMESEFQKQK-------SVLVELSASDNLDAFRTEVEEKGFHVDEA 53 MCK SK+ + SNFIMESEFQKQ SVLVELSASDNLDAFR+EVEEKG HVDEA Sbjct: 1 MCKGSKNTVISSNFIMESEFQKQNGAGLNKSSVLVELSASDNLDAFRSEVEEKGLHVDEA 60 Query: 54 GFWYGRRIGSKQMGFEERTPLMIAAMFGSTKVLKYIIESGMVDVNRSCGSDRVTALHCAA 113 FWYGRRIGSK+MGFEERTPLMIAAMFGSTKVL+YIIESG VDVNRSCGSDRVTALHCA Sbjct: 61 SFWYGRRIGSKKMGFEERTPLMIAAMFGSTKVLRYIIESGKVDVNRSCGSDRVTALHCAT 120 Query: 114 AGGSTASLEVVKLLLDASADANCVNAYGNSPVDLIAPALKSPCSSRRKAMEMLFRGDKSV 173 AGGS++SLEVVKLLLDASADANCVNA GN PVDLIAPA KS C+ RRKAMEML +GD S+ Sbjct: 121 AGGSSSSLEVVKLLLDASADANCVNANGNKPVDLIAPAWKSSCNLRRKAMEMLLKGDMSL 180 Query: 174 MESDQIAIEEGDQRKVSSPQMPKEGSDKKEYPIDISLPDINNGIYGTDEFRMFTFKVKPC 233 + SD D ++V S Q+ KEGS+KKEYPIDI+LPDINNGIYG+DEFRM+TFKVKPC Sbjct: 181 LGSDI------DDQEVPSLQLLKEGSEKKEYPIDIALPDINNGIYGSDEFRMYTFKVKPC 234 Query: 234 SRAYSHDWTECPFVHPGENARRRDPKKYPYSCVPCPEFRKGSCQKGDACEYAHGVFESWL 293 SRAYSHDWTECPFVHPGENARRRDP+KYPYSCVPCPEFRKGSCQKGD CEYAHGVFESWL Sbjct: 235 SRAYSHDWTECPFVHPGENARRRDPRKYPYSCVPCPEFRKGSCQKGDVCEYAHGVFESWL 294 Query: 294 HPAQYRTRLCKDETGCTRKVCFFAHRPEELRPVYASTGSAMPSPRSMSVSAADMATLSPL 353 HPAQYRTRLCKDETGCTRKVCFFAH+PEELRPVYASTGSAMPSPRSMS A DM T+SPL Sbjct: 295 HPAQYRTRLCKDETGCTRKVCFFAHKPEELRPVYASTGSAMPSPRSMSACAGDMTTMSPL 354 Query: 354 ALGXXXXXXXXXXXXXXXXXXXXXXXKNGGLWQNKVSLTPPTLQLPGSRLKSACSARDXX 413 ALG KNGGLWQNKV+LTPP LQLPGSRLKSA SARD Sbjct: 355 ALG-SPSLSMPTTSTPPMSPIASSSPKNGGLWQNKVNLTPPALQLPGSRLKSASSARDLD 413 Query: 414 XXXXXXXXDXXXXXXXXXXXXXXLWDEIXXXXXXX--XXXXXGELKPTNLEDAFGSFDPS 471 D +WDE+ GELKPTNL+D FGSFDPS Sbjct: 414 LEMEFLGRD----HANQQQQQQHMWDEMSRLSSPSCYNNSRMGELKPTNLDDVFGSFDPS 469 Query: 472 LLSQLQA---HSQKPSTP--THRQNMNQLRSSYPTNLSSSPVRKPSSFGLDSPSALAAAV 526 LLSQLQA SQ S+P RQNMNQLRSSYP+NLSSSPVRKPSSFGLDSP+ALAAAV Sbjct: 470 LLSQLQALSTQSQLQSSPGLQSRQNMNQLRSSYPSNLSSSPVRKPSSFGLDSPAALAAAV 529 Query: 527 MNSRSAAFAQQRSQSFIDRGAMNHLSGLNAPVNSSTMRQSSDWSSPGGKL 576 +NSRSAAFA +RS SFIDRGA+NHL G + NS+TM SSDW+SP GKL Sbjct: 530 INSRSAAFA-KRSHSFIDRGAVNHLQGFTSAANSNTMMSSSDWNSPSGKL 578 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15399 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28902 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 384 e-109 >89552756 Length = 189 Score = 384 bits (985), Expect = e-109, Method: Compositional matrix adjust. Identities = 183/189 (96%), Positives = 185/189 (97%) Query: 20 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 79 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR Sbjct: 1 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 60 Query: 80 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSNMVTEKIDVYSFGIVMWELLT 139 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKS+MVTEKIDVYSFGIVMWELLT Sbjct: 61 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLT 120 Query: 140 GDEPYRDMHCASIIGGIVNNTLRPQIPPWCDPEWKSLMESCWAPEPSQRPSFSEISQKLR 199 GDEPY DMHCASIIGGIVNNTLRPQIP WCDPEWKSLMESCW EP+QRPSFSEISQKLR Sbjct: 121 GDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQKLR 180 Query: 200 NMAAAMNVK 208 NMAAAMNVK Sbjct: 181 NMAAAMNVK 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5567 (69 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9875 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89540794 86 2e-19 >89540794 Length = 177 Score = 85.9 bits (211), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 39/77 (50%), Positives = 56/77 (72%) Query: 192 RLYVGNLAWGVDNLALENLFSEQGKVLEAKVVFDRDSGRSRGFGFVTYDTADEMNSAIES 251 R +VG LAW DN ALE F+ G+++E+K++ DR++GRSRGFGFVT+ M AIE Sbjct: 9 RCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEKAMRDAIEG 68 Query: 252 LDGVDLNGRSIRVSAAE 268 ++G DL+GR+I V+ A+ Sbjct: 69 MNGQDLDGRNITVNEAQ 85 Score = 64.3 bits (155), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 34/79 (43%), Positives = 46/79 (58%) Query: 84 ASPEPKLFVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGFVTMSNVQEAE 143 A E + FVG L ++ D+ L F G + ++I D+ TGRSRGFGFVT SN + Sbjct: 4 AEIEFRCFVGGLAWATDNDALERAFAPFGEIIESKIINDRETGRSRGFGFVTFSNEKAMR 63 Query: 144 SAARQLNGYELDGRALRVN 162 A +NG +LDGR + VN Sbjct: 64 DAIEGMNGQDLDGRNITVN 82 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30141 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4660 194 2e-52 >Contig4660 Length = 151 Score = 194 bits (494), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 108/151 (71%), Positives = 116/151 (76%), Gaps = 4/151 (2%) Query: 1 MDIISRSTT-MSSNLNPNAPMFVPLAYRTVEDFSAEWWALVQSSPWFQDYWLQERFQDPQ 59 MDIISR S+LNPNAPMFVP AYR VEDFS EWWALVQSSPWF+DYWLQE F DPQ Sbjct: 1 MDIISRQQPPQQSSLNPNAPMFVPSAYRAVEDFSTEWWALVQSSPWFRDYWLQENFHDPQ 60 Query: 60 NDPSFSDIHDPALLSD---VDALFDDVENIHHSRNTQAAEEEEKDLNKELVSLGLLKWRK 116 NDP FSD++D A L D +D LFD+ AEEEEKD +KELVSLGLLKW K Sbjct: 61 NDPFFSDVNDAAFLDDSDYIDDLFDEQHYPTADNKKVEAEEEEKDYHKELVSLGLLKWPK 120 Query: 117 GRPVAEAPRYIEKAAKFVNVKVSPRAIQQPR 147 GRPVA APR+IEKA KFVNVKVSPRAIQQPR Sbjct: 121 GRPVANAPRFIEKAPKFVNVKVSPRAIQQPR 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825009 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 159 1e-41 >Contig3037 Length = 313 Score = 159 bits (402), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 71/124 (57%), Positives = 97/124 (78%), Gaps = 1/124 (0%) Query: 1 MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKYGTGGNWIALPQKAGLRRCGKSCRLRWLN 60 MGR+PCC+KA+ KG W+ EED +L +YI +G G W +LP++AGL RCGKSCRLRW+N Sbjct: 1 MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGC-WRSLPKQAGLLRCGKSCRLRWIN 59 Query: 61 YLRPNIKHGEFSDEEDRIICNLFTNIGSRWSIIAAQLPGRTDNDIKNYWNTKQKKKLMGI 120 YLRP++K G F++EED +I L + +G++WS+IA +LPGRTDN+IKNYWNT K+KL+ Sbjct: 60 YLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTR 119 Query: 121 SILP 124 + P Sbjct: 120 GLDP 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15951 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15346 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418420 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31648 (296 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26608 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26019 (320 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10738 (362 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1991 61 8e-12 >Contig1991 Length = 284 Score = 61.2 bits (147), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 57/232 (24%), Positives = 87/232 (37%), Gaps = 18/232 (7%) Query: 39 DVRFKVLYCGICHTDLHNIKNEWGISLYPMVPGHEIVGEVTEVGSKVSKVKEGDKVGVGC 98 +VR ++LY +CHTD + + L+P + GHE G V VG V+ V+ GD V + C Sbjct: 36 EVRVRILYTALCHTDAYTWGGKDPEGLFPCILGHEAAGIVESVGEGVTTVQPGDHV-IPC 94 Query: 99 MVGACHACESCNSNLENYCPKM--ILTYGSIYADRTVTY-------------GGYSDTMV 143 C C+ C S N C K+ G + +DR + +S V Sbjct: 95 YQAECGECKFCKSGKTNLCGKVRAATGVGVMMSDRQSRFSINGKPIYHFMGTSTFSQYTV 154 Query: 144 ANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGLAEPXXXXXXXXXXXXXXXXXXFA 203 ++ + + PL+ L C T + E A Sbjct: 155 VHDVSVAKIDPKAPLEKVCLLGCGVPTGLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGA 214 Query: 204 KAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQQ--MQAAIGTLDGIID 253 K GA + SKK + K G FV +D ++ Q + DG +D Sbjct: 215 KTAGASRIIGVDIDSKKFDIAKNFGVTEFVNPKDHEKPIQQVLVDLTDGGVD 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48939202 (75 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13757 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3127 109 6e-27 >Contig3127 Length = 308 Score = 109 bits (272), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 61/79 (77%), Positives = 63/79 (79%), Gaps = 1/79 (1%) Query: 1 MDS-NPQPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVPSSDXX 59 MDS N PSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTA+PGEIV S+D Sbjct: 1 MDSSNAPPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSSADRS 60 Query: 60 XXXXXXXXXXPVPSRPWEQ 78 PVPSRPWEQ Sbjct: 61 TPNNRNTLGRPVPSRPWEQ 79 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11706 (247 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3252 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32030 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91046338 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17483 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10998 (258 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7431 (376 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22383 (371 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226762459 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8707 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20751 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25548 (443 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17706 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7548 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2475 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1709 81 1e-18 >Contig1709 Length = 110 Score = 81.3 bits (199), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 45/64 (70%), Positives = 49/64 (76%) Query: 32 NTQKMSYNAGVAKGQAQEKTSTMMDKANSAAQSAMGTMQGAGQTVQAKAVGAVDAVKNAT 91 N+QK SY G AKGQ QEK +TMM KA +AAQSA TM AGQT+Q KA GA DAVKNAT Sbjct: 47 NSQKASYQTGEAKGQTQEKANTMMGKAGNAAQSAKETMLNAGQTIQQKAAGAADAVKNAT 106 Query: 92 GMNK 95 GMNK Sbjct: 107 GMNK 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig94 (796 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15448 (464 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48389300 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226779431 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21759 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1132 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5748 484 e-139 >Contig5748 Length = 265 Score = 484 bits (1246), Expect = e-139, Method: Compositional matrix adjust. Identities = 236/265 (89%), Positives = 245/265 (92%) Query: 1 MATSAIQQSAFAGQTALKQSSELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP 60 MATSAIQQSAFAGQTALK S+ELVRKIG LGGGR SMRRTVKSAP+SIWYGPDRPKYLGP Sbjct: 1 MATSAIQQSAFAGQTALKPSNELVRKIGSLGGGRISMRRTVKSAPESIWYGPDRPKYLGP 60 Query: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSR 120 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+LS+ Sbjct: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSK 120 Query: 121 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVXXXX 180 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNL+HAQSILAIWAVQVVLMGFIEGYRV Sbjct: 121 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGGP 180 Query: 181 XXXXXXXXXXXXAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE 240 AFDPLGLADDPEAFAELKVKE+KNGRLAMTSMFGFFVQAIVTGKGP+E Sbjct: 181 LGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIE 240 Query: 241 NLFDHIADPVANNAWAYATNFVPGK 265 NL+DH+ADPVANNAWAYATNFVPGK Sbjct: 241 NLYDHVADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7338 (61 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226790703 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30575 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89555242 68 9e-14 >89555242 Length = 222 Score = 67.8 bits (164), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Query: 1 MVTGDNLQTAKAIALECGILLSL-EDATEPTIIEGKTFRELSEKEREQTAKKI 52 +VT DNLQTAKAIA+ECGIL S DA+E IEG+ FR+LS+ +REQ A+KI Sbjct: 170 LVTHDNLQTAKAIAMECGILASDGSDASEINFIEGEVFRQLSDSQREQLAEKI 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226793466 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14959 (537 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226747176 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24186 (249 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13327 (496 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27867 (626 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5104 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48485736 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825476 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8734 (260 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158360899 395 e-112 >158360899 Length = 246 Score = 395 bits (1016), Expect = e-112, Method: Compositional matrix adjust. Identities = 187/244 (76%), Positives = 205/244 (84%) Query: 16 ATACDRCVKQXXXXXXXXXXXXXXGACGYGSLASGFSGGHLAAGVPSLFKGGAGCGACFQ 75 ATAC RCV Q GACGYGSLA G SGGHLAA VPS++K GAGCG+CFQ Sbjct: 2 ATACYRCVHQTKAAYFSKAPALSSGACGYGSLALGLSGGHLAAAVPSIYKDGAGCGSCFQ 61 Query: 76 MRCKNTTLCTKQGTIVTLTDLNQSNQTDFVLSSRAFAAMAQKGLDQHILRRGILDVEYKR 135 +RCKN TLCTKQGT V +DLN +NQTDFVLSSRAF AMAQKGL Q IL+ GI+DVEYKR Sbjct: 62 IRCKNATLCTKQGTKVITSDLNHNNQTDFVLSSRAFMAMAQKGLGQDILKHGIVDVEYKR 121 Query: 136 VPCEYKNQNLSLRVEESSQKPHYLAVKILYQGGQTEIVAMDVAQVGSSNWSFLSRNNGAI 195 VPCEYKNQNL+LRVEESSQKPHYLAVK+LYQGGQTEIVA+DVAQVGSSNWSFL+RN GA+ Sbjct: 122 VPCEYKNQNLALRVEESSQKPHYLAVKVLYQGGQTEIVAIDVAQVGSSNWSFLTRNYGAV 181 Query: 196 WKTSRVPAGALQFRFVVTSGYDGKTVWAPNVLPVNWKSGMIYDTRVQITDIAQEGCPHCD 255 W TSRVPAGALQFRFVVT G+DGK VWA NVLP +WK GM+YDT+VQI+DIAQEGC CD Sbjct: 182 WDTSRVPAGALQFRFVVTGGFDGKMVWAKNVLPADWKPGMVYDTKVQISDIAQEGCSPCD 241 Query: 256 DGSW 259 DG W Sbjct: 242 DGIW 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22044 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14960 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3685 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91019281 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158352771 75 6e-17 >158352771 Length = 100 Score = 75.5 bits (184), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 36/65 (55%), Positives = 41/65 (63%) Query: 30 TLPQSACTPRCKNRCSATSHKKPCMFFXXXXXXXXXXVPPGVVGNKQMCPCYNNWKTQEG 89 +L S C +C RCS T + KPCMFF VPPG GNK +CPCYNNWKTQ+G Sbjct: 36 SLKSSQCPSQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQG 95 Query: 90 RPKCP 94 PKCP Sbjct: 96 GPKCP 100 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2468 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6539 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14670 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7487 (238 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91039667 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226781173 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10909 (570 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2233 293 2e-81 >Contig2233 Length = 595 Score = 293 bits (749), Expect = 2e-81, Method: Compositional matrix adjust. Identities = 193/585 (32%), Positives = 299/585 (51%), Gaps = 31/585 (5%) Query: 6 DEVVEHIFESVTSQKDRNAVSLVCKSWFRIERFSRERVFIGNCYAISPERVIERFPGLKS 65 D V + + KDR AVSLVC+ W+ ++ +RE V I CY SPER+ RF LKS Sbjct: 14 DVVAGCVMPYIVDAKDREAVSLVCRRWYELDALTREHVTIALCYTTSPERLRRRFSQLKS 73 Query: 66 LTLKGKPHFADFNLVPHEWGGFLQPWIEALADGRVGLEELRLKRMVVSDESLELLSR-LF 124 L LKGKP A FNL+P +WGGF+ PW+E +A+ L+ L +RM+V D LELL+R Sbjct: 74 LKLKGKPRAAMFNLIPEDWGGFVTPWVEEIAESFKSLKHLHFRRMIVRDSDLELLARSRG 133 Query: 125 PNFKSLVLVSCEGFTTEGLAAIAANCRFLKELDLQENDI---DDHRGHWLSCFPESSTSL 181 SL L C GF+T+GL I NCR L+ L L+E+ I +D RG WL ++T L Sbjct: 134 RELLSLKLDKCSGFSTQGLVHITRNCRELRTLFLEESSIIENEDERGEWLHQLAINNTVL 193 Query: 182 VSLNFACLK-GEINLAALERLVARSPDLKVLRLNRAVPPDTLQKVLTQAPQLVDLGTGSY 240 +LNF +I LE + P L ++++ D L A L + GS+ Sbjct: 194 ETLNFYMTDLDKIKFEDLELIARNCPSLTSVKISDREILDLL-GFFHHATALEEFCGGSF 252 Query: 241 VLDSDSDTYNKLKATILKCKSIKSLSGFLEVGPRCLPSIYPILENLTSLNLSYASGVHGS 300 S+ K +++ S G +G +P ++P+ L L+L YA + Sbjct: 253 NDQSEE------KYSVVSLPRKLSRLGLTMMGRNEMPIVFPLAPLLVKLDLLYAL-LDTE 305 Query: 301 ELIELIRQCVKLQRLWILDCIGDKGLGVVAKSCKELQELRV---FPSDPFAAGHASVTEE 357 + LI++C L L + IGD+GL V+A++CK+L+ LR+ V++ Sbjct: 306 DHCTLIQKCPNLIVLETRNVIGDRGLEVLAQNCKKLRRLRIERGADEQEMEDEDGVVSQR 365 Query: 358 GLVAISAGCPKIHSLLYFCQQMTNAALITVAKNCPNFIRFRLCILDPTKPDAVTMQPLDE 417 GL+AI+ GC ++ L + +TN +L + + N FRL +LD + + V+ PLD Sbjct: 366 GLMAIAQGCLELEYLAVYVSDITNTSLECIGTHSKNLTDFRLVLLD--REEIVSDLPLDN 423 Query: 418 GFGAIVQACKKIRRLSL---SGLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNG 474 G A+++ C+K+RR +L G LTD+ Y+G Y+ + + + + G++D G+ G Sbjct: 424 GVRALLRGCQKLRRFALYLRPGGLTDKGLFYVGQYSPNVRWMLLGYVGETDTGLEDFSRG 483 Query: 475 CKKLRKLEIRDSPFGNKALLRDVGKYEAMRSLWMSSCEVTLGGCKALAKKMPRLNVEIIN 534 C L+KLE+R F +AL V + ++R LW+ + G L P N+E+I Sbjct: 484 CPSLQKLEMRGCCFSERALANAVMQLPSLRYLWVQGYRGSGTGHDLLGMARPYWNIELIP 543 Query: 535 ENDQMDLDDE---------QRVEKMYLYRTLVGKRRDTPEFVWTL 570 ++D+ D+ + + Y +L G R D P+ V L Sbjct: 544 PR-RVDVSDQSGEAETVVVEHPAHILAYYSLAGPRTDFPDSVIPL 587 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48282335 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25141 (352 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89546967 64 1e-12 >89546967 Length = 114 Score = 64.3 bits (155), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 96 YIGINYSSPTLDSAMSNLTPAFTFILAVFFRMESLALRSYSTQAKIMGTLVSISGALVVV 155 Y+G+ Y++ T +AMSN+ PA TF++A R+E + L +Q K++GT +++GA+++ Sbjct: 25 YLGMKYTTATFAAAMSNILPALTFVMAWILRLEKVKLTCIRSQCKLLGTAATVAGAMIMT 84 Query: 156 LYKGP 160 L KGP Sbjct: 85 LVKGP 89 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25777 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16126 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89558627 242 1e-66 >89558627 Length = 243 Score = 242 bits (617), Expect = 1e-66, Method: Compositional matrix adjust. Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 2/150 (1%) Query: 85 KRVWVWTESKQVMTAAVERGWNTFVFPSQSRELADEWSSIALIDTLFIEEGAILDGENRR 144 K VWVWTESKQVMTAAVERGWNTFVF QS++LAD+WSSIALID L ++EG I D EN R Sbjct: 8 KTVWVWTESKQVMTAAVERGWNTFVF--QSQKLADDWSSIALIDPLLMKEGGIFDSENTR 65 Query: 145 VATMLEVANPKELELLQPEKALGENVVVDLLDWQVIPAENIVAAFQGSGKTVFAVSKTAL 204 VAT+ EV++P+ELE LQPE +GENVVVDLLDWQVIPAENIVAAFQGS KTVFAVSKT + Sbjct: 66 VATVFEVSSPEELEQLQPENGVGENVVVDLLDWQVIPAENIVAAFQGSQKTVFAVSKTPV 125 Query: 205 EAQVFFEALEHGLGGVILKIEEVKALLDLK 234 EAQVFFEALEHGLGGV+LK+E+V+A+LDLK Sbjct: 126 EAQVFFEALEHGLGGVVLKVEDVQAVLDLK 155 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8538 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14424 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27473 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25217 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10895 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12709 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226771428 (71 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21491 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9606 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10179 (434 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4064 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31570 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10220 (356 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5225 336 9e-95 >Contig5225 Length = 321 Score = 336 bits (862), Expect = 9e-95, Method: Compositional matrix adjust. Identities = 159/183 (86%), Positives = 173/183 (94%), Gaps = 3/183 (1%) Query: 1 MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQALLKKHEVFVVEGD 60 MSVLVTGAAGF+GSHCSLALKKRGDGVLGLDNFNSYYDPSLKR+RQA+LKKHE+F+VE D Sbjct: 108 MSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQAMLKKHEIFIVEAD 167 Query: 61 LNDEPLLTKLFDVVPFTHILHLAAQAGVRYAMQNPQSYVSSNIAGFVNLLEVAKRANPQP 120 LND P+LTKLFDVVPFTH+LHLAAQAGVRYAMQNPQSYV+SNIAGFVNLLE++K ANPQP Sbjct: 168 LNDGPMLTKLFDVVPFTHVLHLAAQAGVRYAMQNPQSYVASNIAGFVNLLEISKAANPQP 227 Query: 121 SIVWASSSSVYGLNTDNPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSL---TGL 177 +IVWASSSSVYGLNT+NPFSELHRTDQPASLYAATKKAGEEIAHTYNHIY + +GL Sbjct: 228 AIVWASSSSVYGLNTENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYKPTTDLASGL 287 Query: 178 RFF 180 R F Sbjct: 288 RKF 290 Score = 69.7 bits (169), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Query: 311 YKPTTDLASGLRKFVKWYVSYYGIESRVKKEMDSGKKGSQQTDESG 356 YKPTTDLASGLRKFVKWYVSYYGIESRVK E SQQ +ES Sbjct: 277 YKPTTDLASGLRKFVKWYVSYYGIESRVKTE-SKKMMMSQQPEESA 321 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31347 (459 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7726 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 65 6e-13 >89552756 Length = 189 Score = 64.7 bits (156), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 59/213 (27%), Positives = 95/213 (44%), Gaps = 38/213 (17%) Query: 71 NGSLHDFLHLSDEYNKPLTWNSRVKIALGTARALEYLHEVCSPSIIHKNIKSTNILLDVE 130 NGSL FL D + + R+ IA+ A +EYLH +I+H ++K N+L+++ Sbjct: 3 NGSLKQFLQKKD---RTIDRRKRLIIAMDAAFGMEYLH---GKNIVHFDLKCENLLVNMR 56 Query: 131 LNPH-----LSDAGLASSIPNADQALDHNAGSG---YSAPEVAMSGQ---YTLKSDVYGF 179 +P + D GL+ Q L G + APE+ +SG+ T K DVY F Sbjct: 57 -DPQRPVCKIGDLGLSKV---KQQTLVSGGVRGTLPWMAPEL-LSGKSHMVTEKIDVYSF 111 Query: 180 GVVMLELLSGRKAFDNLKPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFA 239 G+VM ELL+G + + + +H + +V+ L+ P + Sbjct: 112 GIVMWELLTGDEPYTD----------------MHCASIIGGIVNNTLRPQIPTWCDPEWK 155 Query: 240 DVIALCVQPEPEFRPPMSEVVQALVRLVQRANM 272 ++ C EP RP SE+ Q L + N+ Sbjct: 156 SLMESCWGSEPAQRPSFSEISQKLRNMAAAMNV 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9034 (386 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3804 502 e-144 >Contig3804 Length = 391 Score = 502 bits (1292), Expect = e-144, Method: Compositional matrix adjust. Identities = 256/391 (65%), Positives = 288/391 (73%), Gaps = 5/391 (1%) Query: 1 MCGGAIISDFIAPVRSRRLTADYLWPDLKKPSSGKRLS---KPLKSEIVDLDDDFEADFQ 57 MCGGAIIS FI P RSRR+TAD+LWPDLKK SSGKR S +PL+SEI LDDDFEADFQ Sbjct: 1 MCGGAIISGFIPPTRSRRVTADFLWPDLKKSSSGKRFSSGGRPLRSEIFGLDDDFEADFQ 60 Query: 58 EFKXXXXXXXXXXXXXXKPSAFSAGNPS-FARGSTAVKSVEFDGQAEKSAKRKRKNQYRG 116 EFK KP AFSAG PS ARG VKSVE + QAEKSAKRKRKNQYRG Sbjct: 61 EFKDDSDVDDDEDMLDSKPFAFSAGKPSPAARGPKTVKSVECNSQAEKSAKRKRKNQYRG 120 Query: 117 IRQRPWGKWAAEIRDPRKGVRVWLGTFNTXXXXXXXXXXXXXXIRGKKAKVNFPEETPCA 176 IRQRPWGKWAAEIRDPRKGVRVWLGTFNT IRGKKAKVNFPEE P A Sbjct: 121 IRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPEEAPRA 180 Query: 177 SAKRSIKENPQKLIAKTNLNGTQSNPNQNFNFVNDSSEDYYSALGFLDEKPTMNNFRYMS 236 S KR++K NPQK++ KTNL+ QSN NQN NFVN S ++YY+++ FL+EKP NNF YM Sbjct: 181 STKRAVKANPQKVLPKTNLDNMQSNLNQNVNFVNGSDQEYYNSMSFLEEKPQTNNFGYMD 240 Query: 237 TFPANEDVALKSSVPSENAPFYFSSDQGSNSFDCSDFGWGEQGSKTPXXXXXXXXXXXXX 296 + N D +KSS ++ A YFSSDQGSNSFDCSDFGWGEQGS+TP Sbjct: 241 SVLTNGDFGMKSSTVADPAALYFSSDQGSNSFDCSDFGWGEQGSRTPEISSVLSSVLEES 300 Query: 297 DNSPFLEDSNPTKKMKPNSQDLEPPEDNSG-KTLSDELSAFEMKYFQTPYLDESWDASVD 355 +NS FLED+NPTKK+K N + L P E+N KTLS+ELSAFEMKY QTPYL+ SWD S+D Sbjct: 301 ENSLFLEDANPTKKLKANPEGLVPAENNVAPKTLSEELSAFEMKYCQTPYLEGSWDTSID 360 Query: 356 AFLNGDATQDGGNPMDLWSFDDLPAIVGGVF 386 FLNGD TQDG NP+DLWSFDDLP++ GGVF Sbjct: 361 TFLNGDMTQDGCNPVDLWSFDDLPSMAGGVF 391 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226747027 (190 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4113 229 1e-62 >Contig4113 Length = 368 Score = 229 bits (583), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 109/186 (58%), Positives = 135/186 (72%), Gaps = 3/186 (1%) Query: 3 SEPVNVNEYQELARQALPKMYYDFHTGGAEDQHTLKENVEAFRRITLRPRILVDVSRIDM 62 E NV+EY+ +A+Q LPKM YD++ G+EDQ TL EN AF +I RPRIL+DVS IDM Sbjct: 2 GEVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNIDM 61 Query: 63 STTVLGYKISAPIMLAPTSMHQLAHPEGEVXXXXXXXXCNTIMILSSISSCTVEEVASSC 122 +TTVLG+KIS PIM+APT+ ++AHPEGE TIM LSS ++ +VEEVAS+ Sbjct: 62 TTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTG 121 Query: 123 NSVRFFQLYVFKRRDISAQIVRRAEENGYKAIVLTVDAPRPGRREADIKNKMVAP---QL 179 +RFFQLYV+K R + AQ+VRRAE G+KAI LTVD PR GRREADIKN+ P L Sbjct: 122 PGIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTL 181 Query: 180 RNFEGL 185 +NFEGL Sbjct: 182 KNFEGL 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30418 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28229 (502 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25763 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16124 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31969 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27622 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5118 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 52024425 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158370739 304 2e-85 >158370739 Length = 180 Score = 304 bits (779), Expect = 2e-85, Method: Compositional matrix adjust. Identities = 143/183 (78%), Positives = 157/183 (85%), Gaps = 3/183 (1%) Query: 1 MASSMISSATVSTVYTDRAAPAQASMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQC 60 MASSM+SSATV++V AP QASMVAPF GLKS+SAFPVTRK+NDIT++ASNGGRVQC Sbjct: 1 MASSMMSSATVASV---NRAPVQASMVAPFNGLKSASAFPVTRKANDITTLASNGGRVQC 57 Query: 61 MQVWPPLGLKKFETXXXXXXXXXXXXAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSPG 120 MQVWPP+GLKKFET AKEV+YLLR WVPCLEFELEHGFVYRE+ SPG Sbjct: 58 MQVWPPVGLKKFETLSYLPPLSVESLAKEVEYLLRNKWVPCLEFELEHGFVYREHGNSPG 117 Query: 121 YYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP 180 YYDGRYWTMWKLPMFGCTD+SQV+ ELEEAKK YP AFIRIIGFDN+RQVQC+SFIAYKP Sbjct: 118 YYDGRYWTMWKLPMFGCTDASQVIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKP 177 Query: 181 ASY 183 ASY Sbjct: 178 ASY 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13954 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 228 3e-62 >Contig3037 Length = 313 Score = 228 bits (580), Expect = 3e-62, Method: Compositional matrix adjust. Identities = 98/125 (78%), Positives = 114/125 (91%) Query: 2 RKPCCEKEGTNKGAWSKQEDQKLIDYIKTHGEGCWRSLPKAAGLHRCGKSCRLRWINYLR 61 R PCCEK TNKGAW+K+EDQ+LIDYI+ HGEGCWRSLPK AGL RCGKSCRLRWINYLR Sbjct: 3 RSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLR 62 Query: 62 PDIKRGNFEQDEEELIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGID 121 PD+KRGNF ++E+ELIIKLH+LLGN+WSLIAGRLPGRTDNE+KNYWN+HI++KL+ G+D Sbjct: 63 PDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRGLD 122 Query: 122 PNNHR 126 P HR Sbjct: 123 PQTHR 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17400 (139 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29641 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12349 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26787 (444 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19762 (385 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7384 (326 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5776 207 9e-56 >Contig5776 Length = 289 Score = 207 bits (526), Expect = 9e-56, Method: Compositional matrix adjust. Identities = 112/260 (43%), Positives = 154/260 (59%), Gaps = 8/260 (3%) Query: 26 LVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEGCDASIII-ASPNG 84 L +FY +SCP ++SIV + + + + I A LRL HDCFV+GCD S+++ S +G Sbjct: 36 LSWSFYDSSCPKLDSIVRKQLKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLDGSASG 95 Query: 85 DAEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAGGPSFPVE 144 +E+ NLSL F + ++ V ++C VVSCAD+ A+AARD V L+GGP + V Sbjct: 96 PSEQQAPPNLSLRAKAFQIINDLREIVHSKCGRVVSCADLTALAARDAVFLSGGPEYEVP 155 Query: 145 LGRRDGL-ISKASRVAGNLPEPTFNLNQLTTMFAKHNLSLTDVIALSGAHTLGFSHCNRF 203 LGR+DGL + + NLP PT N +L T AK NL TDV+ALSG HT+G HC F Sbjct: 156 LGRKDGLNFATRNETLANLPAPTSNTTKLLTDLAKKNLDATDVVALSGGHTIGLGHCTSF 215 Query: 204 SDRLYNFSPSSTVDPSLNPDYAKQLMATCPIAVDPNIVMTLDPDTPFTFDNAYYRNLVAG 263 + RLY T D S++ +A L CP A D N LD +P TFDN YY +L+ Sbjct: 216 TGRLY-----PTQDASMDKTFANDLKQVCP-AADTNATTVLDIRSPDTFDNKYYVDLMNR 269 Query: 264 KGLLSSDQVLFSDSASRSTV 283 + L +SDQ L++D +R V Sbjct: 270 QCLFTSDQDLYTDKRTRDIV 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10692 (260 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158360899 97 7e-23 >158360899 Length = 246 Score = 97.4 bits (241), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 52/192 (27%), Positives = 97/192 (50%), Gaps = 5/192 (2%) Query: 69 RVGAVNPVLFKSGEGCGACYKIKCLDQSICSRRPVTIIVTDECPGCSKGPAQFDLSGAAF 128 + A P ++K G GCG+C++I+C + ++C+++ +I +D F LS AF Sbjct: 41 HLAAAVPSIYKDGAGCGSCFQIRCKNATLCTKQGTKVITSDL---NHNNQTDFVLSSRAF 97 Query: 129 GRMAVAGEGGLLRNQGELSVLYRRTPCKYPGKQIAFHVNEGSTN-YWLSLLVEFEDGDGD 187 MA G G + G + V Y+R PC+Y + +A V E S ++L++ V ++ G + Sbjct: 98 MAMAQKGLGQDILKHGIVDVEYKRVPCEYKNQNLALRVEESSQKPHYLAVKVLYQGGQTE 157 Query: 188 VGSMHIRPASSSEWIEMSHVWGANWCINGGPLKG-PFSVKITTLSTAKTLSARDVIPGNW 246 + ++ + SS W ++ +GA W + P F +T K + A++V+P +W Sbjct: 158 IVAIDVAQVGSSNWSFLTRNYGAVWDTSRVPAGALQFRFVVTGGFDGKMVWAKNVLPADW 217 Query: 247 SPKATYTSRLNF 258 P Y +++ Sbjct: 218 KPGMVYDTKVQI 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19230 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30239 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2922 59 2e-11 >Contig2922 Length = 223 Score = 59.3 bits (142), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 36/91 (39%), Positives = 50/91 (54%), Gaps = 1/91 (1%) Query: 18 QLKLYSYWMSSCSFRVRIALNLKGLKYEYKALAKGEQFSPEFRKLNPM-GYVPVLVDGDT 76 Q+ + W S +RV AL LKG+ YEY S K NP+ VPVLV Sbjct: 3 QVTVLGAWSSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAGK 62 Query: 77 VVADSFAIILYLEEKYPQHPLLPPDLQKKAI 107 +A+S I+ Y+EE +PQ+PLLP D ++A+ Sbjct: 63 PIAESAVILEYIEETWPQNPLLPKDPHQRAL 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30538 (280 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783864 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158365522 102 1e-24 >158365522 Length = 211 Score = 102 bits (255), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 56/121 (46%), Positives = 72/121 (59%), Gaps = 6/121 (4%) Query: 51 FGNSPELIRSATQILLEENIDQPDDLSCA--VDAAYHVAHSEFEHDTLWGKKVGWVYGSV 108 FG SP I S+ L E+ P S A + A HV +E T WGK+VGW+YGSV Sbjct: 10 FGQSPVFIASS----LMEDGGVPMGTSSASLLKEAIHVISCGYEDKTEWGKEVGWIYGSV 65 Query: 109 TEDVLTGMKIHARGWKSILCMPEPPGFLGAAPSTTHVMLIQRKRGITGLLEILFSKNCPI 168 TED+LTG K+H GW+S+ CMP+ P F G+AP L Q R G +EIL S++CPI Sbjct: 66 TEDILTGFKMHCHGWRSVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPI 125 Query: 169 F 169 + Sbjct: 126 W 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14379 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26880 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775327 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3348 (268 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53859229 (53 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3562 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990999 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22683 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27941 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19704 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 152 1e-39 >Contig3037 Length = 313 Score = 152 bits (383), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 71/119 (59%), Positives = 84/119 (70%), Gaps = 3/119 (2%) Query: 1 MDKKPCNSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRW 60 M + PC + KG WT EED LI+YI HGEG W SL K AGL R GKSCRLRW Sbjct: 1 MGRSPC---CEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRW 57 Query: 61 LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI 119 +NYLRPD++RGN T EE LI++LH+ GN+WS IA LPGRTDNEIKNYW T I++ + Sbjct: 58 INYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKL 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32163 (190 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20015 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29831 (331 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20381 (69 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823766 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10840 (440 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158361786 124 9e-31 >158361786 Length = 186 Score = 124 bits (311), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 52/75 (69%), Positives = 64/75 (85%) Query: 31 MVSWTESGSSFVVWDPTEFAKEMLPMYFKHNNFSSFVRQLNTYGFRKIDPEQWEFANEEF 90 M+SW+E GS+FVVW P EFA+++LP YFKHNNFSSFVRQLNTYGFRK+ P++WEFAN+ F Sbjct: 1 MISWSEGGSTFVVWRPAEFARDILPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANDCF 60 Query: 91 LRGGRHLLKNIHRRK 105 RG + LL+ I RRK Sbjct: 61 KRGEKGLLREIQRRK 75 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783970 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16739 (215 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8015 (256 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24483 (615 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10721 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16424 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24514 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3840 97 8e-23 >Contig3840 Length = 186 Score = 96.7 bits (239), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 55/124 (44%), Positives = 69/124 (55%), Gaps = 11/124 (8%) Query: 1 MKIQCDVCNKDDASVFCTADEAALCDACDHRVHHANKLASKHHRFSLVHPSSKEFPVCDI 60 M+ CD C A VFC ADEAALC ACD +VH NKLAS+H R L PS+ P CDI Sbjct: 1 MRTLCDACESAAAIVFCAADEAALCRACDEKVHLCNKLASRHVRVGLATPSA--VPRCDI 58 Query: 61 CQERRAFLFCQQDRAILCRECDLPIHNANEHTRKHNRYLLT-------GIKLSATSALYK 113 C+ AF +C+ D + LC +CD+ +H + R H RYL+ G K S+ Sbjct: 59 CENAPAFFYCEIDGSSLCLQCDMVVHVGGK--RTHGRYLVLRQRVQFPGDKPSSNGEDPA 116 Query: 114 SSPP 117 S PP Sbjct: 117 SQPP 120 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26370 (406 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89546967 73 3e-15 >89546967 Length = 114 Score = 73.2 bits (178), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 39/89 (43%), Positives = 56/89 (62%) Query: 80 ITLNFLIQFFLLALVGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAAILRIEHVR 139 +TL + +L L+ +Q Y LG+ T+ TFA+A+ N +PA+TF+MA ILR+E V+ Sbjct: 1 MTLAIFTKIMVLGLLEPVLDQNLYYLGMKYTTATFAAAMSNILPALTFVMAWILRLEKVK 60 Query: 140 LNRKDGIAKVLGTVFCVAGASVITLYKGP 168 L K+LGT VAGA ++TL KGP Sbjct: 61 LTCIRSQCKLLGTAATVAGAMIMTLVKGP 89 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27026 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8513 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15287 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28799 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8834 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8789 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11703 (308 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56431713 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16659 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15758 (278 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761363 (59 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5112 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24064 (190 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9058 (494 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13809 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32982 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226750865 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46612112 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24202 (313 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26121 (586 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226810865 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11635 (418 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25511 (242 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13102 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9568 (610 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9457 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4661 444 e-127 >Contig4661 Length = 251 Score = 444 bits (1141), Expect = e-127, Method: Compositional matrix adjust. Identities = 216/252 (85%), Positives = 226/252 (89%), Gaps = 1/252 (0%) Query: 1 MATVTTQASAAIFRPCVNXXXXXXXXXXXXXNREVAFRPMASPPASSFKVEAKKGEWLPG 60 MATVTTQASA ++RP + REVAFRP+ SP ASSFKVEAKKGEWLPG Sbjct: 1 MATVTTQASA-VYRPQITSKSRFLTGSSGKLTREVAFRPVTSPSASSFKVEAKKGEWLPG 59 Query: 61 LPSPDYLTGSLPGDNGFDPLALAEDPENLRWYIQAELVNGRWAMLGVVGMLLPEVFTSIG 120 LPSP YLTGSLPGDNGFDPLALAEDPENL+W++QAELVNGRWAMLGV GMLLPEV TSIG Sbjct: 60 LPSPGYLTGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIG 119 Query: 121 ILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 180 I+NVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP Sbjct: 120 IINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 179 Query: 181 GEVGYPGGIFNPLNFEPTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSD 240 EVGYPGGIFNPLNF PT EAKEKE+ANGRLAMLAFLGFVVQHNVTGKGPFDNL+QHLSD Sbjct: 180 NEVGYPGGIFNPLNFAPTEEAKEKEIANGRLAMLAFLGFVVQHNVTGKGPFDNLVQHLSD 239 Query: 241 PWHNTIVQTLSG 252 PWHNTIVQTL G Sbjct: 240 PWHNTIVQTLRG 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14144 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3882 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28920 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12415 (250 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15142 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25482 (263 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3834 294 4e-82 >Contig3834 Length = 273 Score = 294 bits (752), Expect = 4e-82, Method: Compositional matrix adjust. Identities = 143/212 (67%), Positives = 164/212 (77%) Query: 51 AASVSSEAVALTGVVFQPFEEVKNDAFVVPVSPQVSLARQRYTDESEAAINEQINVEYNV 110 AAS SS + LTGV+F+PFEEVK + +VP PQVSLARQ+Y+++SEAA+NEQINVEYNV Sbjct: 62 AASKSSNSRPLTGVLFEPFEEVKKELDLVPTLPQVSLARQKYSEDSEAAVNEQINVEYNV 121 Query: 111 SYVYHALFAYFDRDNVALKGLANFFKXXXXXXXXXXXKLMEYQNKRGGRVKLHSVIAAPT 170 SYVYHA++AYFDRDNVAL+GLA FFK KLMEYQNKRGGRVKL S++ + Sbjct: 122 SYVYHAMYAYFDRDNVALRGLAKFFKESSEEERGHAEKLMEYQNKRGGRVKLQSILMPVS 181 Query: 171 EFDHAEKGDALYAMELAXXXXXXXXXXXXXXHKVADQNNDPQLMDFIESEFLAEQVEAIK 230 EFDHAEKGDALYAMELA VAD+N D QL DF+ESEFLAEQVEAIK Sbjct: 182 EFDHAEKGDALYAMELALSLEKLTNEKLLNLQHVADKNKDVQLTDFVESEFLAEQVEAIK 241 Query: 231 KIADYVTQLRRVGKGHGVWHFDQYLLHEGDAA 262 KI++YV QLRRVGKGHGVWHFDQ LLH+ AA Sbjct: 242 KISEYVAQLRRVGKGHGVWHFDQMLLHDEVAA 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16998 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17519 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12560 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21429 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6662 (368 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28518 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7568 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2685 158 9e-42 >Contig2685 Length = 116 Score = 158 bits (399), Expect = 9e-42, Method: Compositional matrix adjust. Identities = 82/115 (71%), Positives = 94/115 (81%), Gaps = 2/115 (1%) Query: 3 SSAVTKLALVVALCM--AVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTING 60 +SAV KLALV +C+ AV VA AITCGQVT ++APC YV+SGGAVP ACCNGIR++N Sbjct: 2 ASAVMKLALVALICIVVAVPVAQAITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSLNS 61 Query: 61 LARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115 A+TTADR+ CNCLK+ AGSI G+N N AAGLPGKCGVNVPYKISTSTNC VK Sbjct: 62 AAKTTADRKQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNVK 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31574 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13625 (290 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1557 103 1e-24 >Contig1557 Length = 209 Score = 103 bits (257), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 55/76 (72%), Positives = 59/76 (77%), Gaps = 1/76 (1%) Query: 1 MGEKEKVTIMVLKVDLQCHXXXXXXXXXXXXFPQIRDQVYNEKQNQVVIKVVCCSPEKIR 60 MGEK KVTIMVLKVDLQC FPQIRDQ Y+EK NQV+IKVVCCSPEKIR Sbjct: 1 MGEK-KVTIMVLKVDLQCEKCYKKVKKVLCKFPQIRDQTYDEKNNQVIIKVVCCSPEKIR 59 Query: 61 DKICCKGGSAIKSIEI 76 DK+CCKGG AIKSI+I Sbjct: 60 DKLCCKGGGAIKSIDI 75 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13996 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158360899 96 2e-22 >158360899 Length = 246 Score = 95.5 bits (236), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 50/194 (25%), Positives = 96/194 (49%), Gaps = 7/194 (3%) Query: 10 RVGAVSPVLFKSGEGCGACYKVKCLDQSICSRRAVTIIVTDECPGGYCSNGRTHFDLSGA 69 + A P ++K G GCG+C++++C + ++C+++ +I +D N +T F LS Sbjct: 41 HLAAAVPSIYKDGAGCGSCFQIRCKNATLCTKQGTKVITSD-----LNHNNQTDFVLSSR 95 Query: 70 AFGRMAVAXXXXXXXXXXXXSVLYRRTPCKYPGKQIAFHVNEGSTN-YWLSLLVEFEDGD 128 AF MA V Y+R PC+Y + +A V E S ++L++ V ++ G Sbjct: 96 AFMAMAQKGLGQDILKHGIVDVEYKRVPCEYKNQNLALRVEESSQKPHYLAVKVLYQGGQ 155 Query: 129 GDVGSMHIRPASSSEWIAMSHVWGANWCINGGPLNG-PFSVKITTLSTAKTLSARDVIPS 187 ++ ++ + SS W ++ +GA W + P F +T K + A++V+P+ Sbjct: 156 TEIVAIDVAQVGSSNWSFLTRNYGAVWDTSRVPAGALQFRFVVTGGFDGKMVWAKNVLPA 215 Query: 188 NWSPKATYTSRLNF 201 +W P Y +++ Sbjct: 216 DWKPGMVYDTKVQI 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8326 (344 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5162 314 3e-88 >Contig5162 Length = 448 Score = 314 bits (805), Expect = 3e-88, Method: Compositional matrix adjust. Identities = 200/370 (54%), Positives = 240/370 (64%), Gaps = 46/370 (12%) Query: 1 MTSSFTHLLTSNMENSG--IGQDRT---NWGGLFSDYSSNPNRFTDRNGTDIPKFKXXXX 55 MTSSFTHLLTSNM + QDRT NWG SD S+ PKFK Sbjct: 1 MTSSFTHLLTSNMNMNTNNFDQDRTGSWNWG--LSDRSTEQQEH--------PKFKSHQP 50 Query: 56 XXXXXXXXXXXXXXXXXXXXAFSPTDFLSSPMFLSSSYNLESPTTGAFSSQVFDWMNNTK 115 AFSPTDFLSSPMFL++S L SPTTGAFSSQ+FDWM+++K Sbjct: 51 PSLPLSPPPPSPSSYLVN--AFSPTDFLSSPMFLANSNTLPSPTTGAFSSQIFDWMSSSK 108 Query: 116 D--TQQGIKDKEEPKLFSDFSFQPESRPATNLQSSSSMVSVEEPFKG-----ERQAWDFS 168 + +QQG + +E K+F+DFSFQP + ++ S S+ + ++Q W F+ Sbjct: 109 ENNSQQGAE--KEQKMFTDFSFQPATSSSSFSHQQQSSSSMVSSVEESLKSQQQQTWGFN 166 Query: 169 ---------AEKTGVKSEFEPIEANTQSNGLNGAPKSDYLH-SNQCSQYAREQKSDDGFN 218 AEKT VKSE P+++ N APKS+Y + S +QY REQKSDDG+N Sbjct: 167 KTSRQEETVAEKTEVKSEVAPVQS------FNAAPKSEYTNCSTHSTQYVREQKSDDGYN 220 Query: 219 WRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLDGQITQIVYKGNHNHPKP--QSTR 276 WRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLDGQITQIVYKG+HNH KP Sbjct: 221 WRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLDGQITQIVYKGSHNHAKPQSTRRS 280 Query: 277 RSSSNSIQGSFYGISDQSVPTLSNPKVESVSLQEDSSTSI--GEDEFEQNSPISNSVGAE 334 S S+Q S Y ISDQS T+ NPK+E+V+LQEDS+++ GEDEFEQNSPISNS GA+ Sbjct: 281 SSQQQSLQTSSYAISDQSASTIYNPKIEAVTLQEDSNSASMGGEDEFEQNSPISNSNGAD 340 Query: 335 DENEPEAKRW 344 D+NEPEAKRW Sbjct: 341 DDNEPEAKRW 350 Score = 80.1 bits (196), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Query: 214 DDGFNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVER-SLDGQITQIVYKGNHNHPKP 272 DDG+ WRKYGQK VKG+ NPRSYYKCT CP +K VER S D + Y+G HNH P Sbjct: 384 DDGYRWRKYGQKVVKGNPNPRSYYKCTSTGCPVRKHVERASHDMRAVITTYEGKHNHDVP 443 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8270 (411 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5212 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27935 (256 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 202 1e-54 >158372667 Length = 230 Score = 202 bits (515), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 105/231 (45%), Positives = 140/231 (60%), Gaps = 4/231 (1%) Query: 5 RYAFGRADEATHPDSIRATLAELVATFIFVFAGEGSALALGKIYKDSGTSASEXXXXXXX 64 + AFG EA P+ RA + E V TF+F+FAG GSA+A K+ D+ + Sbjct: 3 KIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKLGADT----TVALFFIAI 58 Query: 65 XXXXXXXXXXXXXNVSGGHVNPAVTFGALLGGRLSVVRALYYWVAQLLGAIVASLLLRLV 124 ++SGGH+NPAVT G L GG +++ R++ YW+ QLL A + LL+ + Sbjct: 59 THALVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLKYL 118 Query: 125 TNGMRTVGFNVASGVAEVHGLILEIVLTFGLVYTVYATAIDPKRGSLGTIAPLAIGFIVG 184 T G+ T ++ASGV G+I EI+LTF L++TVYAT +DPK+GSL + P GF+VG Sbjct: 119 TGGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGFVVG 178 Query: 185 ANILVGGPFDGACMNPARAFGPALVGWRWRNHWIYWVXXXXXXXXXXXIYE 235 ANIL GG F GA MNPAR+FGPALV W W +HW+YWV IYE Sbjct: 179 ANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYE 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3904 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10297 (326 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6386 (57 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31927 (350 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29842 (497 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3077 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26743 (696 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig403 298 9e-83 >Contig403 Length = 237 Score = 298 bits (762), Expect = 9e-83, Method: Compositional matrix adjust. Identities = 157/239 (65%), Positives = 186/239 (77%), Gaps = 5/239 (2%) Query: 41 KQESHTIKPTEQKTHGSKFDLQDRKLESSPNFDTSEGISTSEFGMDSWPDSSLANVAKSE 100 +QES TIKPTEQK G+K DL R+ ESS NF+T EGISTS F D+WPD L++ KSE Sbjct: 2 RQESDTIKPTEQKAPGAKVDLHGREPESSSNFETGEGISTSGFRTDTWPD--LSSFEKSE 59 Query: 101 QHCIAEAIQLDKDGEIFQNSNEGKEQGDIVDYGWANIGSFDDLDRIFSNDDTIFGNVSLG 160 QHC+AEA QL+K E+ QNSNE KEQ VDYGWA IGSFDDLD+IFSNDDTIF + SLG Sbjct: 60 QHCMAEANQLEKGAELIQNSNEAKEQ--FVDYGWATIGSFDDLDQIFSNDDTIFSHGSLG 117 Query: 161 NADELWSSSRDATDSPIKAFPVSSDSPSFTSGAVTNASEYLEIKTDYIQKDNQSITPGYG 220 N DELWSS RDAT+SPIKAFP++SDSPS SGA+ N SE+ ++KT+Y+Q+D Q+I+P G Sbjct: 118 NVDELWSS-RDATNSPIKAFPLTSDSPSCGSGALRNVSEHSQVKTEYVQQDEQAISPVSG 176 Query: 221 KMDYSASYGLQNAHAALDHVEYAGGKSKTMEKEQSDMDTGRSTLTNSSLNAENSSSPNE 279 DYSAS+GLQNA A +DHVEYA GKS+T EKEQ+ D G ST+TNS A NSSS E Sbjct: 177 TTDYSASHGLQNAPATVDHVEYAVGKSRTTEKEQTVSDLGNSTVTNSYQPAVNSSSSTE 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5005 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31753 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5029 191 3e-51 >Contig5029 Length = 421 Score = 191 bits (485), Expect = 3e-51, Method: Compositional matrix adjust. Identities = 112/231 (48%), Positives = 151/231 (65%), Gaps = 17/231 (7%) Query: 3 DKQQLAGELVTKSFTWTIKNVSKVKTQKHYSEVFFVGDWKWRILVYLKGNNVEQ-LSMYL 61 + Q+ EL++ ++TWTI N SK+KT+KHYS+ F VGD+KWRI+VY KG+N Q LSMYL Sbjct: 2 ENQKEGHELISMTYTWTIDNFSKLKTRKHYSDGFVVGDFKWRIVVYPKGSNGRQFLSMYL 61 Query: 62 EVVDASDLPYLWTRYAQFSLTVVNQLSSNMSITKETKHKFNASESDWGFTSFMPLSDFFD 121 V DAS LP W+RYA+F+LTVVNQ +S+ SIT +T+H+F+A +SDWGFTSFMPL++ +D Sbjct: 62 NVADASKLPSGWSRYAEFTLTVVNQFNSDKSITIDTQHQFSAKKSDWGFTSFMPLNELYD 121 Query: 122 -GEQFVCNDKCIIEAKVAVRKVDIKNFGDQGTD-SSAPRESEPSSVDSVQFP-LSLPVTT 178 E ++ +D CI+EA+VAV K DIK DQ T +S+ S VDSV++ +S T+ Sbjct: 122 QNEGYIVDDICIVEAEVAVSKADIKVLKDQETAFLEQELQSQSSDVDSVKYSDVSTTHTS 181 Query: 179 PTSEQ------------VQANVKSEQVLAFQDAPSSGEVC-IKPTDVLVNP 216 EQ VQ NV S Q + + P S EV + TD V P Sbjct: 182 LCYEQMLALHNSLIPDPVQTNVDSPQAPSLKIIPRSDEVLPYQETDSPVGP 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12801 (238 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9361 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780713 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7583 (376 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1399 169 2e-44 >Contig1399 Length = 143 Score = 169 bits (428), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 85/162 (52%), Positives = 110/162 (67%), Gaps = 19/162 (11%) Query: 215 FRNESKKTTLRLVDMESSYLTVDFFRRLPQEMEXXXXXXXXXXXXXXXXXXXXXXXXXXX 274 R ESKK TL+LVDME SYLTVDFFR+LPQ+++ Sbjct: 1 MREESKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPSHSL------------------ 42 Query: 275 XMDRYSEGHFRRIGSNVSSYVGMVSETLRNTIPKAVVHCQVKEANTSLLNHFYIQIGKRE 334 DRY++ + RRIGSNV +YV MV +LRN+IPK+VV+CQV+EA SLL+ F+ +GK + Sbjct: 43 -FDRYNDSYLRRIGSNVLAYVNMVCASLRNSIPKSVVYCQVREAKRSLLDRFFTDMGKLD 101 Query: 335 AKHLSQLLDEDPALMERRHQCAKRLELYKSARDEIDSVAWVR 376 AK LS LL+EDPA+MERR AKRLELY+SA+ E+D+VAW + Sbjct: 102 AKQLSSLLNEDPAVMERRSALAKRLELYRSAQAEMDTVAWSK 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48939927 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754210 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5772 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5057 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5908 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8381 (352 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3715 109 2e-26 >Contig3715 Length = 362 Score = 109 bits (272), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 8/98 (8%) Query: 66 DDQSKKIRKPYTITKSRESWTDQEHDKFLEALQLFDRDWKKIESFVGSKTVIQIRSHAQK 125 +DQ+ K+RKPYTITK RE WT++EH KFLEAL+L+ R W++IE VG+KT +QIRSHAQK Sbjct: 44 NDQALKVRKPYTITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSHAQK 103 Query: 126 YFLKVQKK--GTSEHVPPP------RPKRKATHPYPQK 155 +F KV K+ GT E P RPKRK HPYP+K Sbjct: 104 FFSKVAKELPGTGEGSLKPIEIPPPRPKRKPMHPYPRK 141 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12578 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158353901 113 9e-28 >158353901 Length = 203 Score = 113 bits (282), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 75/144 (52%), Positives = 98/144 (68%) Query: 61 ALAVVNKVPETLVKKASGGSIDRDIALAGLEKEKSMSFIRAWEESEKTKAENKAQKKLSD 120 A+A+V K E +K S DRD LA +E EK +S I AWEESEK+K ENKA KKLS Sbjct: 60 AVAIVEKPCEPAEEKKSKEVSDRDAVLARVETEKKISLINAWEESEKSKVENKAHKKLSV 119 Query: 121 VTAWESSRKAAVEAKLRSIEEQLEKKKAQYAEKMKNKVALLQKQADEKRAMVLAQKGXXX 180 V +WE+++KA+VEA+L+ IEE+LEKKKA+ E+MKNK+AL+ K A+EKRA++ A++ Sbjct: 120 VGSWENTKKASVEAELKIIEEKLEKKKAEAVEQMKNKIALIHKAAEEKRALIEAKRAEDL 179 Query: 181 XXXXXXXXXYRATGSIPKKFLGCF 204 YRATG PKK L F Sbjct: 180 LKAEENAAKYRATGKAPKKLLSFF 203 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32458 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226778833 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10855 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49631623 (62 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210146193 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5029 155 1e-40 >Contig5029 Length = 421 Score = 155 bits (391), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 74/105 (70%), Positives = 91/105 (86%), Gaps = 3/105 (2%) Query: 4 QIVVYPKGSSGTPGTHDLSIYLNVADASALPSGWSRYAQFTLTVVNQVNYDKSITVETKH 63 +IVVYPKGS+G LS+YLNVADAS LPSGWSRYA+FTLTVVNQ N DKSIT++T+H Sbjct: 43 RIVVYPKGSNGR---QFLSMYLNVADASKLPSGWSRYAEFTLTVVNQFNSDKSITIDTQH 99 Query: 64 VFSARKSDWGFTSFMPLSELCDFSQGFLVNDTCVLEAEVAVSQVD 108 FSA+KSDWGFTSFMPL+EL D ++G++V+D C++EAEVAVS+ D Sbjct: 100 QFSAKKSDWGFTSFMPLNELYDQNEGYIVDDICIVEAEVAVSKAD 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22824 (399 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25452 (419 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4974 493 e-141 >Contig4974 Length = 423 Score = 493 bits (1268), Expect = e-141, Method: Compositional matrix adjust. Identities = 262/429 (61%), Positives = 318/429 (74%), Gaps = 16/429 (3%) Query: 1 MFGGFGHAARKSDNTKYYGVLGVPKSASADELKKAYKKAAIKNHPDKGGDPEKFKELGQA 60 MFGG G A +KSDN+KYY +LGV K+AS +++KKAYKKAAIKNHPDKGGDPEKFKEL QA Sbjct: 1 MFGG-GRAPKKSDNSKYYEILGVSKTASPEDVKKAYKKAAIKNHPDKGGDPEKFKELAQA 59 Query: 61 YEVLSNPEKREIYDEYXXXXXXXXXXXXSTSHNPFDLFETFLNPRYRSHVRRQKQG---- 116 YEVLS+PEKREIYD Y S H+PFD+F +F Sbjct: 60 YEVLSDPEKREIYDRYGEDGLKEEMQ--SGGHDPFDIFSSFFGGGGSPFGGMPGGSSRGR 117 Query: 117 -----EDVVHTLKVSLEDLYNGTTKKLSLSRNILCTXXXXXXXXXXXXXRCYGCQGTGMK 171 EDVVH LKVSLEDLY GT+KKLSLSRN+LC+ +C GCQGTGMK Sbjct: 118 RQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVLCSKCKGKGSKSGASTKCGGCQGTGMK 177 Query: 172 ITTRSIGLGMIQQMQHICPECQGSGEVISERDKCPPCKGKKITQEKKVMDVHVEKGMEHG 231 +T R +G MIQQMQH C EC+G+GE IS++D+C CKG+K+ EKKV++VHVEKGM++G Sbjct: 178 VTIRHLGPSMIQQMQHACNECKGTGETISDKDRCGQCKGEKVVHEKKVLEVHVEKGMQNG 237 Query: 232 EKILFEGQADEAPDTITGDIVFVLQLKDHAKFKRKFDDLYVEHTLNLTEALCGFQFALTH 291 +KI F G+ADEAPDT+TGDIVF++Q K+H KFKRK DDL+VEH+L+LT+ALCGFQF L H Sbjct: 238 QKITFPGEADEAPDTVTGDIVFIIQQKEHPKFKRKMDDLFVEHSLSLTDALCGFQFVLNH 297 Query: 292 LDGRQLLVKSNPGEVIKPGQSKAINDEGMPHHQRPFIKGKLYIHFNVEFPDSGILSPHQS 351 LDGRQLL+KSNPGEV+KP KA+NDEGMP +QRPF+KGKLYIHF+V+FP++ LSP Q Sbjct: 298 LDGRQLLIKSNPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVDFPET--LSPEQV 355 Query: 352 QMLQTVLDPR-HSKKLTDMELDKCEETTLHDVNIEDEMRRKPRQQYREAYXXXXXXXXXS 410 + L+ L R S++LTDMELD+CEETTLHDVN+E+EMRRK Q + EAY + Sbjct: 356 KALEAALPSRASSQQLTDMELDECEETTLHDVNMEEEMRRKQHQAHSEAYDEDDDMPGGA 415 Query: 411 MPRVQCAQQ 419 RVQCAQQ Sbjct: 416 Q-RVQCAQQ 423 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27972 (434 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 75 6e-16 >89552756 Length = 189 Score = 75.1 bits (183), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 47/133 (35%), Positives = 76/133 (57%), Gaps = 19/133 (14%) Query: 213 NGTLRQHLECLYGQILDLAARLDVAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENFR 272 NG+L+Q L+ + +D RL +A+D A + YLH I+H D+K N+L+ N R Sbjct: 3 NGSLKQFLQ-KKDRTIDRRKRLIIAMDAAFGMEYLH---GKNIVHFDLKCENLLV--NMR 56 Query: 273 ------AKVADFGFARLAADSDSGETHVSTQVKGTAGYLDPEYL--RTYQLTEKSDVFSF 324 K+ D G +++ +T VS V+GT ++ PE L +++ +TEK DV+SF Sbjct: 57 DPQRPVCKIGDLGLSKVKQ-----QTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSF 111 Query: 325 GVLLVELVTGRRP 337 G+++ EL+TG P Sbjct: 112 GIVMWELLTGDEP 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19075 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13126 (304 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26571 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3262 157 3e-41 >Contig3262 Length = 134 Score = 157 bits (396), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 77/114 (67%), Positives = 89/114 (78%), Gaps = 2/114 (1%) Query: 1 MESQNFSPPHVDASRPSLGFPLGTAXXXXXXXXXXXXXXCCYHWDKLRSLRRSFNQNADP 60 MESQN SPPHVDASRPSLGFPLGTA CCYHWDKLRSLRRSF ++++P Sbjct: 1 MESQNLSPPHVDASRPSLGFPLGTALLLIIIFSLSGVFSCCYHWDKLRSLRRSFAEDSNP 60 Query: 61 EA--DVQPPSPSKSKPAHMDLKQKQRESLPVIMAGDQIPKFMALPCPREPPTDE 112 EA D++ PSKSKPAH+D+KQ Q++S+PVIM GDQIPKFMALPCP EPP +E Sbjct: 61 EASDDIEGQPPSKSKPAHLDMKQTQKQSVPVIMPGDQIPKFMALPCPCEPPREE 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12515 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32253 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32576 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30618 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91046348 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3715 103 1e-24 >Contig3715 Length = 362 Score = 103 bits (256), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 44/62 (70%), Positives = 53/62 (85%) Query: 27 KVRKPYTITKSRESWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKV 86 KVRKPYTITK RE WT+EEH KFLEAL+L+ R W++IE+ VG+KT +QIRSHAQK+F KV Sbjct: 49 KVRKPYTITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKV 108 Query: 87 QK 88 K Sbjct: 109 AK 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10590 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823815 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 86 1e-19 >Contig4694 Length = 351 Score = 86.3 bits (212), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 56/190 (29%), Positives = 92/190 (48%), Gaps = 26/190 (13%) Query: 45 IPILDLSMLSREHKEE--------LNKLDQACKEWGFFHVVNHGVATELLHEMKDATAKF 96 +P++DLS L+ + ++ ACK WGFF V+NHGV E+ +++ KF Sbjct: 26 VPLIDLSPLTSADSISDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTARKF 85 Query: 97 FELPLEEKNK-RRMSGGREGYGQAYAISEGQTM-DWSDTLIL-----SLYPA-------- 141 F PLEEK K RR GY Y + + DW + +L P+ Sbjct: 86 FAQPLEEKRKIRRDEKCVVGY---YDTEHTKNVRDWKEVYDFLVEEPTLVPSSTEPDDKE 142 Query: 142 QSRDLHVWPTAPNGFKETIEAYSSEVKRIGEELITSLSTIMELEKDALLGLHKEVLQALR 201 +++ + WP P +E +E YS EV+++ +L+ ++ + L +D G K+ +R Sbjct: 143 ETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQTSFIR 202 Query: 202 VNYTPPCSMP 211 +N+ PPC P Sbjct: 203 LNHYPPCPSP 212 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18443 (118 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25354 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226813426 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27448 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9628 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27265 (486 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1830 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17017 (103 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27182 (447 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5264 884 0.0 >Contig5264 Length = 447 Score = 884 bits (2284), Expect = 0.0, Method: Compositional matrix adjust. Identities = 424/436 (97%), Positives = 433/436 (99%) Query: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD 240 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPSDKPLRLPLQD Sbjct: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETG++KPGMVVTFGPTGLTTEVKSVEMHHEAL EALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 EILTKIDRRSGKE+EKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 GEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKSVEKKEPTG 436 VAVGVIK+VEKK+P+G Sbjct: 421 VAVGVIKNVEKKDPSG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6439 (450 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19588 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9420 (377 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11611 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig338 72 4e-15 >Contig338 Length = 345 Score = 72.0 bits (175), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 6/128 (4%) Query: 109 KDQGNALHSQGKFNEAMQKYLLAKK------NLSGIPSSKGRSLLMACSLNLMSCYLKTR 162 K++GNAL K+ A ++Y A + + S + R L + C+LN +C LK + Sbjct: 187 KEEGNALFKAAKYERASKRYEKAVRYIEYDSSFSDDEKQQARVLKITCNLNDAACKLKLK 246 Query: 163 QYDECIKEGSEVLAYDADNIKALYRRGQAYKEIGQFEGAVSDLSKAHEVSPDDETISDVL 222 +Y E K ++VL D+ N+KALYRR QAY ++ + A D+ KA E+ P+++ + Sbjct: 247 KYKEAEKLCTKVLELDSRNVKALYRRAQAYIQLVDLDLAEQDIKKALEIEPNNKDVKLEY 306 Query: 223 RDAKENLR 230 + KE +R Sbjct: 307 KLLKEKVR 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24960 (93 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23203 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24121 (439 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89557288 59 5e-11 >89557288 Length = 216 Score = 58.9 bits (141), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 32/116 (27%), Positives = 61/116 (52%) Query: 1 MNQPKVKRRVGKYEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKR 60 M+ + K V +++ IG G F +V+ R TG+ A+K L K ++L+ E +K Sbjct: 101 MHLQRHKMGVDDFQLLTIIGRGAFGEVRICREKSTGQVYAMKKLKKLEMLRRGQVEHVKA 160 Query: 61 EIETMKLIKHPNVVQLYEVMGSKTKIFIVMEFVTGGELFDKIVNNGRMKEDEARRY 116 E + + +V+LY + ++++ME++ GG++ ++ + EDEAR Y Sbjct: 161 ERNLLAEVDSAYIVKLYCSFQDEEFLYLIMEYLPGGDMMTLLMRKDILTEDEARFY 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13065 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18545 (75 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30481 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990148 (123 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30021 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27653 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158380033 167 3e-44 >158380033 Length = 161 Score = 167 bits (422), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 78/141 (55%), Positives = 102/141 (72%) Query: 1 MIRFILLQNRQGKTRLAKYYVPLEDSEKHKVEYEVHRLVVNRDPKFTNFVEFRTHKVIYR 60 MI+F+LL +RQGK RL K+Y P E+ KV E+ +++ R PK NFVE+R +KV+Y+ Sbjct: 1 MIQFVLLISRQGKVRLTKWYSPYTQKERTKVLRELSGVILARGPKLCNFVEWREYKVVYK 60 Query: 61 RYAGLFFSLCVDITDNELAYLECIHLFVEILDHFFSNVCELDLVFNFHKVYLILDEFILA 120 RYA L+F +C+D DNEL LE IH FVEILD +F +VCELDL+FNFHK Y ILDE ++A Sbjct: 61 RYASLYFCMCIDQDDNELEVLEIIHHFVEILDRYFGSVCELDLIFNFHKAYYILDELLIA 120 Query: 121 GELQETSKKAIIERMGELEKL 141 GELQE+SKK I + + L Sbjct: 121 GELQESSKKTIARLIAAQDSL 141 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780478 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48279658 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1895 290 5e-81 >Contig1895 Length = 361 Score = 290 bits (741), Expect = 5e-81, Method: Compositional matrix adjust. Identities = 143/167 (85%), Positives = 153/167 (91%), Gaps = 3/167 (1%) Query: 19 FHGAPMVRLQLAKAAPANNG-GLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTRRYM 77 FHGAP+ R+Q KAA ++NG GLSVSMSA+ T +YDLS FKF+PIKESIVSREMTRRYM Sbjct: 29 FHGAPLARVQPLKAASSSNGHGLSVSMSAS--TNAYDLSNFKFEPIKESIVSREMTRRYM 86 Query: 78 TDMITYADTDXXXXGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVV 137 TDMITYADTD GAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVV Sbjct: 87 TDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVV 146 Query: 138 RKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLF 184 RKPAH FL+ELGIDYDE+D+YVVIKHAALFTSTIMSKLLARPNVKLF Sbjct: 147 RKPAHHFLSELGIDYDEKDDYVVIKHAALFTSTIMSKLLARPNVKLF 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12837 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4505 (254 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15768 (307 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6543 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18023 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22878 (358 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6942 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48398376 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5915 (298 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3037 144 6e-37 >Contig3037 Length = 313 Score = 144 bits (363), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 65/102 (63%), Positives = 78/102 (76%) Query: 15 RGPWTLEEDNLLIHYIVNHGEGHWNSLAKLAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQ 74 +G WT EED LI YI HGEG W SL K AGL R GKSCRLRW+NYL+PD+KRGN T + Sbjct: 14 KGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTEE 73 Query: 75 EQLMILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQ 116 E +I++LHS GN+WS IA LPGRTDNEIKNYW T ++++ Sbjct: 74 EDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRK 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226744329 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9270 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26633 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812699 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10801 (276 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5650 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24526 (193 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1988 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2558 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158355199 111 9e-28 >158355199 Length = 105 Score = 111 bits (277), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 51/71 (71%), Positives = 61/71 (85%) Query: 3 RCCPLDWPEGATSRESIKAVLKLHRLQNIVMQHVDHSAGDLIDLLQGLLKFDPSSRLTAP 62 R LDWP+GA SRES++AV KL RL N++MQHVDHSAGDLI+LLQGLL+++P+ RL A Sbjct: 27 RGARLDWPDGAASRESMRAVFKLPRLPNLIMQHVDHSAGDLIELLQGLLRYEPTERLKAR 86 Query: 63 EALRHPFFTRD 73 EALRHPFFTRD Sbjct: 87 EALRHPFFTRD 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4842 (401 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5097 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746547 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16576 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24820 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26371 (388 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2343 (585 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig926 (423 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210146429 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 79 6e-18 >89552756 Length = 189 Score = 79.3 bits (194), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 33/79 (41%), Positives = 53/79 (67%) Query: 14 EKSDIYSYGVILWELATEKIPWDNLNSMQVIGAVGFMDQRLEIPKDVDPQWTCLIESCWQ 73 EK D+YS+G+++WEL T P+ +++ +IG + R +IP DP+W L+ESCW Sbjct: 104 EKIDVYSFGIVMWELLTGDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWG 163 Query: 74 SDAASRPTFQELLEKLRDL 92 S+ A RP+F E+ +KLR++ Sbjct: 164 SEPAQRPSFSEISQKLRNM 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9502 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4661 232 2e-63 >Contig4661 Length = 251 Score = 232 bits (591), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 121/231 (52%), Positives = 149/231 (64%), Gaps = 13/231 (5%) Query: 38 RKLRVRSFTAPTGSSSSFTVRAAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSD 97 R++ R T+P S+SSF V A + W PG P +L GSLPGD GFDPL L+ D Sbjct: 32 REVAFRPVTSP--SASSFKVEAKKGE-----WLPGLPSPGYLTGSLPGDNGFDPLALAED 84 Query: 98 PDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFVV 157 P++LKW QAELV+ RWAMLG AG+ +PE LT IGI+N P WY AG+ EYF ++TLFV+ Sbjct: 85 PENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIGIINVPKWYDAGKAEYFASSSTLFVI 144 Query: 158 ELVLIGWAEGRRWADILKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIK 217 E +L + E RRW DI PGSVN DPIF L +VGYPGG+ F+PL + + Sbjct: 145 EFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNFAP-----TE 198 Query: 218 ELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFASF 268 E + KEI NGRLAMLA +G QH TG GP DNL HL+DP H TI + Sbjct: 199 EAKEKEIANGRLAMLAFLGFVVQHNVTGKGPFDNLVQHLSDPWHNTIVQTL 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53858449 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23341 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13739 (485 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10093 (272 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26388 (74 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14657 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4228 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27691 (210 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6436 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22760 (313 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10532 (387 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32220 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226790710 (50 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18465 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17475 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31690 (159 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3250 318 1e-89 >Contig3250 Length = 159 Score = 318 bits (814), Expect = 1e-89, Method: Compositional matrix adjust. Identities = 152/159 (95%), Positives = 155/159 (97%) Query: 1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF 60 MSDEEH FESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF Sbjct: 1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF 60 Query: 61 VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 V IDIF KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD Sbjct: 61 VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 Query: 121 DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159 D+LLTQ+KDGFAEGKDLVV+VMSAMGEEQICALKDIGPK Sbjct: 121 DALLTQLKDGFAEGKDLVVTVMSAMGEEQICALKDIGPK 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6829 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5373 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5471 (348 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489103 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754887 (71 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814953 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226811488 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17294 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6531 (406 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19136 (108 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3566 103 2e-25 >Contig3566 Length = 175 Score = 103 bits (258), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 8/86 (9%) Query: 13 MGEAIARGA-----EKRVMVAIDESDCSHYALMWVLDNLKDSI-TNSPLIIFTAQTPSAG 66 MGE + G EK VMVA+DES+CSHYALMWV+DNLK+SI TNSPL+IF AQ P A Sbjct: 1 MGEVVDNGGAAESGEKPVMVAVDESECSHYALMWVIDNLKESINTNSPLLIFMAQPPPAN 60 Query: 67 NVIFSASLGNARMYYPMSSNQEFVNS 92 N+ F+A LG+ARMY P + EF N+ Sbjct: 61 NITFAAPLGSARMYCPPTP--EFTNN 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6902 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14679 (327 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18502 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27642 (351 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17962 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20731 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32826 (455 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16051 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14383 (381 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig732 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11499 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9097 (113 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5748 181 2e-48 >Contig5748 Length = 265 Score = 181 bits (458), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 91/111 (81%), Positives = 94/111 (84%) Query: 1 MLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQV 60 MLGALGCVFPE+LSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNL+HAQSILAIWAVQV Sbjct: 106 MLGALGCVFPEVLSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQV 165 Query: 61 VLMGFIEGYRVXXXXXXXXXXXXXXXXAFDPLGLADDPEAFAELKVKELKE 111 VLMGFIEGYRV AFDPLGLADDPEAFAELKVKE+K Sbjct: 166 VLMGFIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKN 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24488 (308 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12777 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54686638 (89 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51913309 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21254 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158350521 80 6e-18 >158350521 Length = 226 Score = 80.5 bits (197), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 53/157 (33%), Positives = 90/157 (57%), Gaps = 11/157 (7%) Query: 65 NKYALACAILA----SMTSILMGYDIGVMSGASIYIEKDLKVTDTQIE---IMIGVI--- 114 + Y++ A+L ++ +L GYDIG S A+I +E + + + IG+I Sbjct: 4 DNYSVLAAVLPFLFPALGGLLYGYDIGATSCATISVESATLSGVSWYDLSSVEIGLITSG 63 Query: 115 EIY-SLIGSAMAGKTSDWVGRRYTIVISGAIFFIGAILMGFSTNYTFLMCGRFVAGIGVG 173 +Y +LIGS +A +D +GRR+ ++ S ++ IGAI+ + + ++ GR V GIG+G Sbjct: 64 SLYGALIGSVLAFNIADIIGRRWELISSAIVYLIGAIVTALAPDLPIMVIGRVVFGIGIG 123 Query: 174 YALTIAPVYSAEVSPTSSRGFLTSFPEVFVNIGILLG 210 A+ AP+Y AE +P+ RG L S E F+ +G++ G Sbjct: 124 LAMHAAPMYIAETAPSQIRGRLISLKEFFIVLGMVAG 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24662 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2612 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 234 5e-64 >158372667 Length = 230 Score = 234 bits (596), Expect = 5e-64, Method: Compositional matrix adjust. Identities = 125/220 (56%), Positives = 160/220 (72%), Gaps = 6/220 (2%) Query: 1 MAGIAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVA 60 MA IAFG ++ +A + EF++T LF+FAGVGSA+A +KL +D + L +A Sbjct: 1 MAKIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKLGADTTV---ALFFIA 57 Query: 61 IAHGFALFVAVSIGA-NISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVAAFIL 119 I H AL VAV I A +ISGGH+NPAVT GL GG IT+ + YWI QL+ A + ++L Sbjct: 58 ITH--ALVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLL 115 Query: 120 KFVTGGLTIPIHSLAAGVGAIQGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGF 179 K++TGGLT PIHSLA+GVG QGV++EII+TF+L++TVYAT DPKKGSL + P GF Sbjct: 116 KYLTGGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGF 175 Query: 180 IVGANILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWV 219 +VGANILA G FSG SMNPARSFGPA+ S D+ D+W+YWV Sbjct: 176 VVGANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWV 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5506 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5653 297 2e-83 >Contig5653 Length = 653 Score = 297 bits (760), Expect = 2e-83, Method: Compositional matrix adjust. Identities = 142/155 (91%), Positives = 152/155 (98%) Query: 1 MTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPR 60 MT LIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPR Sbjct: 416 MTTLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPR 475 Query: 61 GVPQINVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIERMVQEAEKYKAED 120 GVPQINVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKE+IE+MVQ+AEKYKAED Sbjct: 476 GVPQINVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEDIEKMVQDAEKYKAED 535 Query: 121 EEVKKKENAKNSLENYALHMRNTVKEDKVAGKLNP 155 EEVKKK +AKN+LENYA +MRNT+K+DK+AGKL+P Sbjct: 536 EEVKKKVDAKNALENYAYNMRNTIKDDKIAGKLDP 570 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265055 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9175 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55855795 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990137 (83 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040385 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2474 (420 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824629 (100 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3444 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16040 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25324 (400 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56200602 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23023 (350 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1157 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283027 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815794 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5396 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226813500 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48270958 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48266188 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10758 (436 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27440 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51098616 (168 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10326 (54 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55699223 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13485 (397 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89546967 61 9e-12 >89546967 Length = 114 Score = 61.2 bits (147), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 33/91 (36%), Positives = 51/91 (56%) Query: 75 MNRRLFVSFFFLGLTGIFGNQLLFLIGLGYTNPTYAAAIQPAIPVFTFILAVLMGTERVN 134 M +F LGL +Q L+ +G+ YT T+AAA+ +P TF++A ++ E+V Sbjct: 1 MTLAIFTKIMVLGLLEPVLDQNLYYLGMKYTTATFAAAMSNILPALTFVMAWILRLEKVK 60 Query: 135 LLRTEGQAKVGGTLLCVSGAILMVLFRGPPL 165 L Q K+ GT V+GA++M L +GP L Sbjct: 61 LTCIRSQCKLLGTAATVAGAMIMTLVKGPLL 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27045 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48290058 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22668 (337 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71919120 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26134 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11451 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23306 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25856 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8669 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764647 (176 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25753 (308 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24056 (423 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2660 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990485 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20929 (331 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21889 (267 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158361591 84 9e-19 >158361591 Length = 219 Score = 84.0 bits (206), Expect = 9e-19, Method: Compositional matrix adjust. Identities = 50/109 (45%), Positives = 63/109 (57%), Gaps = 17/109 (15%) Query: 125 VSIDILHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKTALDSRIIPRYLLPEY 184 V++D++H VFSAFG V KI FEK QALVQ+ D TA A+ AL+ I Y Sbjct: 5 VTVDVIHTVFSAFGTVQKIAIFEKNCQTQALVQYPDIATAAVAREALEGHCI-------Y 57 Query: 185 VGP-CTLRITYSGHTDLSVKFQSHRSRDYTNPN---------LPVAPSA 223 G C L ++YS HTDL+VK S +SRDYT P+ P AP+A Sbjct: 58 DGGYCKLHLSYSRHTDLNVKAYSDKSRDYTIPDASLLAVQSGYPAAPAA 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28510 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31715 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24371 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7694 (302 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19908 (110 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226765319 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27416 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9536 (425 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6621 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27007 (207 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158359626 266 9e-74 >158359626 Length = 291 Score = 266 bits (679), Expect = 9e-74, Method: Compositional matrix adjust. Identities = 125/170 (73%), Positives = 140/170 (82%) Query: 12 ACCASTKFAKEMAEASPFSSLDEAVTAARDIWFNKVDVNGWLQSFSAHPQIGNXXXXXXX 71 ACC ST+FAKEMA+ASPFSSL+EAVT ARD+WFNKVDV GWLQ+FSAHPQIG+ Sbjct: 13 ACCGSTQFAKEMAKASPFSSLEEAVTVARDVWFNKVDVTGWLQAFSAHPQIGHSPPSSSH 72 Query: 72 XXXAQWSKGEQXXXXXXXXXXXLQELAEWNAKYRQKFGFVFLICASGKSSDGILAELKKR 131 AQWSKGEQ LQEL++WNA+YR+KFGFVFLICASGKS+DGILAELKKR Sbjct: 73 PTSAQWSKGEQSTAIATATSSSLQELSQWNARYREKFGFVFLICASGKSTDGILAELKKR 132 Query: 132 YPNRPIVEFEIAAQEQMKITELRLAKLFAAKENVTSTGNKNPTIVAKKAE 181 YPNRPIVEFEIAA+EQMKITELRLAKLF+ KE V STGN NP++ AKK E Sbjct: 133 YPNRPIVEFEIAAKEQMKITELRLAKLFSTKEKVPSTGNVNPSVAAKKVE 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27018 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7377 (65 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20275 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158378696 328 1e-92 >158378696 Length = 195 Score = 328 bits (841), Expect = 1e-92, Method: Compositional matrix adjust. Identities = 160/174 (91%), Positives = 169/174 (97%) Query: 1 MIYAHFCGSWGHYTCLAWLPTYFSEELNLNLTEAAWVSILPPLASIFVTSIASQFADSLI 60 MIYAHFCGSWGHYTCLAWLPTYFSEELNLNLTEAAWVSILPPLASIFV +IASQ AD+LI Sbjct: 1 MIYAHFCGSWGHYTCLAWLPTYFSEELNLNLTEAAWVSILPPLASIFVNTIASQIADNLI 60 Query: 61 STGVQTTTVRKVCQTIAFLSPAACMTLSSLDLGLPHWEVVGILTGGLALSSFALSGMDCT 120 S GVQTTTVRK+CQTIAFLSPAACMTLSSLDLGLPHWEVVGILT GLALSSFA+SG+ CT Sbjct: 61 SNGVQTTTVRKICQTIAFLSPAACMTLSSLDLGLPHWEVVGILTAGLALSSFAISGLYCT 120 Query: 121 HQDMSPEYASILLGITNTVGAVPGIIGVALTGFLLDSTHSWSISLFIPSIFFYL 174 HQD+SPEYASILLGITNTVGAVPGI+GVALTG+LLDSTHSWS+SLFIPSIFFYL Sbjct: 121 HQDISPEYASILLGITNTVGAVPGIVGVALTGYLLDSTHSWSMSLFIPSIFFYL 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15114 (306 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27589 (543 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20884 (490 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3667 543 e-156 >Contig3667 Length = 289 Score = 543 bits (1398), Expect = e-156, Method: Compositional matrix adjust. Identities = 249/289 (86%), Positives = 278/289 (96%) Query: 1 MVISTTSAERRGEQVNCTFASRYVRNVLPKFQMPETSMPKDSAYQIINDELMLDGNPRLN 60 MVIS+TS +R ++CTFASRYVRN +PKF+MPE+S PK++AYQIINDELMLDG PRLN Sbjct: 1 MVISSTSGDRSDHFLDCTFASRYVRNPVPKFRMPESSQPKEAAYQIINDELMLDGTPRLN 60 Query: 61 LASFVTTWMEPECDRLMMASMNKNYVDMDEYPVTTELQNRCVNIIANLFNAPIGDGETAV 120 LASFVTTWMEPEC+++MMASMNKNYVDMDEYPVTTELQNRCVN+I++LFNAPIG+ ETA+ Sbjct: 61 LASFVTTWMEPECEKIMMASMNKNYVDMDEYPVTTELQNRCVNMISHLFNAPIGEAETAI 120 Query: 121 GVSTVGSSEAMMLAGLAFKRKWQNKRKLEGKPFDKPNMVTGANVQVCWEKFARYFEVELK 180 GV TVGSSEA+MLAGLAFKRKWQ++RKLEGKPFDKPN+VTGANVQVCWEKFARYFEVELK Sbjct: 121 GVGTVGSSEAIMLAGLAFKRKWQHRRKLEGKPFDKPNIVTGANVQVCWEKFARYFEVELK 180 Query: 181 EVKLSEGYYVMDPAKAVEMVDENTICVAAILGSTLTGEFEDVKLLHDLLVEKNKQTGWDT 240 EVKLS+GYYVMDP KAVEMVDENTICVAAILGSTLTGEFEDVKLL+DLL++KNK+TGW+T Sbjct: 181 EVKLSDGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLIKKNKETGWET 240 Query: 241 PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWV 289 PIHVDAASGGFIAPFLYP++EWDFRLPLVKSINVSGHKYGLVYAGVGWV Sbjct: 241 PIHVDAASGGFIAPFLYPDIEWDFRLPLVKSINVSGHKYGLVYAGVGWV 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6166 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10034 (323 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15529 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30388 (443 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4974 137 9e-35 >Contig4974 Length = 423 Score = 137 bits (346), Expect = 9e-35, Method: Compositional matrix adjust. Identities = 107/355 (30%), Positives = 173/355 (48%), Gaps = 15/355 (4%) Query: 82 DSDFYSVLGVSRNASKSEIKSAYRKLARSYHPDVNKEPGAETKFKEISNAYEVLSDDEKR 141 +S +Y +LGVS+ AS ++K AY+K A HPD +P KFKE++ AYEVLSD EKR Sbjct: 13 NSKYYEILGVSKTASPEDVKKAYKKAAIKNHPDKGGDP---EKFKELAQAYEVLSDPEKR 69 Query: 142 SLYDKYGEAGIKGAGMGTGDFSNPFDLFESLFEXXXXXXXXXXXXXXXSKSRAVDGQDEY 201 +YD+YGE G+K G +PFD+F S F + + G+D Sbjct: 70 EIYDRYGEDGLKEEMQSGG--HDPFDIFSSFFGGGGSPFGGMPGGSSRGRRQRR-GEDVV 126 Query: 202 YNLVLNFKEAVFGVEKEIEISRLESCGTCNGSGAKPGTKASRCSTCGGQGQVVQSARTPL 261 + L ++ ++ G K++ +SR C C G G+K G +++C C G G V Sbjct: 127 HPLKVSLEDLYLGTSKKLSLSRNVLCSKCKGKGSKSGA-STKCGGCQGTGMKVTIRHLGP 185 Query: 262 GVFQQVM-TCSSCGGTGET---SIPCNTCSGDGRVRRTKRISLKVPAGVDSGSRLRVRNE 317 + QQ+ C+ C GTGET C C G+ V K + + V G+ +G ++ E Sbjct: 186 SMIQQMQHACNECKGTGETISDKDRCGQCKGEKVVHEKKVLEVHVEKGMQNGQKITFPGE 245 Query: 318 GNAGRGGGSPGDLFVIIDVISDPVLKRDDTNILYSCKVSYIDAILGTTIKVPTVDG-MVD 376 + + GD+ II P KR ++ +S DA+ G + +DG + Sbjct: 246 ADEAPDTVT-GDIVFIIQQKEHPKFKRKMDDLFVEHSLSLTDALCGFQFVLNHLDGRQLL 304 Query: 377 LKIPAG--TQPNTTLVMAKKGVPLLNKSNMRGDQLVRVQVEIPKRLSTDEKKLVE 429 +K G +P++ + +G+P+ + M+G + V+ P+ LS ++ K +E Sbjct: 305 IKSNPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVDFPETLSPEQVKALE 359 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21658 (352 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2260 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17022 (443 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25479 (392 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746565 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158365522 125 1e-31 >158365522 Length = 211 Score = 125 bits (315), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 65/155 (41%), Positives = 92/155 (59%), Gaps = 1/155 (0%) Query: 18 SCVYEDGTKWGKEVGFLYGSVVEDYFTGFHLHCKGWISVYYDPKRPQFLGSGTTNLDEFL 77 SC YED T+WGKEVG++YGSV ED TGF +HC GW SVY PKRP F GS NL + L Sbjct: 45 SCGYEDKTEWGKEVGWIYGSVTEDILTGFKMHCHGWRSVYCMPKRPAFKGSAPINLSDRL 104 Query: 78 VQGTRWSSGLVDVAISKFSPLIYGPFKTRNFLHSMCYAELALFPIFYFLSLWGFATIPQL 137 Q RW+ G V++ +S+ P+ YG L Y ++P+ + L + ++P + Sbjct: 105 HQVLRWALGSVEILLSRHCPIWYGYGCGLKSLERFSYINSVVYPLTS-IPLIAYCSLPAV 163 Query: 138 CLLNGIPLYPQVSNTYFIVFSFIFLSSHSKHLYEV 172 CLL G + P++SN I+F +FLS + + E+ Sbjct: 164 CLLTGKFIVPEISNYASIIFMALFLSIAATSVLEM 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51864488 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7983 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226749360 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226755800 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14484 (459 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6468 (410 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48285622 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57896315 226 9e-62 >57896315 Length = 271 Score = 226 bits (575), Expect = 9e-62, Method: Compositional matrix adjust. Identities = 110/130 (84%), Positives = 112/130 (86%), Gaps = 2/130 (1%) Query: 46 PLDRKIRSDRFSYRDAPYXXXXXXXXFSR--DNLCKNCKRPGHFARECPNVAICHNCGLP 103 P DRK+R+DRFSYRDAPY DNLCKNCKRPGHFARECPNVAICHNC LP Sbjct: 101 PTDRKMRTDRFSYRDAPYRRDGGRRGGGFSRDNLCKNCKRPGHFARECPNVAICHNCSLP 160 Query: 104 GHIASECTTKSLCWNCREPGHMASNCPNEGICHTCGKAGHRARDCTAPPMPPXDLRLCNN 163 GHIASECTTKSLCWNCREPGHMASNCPNEGICHTCGKAGHRARDCTA PMPP DLRLCNN Sbjct: 161 GHIASECTTKSLCWNCREPGHMASNCPNEGICHTCGKAGHRARDCTAAPMPPGDLRLCNN 220 Query: 164 CYKQGHIAAD 173 CYKQGHIA D Sbjct: 221 CYKQGHIAVD 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24495 (144 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21292 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48120635 (91 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91012308 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7380 (55 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10660 (324 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25085 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19740 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10557 (394 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 93 2e-21 >Contig2005 Length = 422 Score = 92.8 bits (229), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 57/169 (33%), Positives = 85/169 (50%), Gaps = 34/169 (20%) Query: 217 WGSVSICGRRPEMEDAFAAVPRFINIPIKMLVGSQVYNGMSQSLTHLTSHFFGIYDGHGG 276 +GS S+CGRR +MEDA + P+ N +G HF+G+YDGHG Sbjct: 125 FGSTSVCGRRRDMEDAVSIHPKLFN------------DGSDSD----GCHFYGVYDGHGC 168 Query: 277 PQVANYCSERLHLALAEELGGIKDDSRDGIMVETQQV-QWEKAFTNCFQRVDDEIGGKVS 335 VA C +RLH + ++L E+Q+V QW+ F ++D+E+ + Sbjct: 169 SHVALKCKDRLHEIVKQDL-------------ESQRVVQWKDTMERSFSKMDEEVQAG-N 214 Query: 336 RGIIESNADASEASFEPVAPETVGSTAVVALVSSSHIIVANCGESRTIL 384 R + N + + VGSTAVVA+V+ IIV+NCG+SR +L Sbjct: 215 RALQNPNC---RCELQTPQCDAVGSTAVVAVVTPEKIIVSNCGDSRAVL 260 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1788 (83 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29655 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2545 (305 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48286232 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9678 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990673 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8651 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 107 7e-26 >89550571 Length = 226 Score = 107 bits (267), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 62/161 (38%), Positives = 97/161 (60%), Gaps = 6/161 (3%) Query: 21 KIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYANNSVKG 80 KI+I++I+N RQVT+ KRR GLLKKA ELSVLCD E ++I+FS G+L E +++S K Sbjct: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSSTKD 67 Query: 81 TIERYKKASADSSNTGSVSEASTQYYQQEAAKLRAQIVKLQNDNRNMMGDALSSMSVKDL 140 I RY+ + D N + S+ Q + KL +I R M G+ L +++ +L Sbjct: 68 VITRYESQTGDEGNL----DQSSLDLQHDCIKLSNEIADKSRVLRQMNGEDLEGLNIDEL 123 Query: 141 KSLENKLEKAISRIRSKKNELLFAEIEYMQKR--ELDLHNN 179 + LE K++ +++R+ K E + EI ++ + EL+L NN Sbjct: 124 QRLETKIDGSLNRVLQTKEENIIGEILALEAKGAELELANN 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55698717 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226774982 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21596 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54623103 (62 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27311 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29022 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32890 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25471 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265276 (117 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1122 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158378709 74 5e-16 >158378709 Length = 115 Score = 73.6 bits (179), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 2/68 (2%) Query: 50 WVLHTEGRPLELLDTSVEDSITLHEVVRTIHVGLLCVQRNPEDRPSMSAAVLMLGGEGA- 108 W L EGR +E++D SV ++ +HE +R IHVGLLCVQ P DRP+MS + ML E A Sbjct: 7 WQLWKEGRGMEVIDASVRETCRIHEALRCIHVGLLCVQEAPADRPTMSLVIHMLEAEEAT 66 Query: 109 -LPPPLKP 115 LPP +P Sbjct: 67 SLPPSKEP 74 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11672 (507 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27449 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48411817 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4113 245 1e-67 >Contig4113 Length = 368 Score = 245 bits (625), Expect = 1e-67, Method: Compositional matrix adjust. Identities = 116/134 (86%), Positives = 122/134 (91%) Query: 21 EITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDMT 80 E+TNVSEYEAIAK+KLPKM YDYYASG+EDQWTLAENRNAF++ILFRPRILIDVS IDMT Sbjct: 3 EVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNIDMT 62 Query: 81 TTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWATSSVEEVASTGP 140 TTVLGFKISMPIMIAPTA QKMAHPEGEY GTIMTLSSWATSSVEEVASTGP Sbjct: 63 TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 122 Query: 141 GIRFFQLYVYKDRN 154 GIRFFQLYVYKDR+ Sbjct: 123 GIRFFQLYVYKDRH 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18537 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15234 (240 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26935 (201 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825938 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16031 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992451 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48417129 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26436 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27141 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743385 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14654 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3700 154 6e-41 >Contig3700 Length = 476 Score = 154 bits (390), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 71/86 (82%), Positives = 80/86 (93%) Query: 1 MTLEKLLHYGQMLVQEQDNVKRVQLADKYLADAALGDANQDSINRGEFYGKAAQQVNVPV 60 MTLEKLL YG MLVQEQDNVKRVQLA+ YL+ AALGDANQDSI RG+FYG+AAQQV+VPV Sbjct: 390 MTLEKLLGYGNMLVQEQDNVKRVQLAETYLSQAALGDANQDSIKRGDFYGQAAQQVHVPV 449 Query: 61 PEGCTDRTAANFNPAARSDDGSCQYE 86 PEGCTDRTA+NF+P ARSDDGSC+Y+ Sbjct: 450 PEGCTDRTASNFDPTARSDDGSCEYQ 475 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32383 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226801430 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30126 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3499 299 5e-84 >Contig3499 Length = 148 Score = 299 bits (766), Expect = 5e-84, Method: Compositional matrix adjust. Identities = 142/148 (95%), Positives = 146/148 (98%) Query: 1 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPAESPFSGGVFLVSIHFPPDY 60 MASKRI+KELKDLQKDPPASCSAGPVA+DMFHWQATIMGP +SPF+GGVFLVSIHFPPDY Sbjct: 1 MASKRISKELKDLQKDPPASCSAGPVAEDMFHWQATIMGPGDSPFAGGVFLVSIHFPPDY 60 Query: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRQKYETTARSWTQKYAMG 148 PEIAHMYKTDR KYETTARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRVKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48276288 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24372 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 300 4e-84 >Contig1161 Length = 148 Score = 300 bits (767), Expect = 4e-84, Method: Compositional matrix adjust. Identities = 143/148 (96%), Positives = 145/148 (97%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPGDSPYTGGVFLVSIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPY GGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRAKYEATARSWTQKYAMG 148 PEIAHMYKTDR+KYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRSKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226793997 (135 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25128 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50891356 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2908 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10432 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4766 253 5e-70 >Contig4766 Length = 180 Score = 253 bits (646), Expect = 5e-70, Method: Compositional matrix adjust. Identities = 125/181 (69%), Positives = 148/181 (81%), Gaps = 4/181 (2%) Query: 4 ISSVYSSCLTGSAAIQPPSIFSSQNLNHKSSLSL--NGKRL-GTGLQNKNFNFCVKAAQK 60 ++S+ +SCLTG ++ PS+ S QN N +S LSL N R+ G + KN + C KA+ + Sbjct: 1 MTSLSTSCLTG-PVLRLPSLLSPQNPNQRSLLSLTRNPDRIRGNRIVCKNLSVCPKASLR 59 Query: 61 RNLEAVGVPTSVPVRVAHELLQAGHKYLDVRTPEEFSAGHAPGAVNIPYLYKVGSGMTKN 120 NLE G+PTSVPVRVAHELL AGH YLDVRTPEEFSAGH GAVNIPYLY+VGSGM+KN Sbjct: 60 GNLEVAGLPTSVPVRVAHELLLAGHHYLDVRTPEEFSAGHPSGAVNIPYLYRVGSGMSKN 119 Query: 121 QEFLEQVSSHFRKHDEIIVGCQLGKRSMMAATDLEASGFTGITDIAGGYAAWTQSGLPTE 180 EF+++VSSHFRKHDEIIVGCQLGKRSMMAATDL A+GFTGITD+AGGYA WTQ+GLPTE Sbjct: 120 PEFVKEVSSHFRKHDEIIVGCQLGKRSMMAATDLVAAGFTGITDMAGGYATWTQNGLPTE 179 Query: 181 I 181 + Sbjct: 180 L 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7950 (326 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55855564 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7270 (365 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 185 3e-49 >Contig4694 Length = 351 Score = 185 bits (469), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 106/343 (30%), Positives = 181/343 (52%), Gaps = 25/343 (7%) Query: 21 FVRDEDERPKVAYNDFSNEIPIISLAGI---DEVEGRRG--EICKKIVAACEDWGIFQIV 75 F++D + RPK++ + ++ +P+I L+ + D + + + ++I AC++WG FQ++ Sbjct: 8 FIQDPEHRPKLSIIE-ADGVPLIDLSPLTSADSISDPKAIEVLVREIGNACKNWGFFQVI 66 Query: 76 DHGVDAELISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTY 135 +HGV E+ ++ AR+FFA P EEK + G+ + H + V+DW+E+ + Sbjct: 67 NHGVPLEMREKVETTARKFFAQPLEEKRKIRRDEKCVVGYYDTEHTKN--VRDWKEVYDF 124 Query: 136 F----------SYPIRHRD---YSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMG 182 + P + +++WP+ P REV + YS E+ L+ KL+G+++ ++G Sbjct: 125 LVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLIALSLG 184 Query: 183 LDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDD 242 L + D + +N YP CP P+L LG+ RH D G +T+L QD+VGGL+ R Sbjct: 185 LPEDRFKGYFKDQTSFIRLNHYPPCPSPELALGVGRHKDGGALTVLAQDEVGGLEVKRKT 244 Query: 243 GKTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQEAIV 302 WI V+P A+++N+GD + SN +++ +H+ +VNS R S+ F NPA V Sbjct: 245 DGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHRVMVNSEKERFSVLFFLNPAHYTEV 304 Query: 303 YPLSVREGEKPILEAPITYTEMYKKKMSKDLELARLKKLSKEQ 345 PL + + P YT K +L+ KKL E Sbjct: 305 KPLEELTNK----QNPAKYTPYSWGKFLTLRKLSNFKKLKAEN 343 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13504 (334 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 108 5e-26 >Contig2005 Length = 422 Score = 108 bits (269), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 90/269 (33%), Positives = 129/269 (47%), Gaps = 54/269 (20%) Query: 3 GWRATMEDAHAAYPDL--DASTS----FFGVYDGHGGKVVAKFCAKYLHQQVLKN-EAYA 55 G R MEDA + +P L D S S F+GVYDGHG VA C LH+ V ++ E+ Sbjct: 132 GRRRDMEDAVSIHPKLFNDGSDSDGCHFYGVYDGHGCSHVALKCKDRLHEIVKQDLESQR 191 Query: 56 AGDIGTSVQKAFFRMDEMMRGQRGWRELAVLGDKINKFTGMIEGLIWSPRSSDSNDQADD 115 +++++F +MDE + Q G R L Q + Sbjct: 192 VVQWKDTMERSFSKMDEEV--QAGNRAL----------------------------QNPN 221 Query: 116 WAFE-EGPHSDFTGPTSGCTACVAILRNKQLVVANAGDSRCVISRKGQAYNLSRDHKPDL 174 E + P D G T A VA++ ++++V+N GDSR V+ RKG A LS DHKPD Sbjct: 222 CRCELQTPQCDAVGST----AVVAVVTPEKIIVSNCGDSRAVLCRKGAAVPLSSDHKPDR 277 Query: 175 ELEKERILKAGGFI---HAGRVNGSLNLARAIGDMEFKQNKFLPAEKQIVTASPDINTVE 231 E RI AGG + RV G L ++RAIGD +L K V + P++ ++ Sbjct: 278 PDELLRIEAAGGRVIYWDGPRVLGVLAMSRAIGD------NYL---KPYVISEPEVTIMD 328 Query: 232 LCDDDEFIVLACDGIWDCMSSQQVVDFVH 260 +DE ++LA DG+WD +S+ V Sbjct: 329 RTAEDECLILASDGLWDVVSNDTACGVVR 357 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48125617 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48123095 (58 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27846 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2194 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4766 59 1e-11 >Contig4766 Length = 180 Score = 59.3 bits (142), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 38/126 (30%), Positives = 54/126 (42%), Gaps = 35/126 (27%) Query: 25 LDVRPEAEFKEAHPPGAINVQ-IYRLIKEWTAWDXXXXXXXXXXXXXXXTEENPDFISSV 83 LDVR EF HP GA+N+ +YR+ + +NP+F+ V Sbjct: 87 LDVRTPEEFSAGHPSGAVNIPYLYRVGSGMS--------------------KNPEFVKEV 126 Query: 84 GSQLDKKAKIIVACAAGGTMRPTQNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLYAWF 143 S K +IIV C G RS++AA LV G+T + + GG W Sbjct: 127 SSHFRKHDEIIVGCQLG--------------KRSMMAATDLVAAGFTGITDMAGGYATWT 172 Query: 144 KEGLPS 149 + GLP+ Sbjct: 173 QNGLPT 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91021444 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10435 (487 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20819 (82 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20329 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226753789 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26969 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27214 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48118301 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23333 (356 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226801981 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16295 (317 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27986 (115 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91037763 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12395 (323 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91027550 (109 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11148 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27629 (312 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2209 (219 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 86591033 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48385879 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30530 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48484945 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22340 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24312 (482 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4717 244 6e-67 >Contig4717 Length = 244 Score = 244 bits (624), Expect = 6e-67, Method: Compositional matrix adjust. Identities = 119/206 (57%), Positives = 143/206 (69%), Gaps = 3/206 (1%) Query: 36 QNLDRVADLPGQSFNLSFAHFSGYVPVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPG 95 Q DRV LPGQ + F ++GYV VNE GRALFYWF EA + P KP+VLWLNGGPG Sbjct: 36 QKADRVIGLPGQP-PVKFDQYAGYVTVNETHGRALFYWFFEAVKTPQDKPLVLWLNGGPG 94 Query: 96 CSSIAYGMAEEIGPFHIEADGK-TLYLNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLS 154 CSSI YG +EE+GPF + K L NPY+WN AN+LF +SPVGVGFSY+NT+ D+ Sbjct: 95 CSSIGYGASEELGPFFPQKGAKPKLKYNPYTWNNAANLLFLESPVGVGFSYTNTTKDISQ 154 Query: 155 NGDKRTANDSLTFLLQWFERFPQYKGRDFYITGESYGGHYVPQLSQAIVKYNLK-TKEKT 213 GD TA DS FL+ WF+RFPQYK DFYITGESYGGHYVPQLS+ + N +KE Sbjct: 155 LGDTITAEDSHKFLINWFKRFPQYKSHDFYITGESYGGHYVPQLSELVYDRNKNASKETY 214 Query: 214 VNLKGYMVGNALTDDYHDHLGVFQFM 239 +N KG+M+GNA DD D G+ + Sbjct: 215 INFKGFMIGNAAIDDETDQKGLIDML 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27916 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13382 (530 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32683 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26713 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489810 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6102 (212 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 59 3e-11 >89552756 Length = 189 Score = 58.5 bits (140), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 52/183 (28%), Positives = 87/183 (47%), Gaps = 30/183 (16%) Query: 3 IAAGAAKGLKYLHDKASPPVLHRNLKCSNILLG--EGYHP--KLSGFGLAKLGPAGDNTH 58 IA AA G++YLH K ++H +LKC N+L+ + P K+ GL+K+ T Sbjct: 25 IAMDAAFGMEYLHGKN---IVHFDLKCENLLVNMRDPQRPVCKIGDLGLSKVK---QQTL 78 Query: 59 VSKWVMGTYGYCAPEYAMTGQ---LTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILV 115 VS V GT + APE ++G+ +T K D+YSFG+V+ E++TG + A Sbjct: 79 VSGGVRGTLPWMAPEL-LSGKSHMVTEKIDVYSFGIVMWELLTGDEPYTDMHCAS----- 132 Query: 116 EWARTLFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTY 175 + + + TL+ Q P + ++ C +P RP +++ L Sbjct: 133 -----------IIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQKLRN 181 Query: 176 LAS 178 +A+ Sbjct: 182 MAA 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595520 (151 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1486 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27009 (178 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7364 (99 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226810834 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925431 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24826 (447 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4544 882 0.0 >Contig4544 Length = 447 Score = 882 bits (2279), Expect = 0.0, Method: Compositional matrix adjust. Identities = 421/436 (96%), Positives = 431/436 (98%) Query: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSRARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDAT+PKYS+ARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD 240 +GYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPSDKPLRLPLQD Sbjct: 181 IGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETG+IKPGMVVTF PTGLTTEVKSVEMHHEA+QEALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRGYVASNSKDDPAKEAANF AQVIIMNHPGQIG GYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 E++TKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 GEILTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKSVEKKDPTG 436 VAVGVIK+VEKKDP+G Sbjct: 421 VAVGVIKAVEKKDPSG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26130 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226800902 (78 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20504 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48264387 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17480 (352 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040450 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20803 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158368865 84 4e-19 >158368865 Length = 226 Score = 84.0 bits (206), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 46/112 (41%), Positives = 78/112 (69%), Gaps = 5/112 (4%) Query: 44 GMGPRQLPPHPAII-----EEHLAAQHQDIQGLLGNNQRLAATHVALKQELEAAQFELQR 98 G PR L P I+ E+ + Q ++IQ LL +NQRLAATHVALKQ+L +AQ +L+ Sbjct: 3 GREPRHLHRLPQIVNTTALEDRVDLQQREIQSLLIDNQRLAATHVALKQDLTSAQSDLRN 62 Query: 99 MAYHVDSLRADKDVKMRDLYDKSVRLEVDLRGVEAMRNELLQVRADIKELTA 150 + ++++++ ++R++YD+S++L+ +LRG++AM+ EL V DI++L+A Sbjct: 63 LKAVAGQIKSERNAEVREVYDRSLKLDDELRGLDAMKAELSVVLNDIEDLSA 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8550 (198 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12321 (226 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19775 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14225 (170 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5896 249 7e-69 >Contig5896 Length = 167 Score = 249 bits (635), Expect = 7e-69, Method: Compositional matrix adjust. Identities = 114/148 (77%), Positives = 130/148 (87%) Query: 23 HPVDGFSAGLVNEDNIFEWNVTIIGPPDTLYEGGFFNAIMSFPEDYPCNPPIVRFTSEMW 82 +PVDGFSAGLV+E+NIFEW+VTIIGPPDTLYEGGFFNAIMSFP +YP +PP V+FTSE+W Sbjct: 20 NPVDGFSAGLVDENNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTSELW 79 Query: 83 HPNVYADGKVCVSILHPPGDDPNGYELATERWNPVHTVEXXXXXXXXXXXXPNDESPANV 142 HPNVY DG+VC+SILHPPGDDPNGYELA+ERW PVHTVE PNDESPANV Sbjct: 80 HPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVESIVLSIISMLSSPNDESPANV 139 Query: 143 DAAKQWRESRDEFRKKVGRCVRKSQEML 170 +AAK+WR+ RD+F+KKVGRCVRKSQEML Sbjct: 140 EAAKEWRDRRDDFKKKVGRCVRKSQEML 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26655 (223 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50701423 (54 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1576 75 5e-17 >Contig1576 Length = 164 Score = 75.5 bits (184), Expect = 5e-17, Method: Composition-based stats. Identities = 36/53 (67%), Positives = 40/53 (75%) Query: 2 EGQKKVAEEATQPSQAGEGESDPLVAAETGSGVGTDSTPQIGPVWKSNKDLHA 54 EGQKKVAEEATQ +AGEGESDPL++ E GSG+ T P WKSNKDLHA Sbjct: 112 EGQKKVAEEATQVLKAGEGESDPLMSVENGSGLKLAVTQMSPPSWKSNKDLHA 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16686 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2867 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283176 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775772 (56 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10173 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1609 (111 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30601 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19591 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13112 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26179 (200 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226745693 (195 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48280866 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6152 (382 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4343 (182 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29071 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158357520 68 3e-14 >158357520 Length = 260 Score = 68.2 bits (165), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 11/136 (8%) Query: 49 AGKCNWFRGTWVYDASSKPPYYSSTCPFVDPQFDCLKYGRPDTAFL-KYRWQPFSCALPR 107 A C++ G W+YD ++ P Y TC + ++C+ + + L K+RW+P C LP Sbjct: 16 ARSCDYSDGAWIYDPNASPKY-DHTCKEIFKGWNCISGNKSNGRELTKWRWKPNGCDLPT 74 Query: 108 FNGLYFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTSYVKK----DGLASVTF 163 F+ + FL +R I F+GDSL+ N +V+L C L +S VKK TF Sbjct: 75 FDPVRFLHMYRNTSIGFIGDSLNRNMFVALFCSL-----KRVSSEVKKWRPFGADRGFTF 129 Query: 164 QDYGVQILLYRTPYLV 179 Y V + +RT L Sbjct: 130 LQYNVTLAYHRTNLLA 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3227 (191 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4687 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16217 (330 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9508 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7629 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71922754 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13333 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24583 (259 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27584 (348 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17640 (84 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91014122 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6300 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25573 (308 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550843 137 5e-35 >89550843 Length = 144 Score = 137 bits (346), Expect = 5e-35, Method: Compositional matrix adjust. Identities = 62/77 (80%), Positives = 69/77 (89%) Query: 111 QAMWVWTVSLPVTVANASNRMPLIQAADIIGWIMWFVGFSVEAAADQQKLTFKSSPQNRG 170 +A+WVWTVSLPVTV N+SN+ P +QAAD IGWIMW VGF VEA ADQQKL FK+SP+NRG Sbjct: 26 EAVWVWTVSLPVTVVNSSNKTPSLQAADFIGWIMWSVGFLVEATADQQKLVFKNSPENRG 85 Query: 171 KWCNVGLWKYTRHPNYF 187 KWCNVGLWKYTRHPNYF Sbjct: 86 KWCNVGLWKYTRHPNYF 102 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4740 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19697 (310 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 120 1e-29 >Contig4694 Length = 351 Score = 120 bits (300), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 87/309 (28%), Positives = 138/309 (44%), Gaps = 26/309 (8%) Query: 9 VPILHPSQVTTIDVSQLHQDSHTRSVLVKSIHHACQEMGFFQVINHGISKTVTENALGSL 68 VP++ S +T+ D D VLV+ I +AC+ GFFQVINHG+ + E + Sbjct: 26 VPLIDLSPLTSADSIS---DPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTA 82 Query: 69 SNFFDLPMDQKKLFLSDDISKPVRFVT----NSRDSIKLYANPIE--------------- 109 FF P+++K+ D+ + T N RD ++Y +E Sbjct: 83 RKFFAQPLEEKRKIRRDEKCVVGYYDTEHTKNVRDWKEVYDFLVEEPTLVPSSTEPDDKE 142 Query: 110 --NWIDLWPHNPTEFRESLGRYAAEVKRLSIDILGAIVESLGLSPTYLRSSLGQGMQMIV 167 W + WP NP E RE + Y+ EV++LS+ ++G I SLGL + I Sbjct: 143 ETQWFNQWPENPPELREVMEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQTSFIR 202 Query: 168 GSRYPRCXXXXXXXXXXXXXXXXXXXXXLES-TSGVEIMDFTDNSAWKSVPATDGTLKVL 226 + YP C + G+E+ TD W V T + Sbjct: 203 LNHYPPCPSPELALGVGRHKDGGALTVLAQDEVGGLEVKRKTDGE-WIRVRPTPNAYIIN 261 Query: 227 VGNHLEILSNGLYKSVFHRVVPNPERNRVSIGSFLSLPMEEIMEPAMELIDEQHPKRYKA 286 VG+ +++ SN Y+SV HRV+ N E+ R S+ FL+ ++P EL ++Q+P +Y Sbjct: 262 VGDVIQVWSNDEYESVEHRVMVNSEKERFSVLFFLNPAHYTEVKPLEELTNKQNPAKYTP 321 Query: 287 SSLDEYIKL 295 S +++ L Sbjct: 322 YSWGKFLTL 330 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14832 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26684 (446 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27736 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11692 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48404361 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28502 (246 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26404 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13487 (663 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12632 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15312 (461 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12391 (343 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 73 2e-15 >Contig2005 Length = 422 Score = 73.2 bits (178), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 70/220 (31%), Positives = 103/220 (46%), Gaps = 48/220 (21%) Query: 92 FCGIFDGHGPWGHFVAKQIRETMPPSLLCSWQETLAQTSIDPDPDLDKKCHRFNVWKDSY 151 F G++DGHG VA + ++ + E + Q D + R WKD+ Sbjct: 159 FYGVYDGHG--CSHVALKCKDRL--------HEIVKQ---------DLESQRVVQWKDTM 199 Query: 152 IKTCAAIDHELGQHRRIDSFYS-------------GTTALSIVRQGELIFIANVGDSRAV 198 ++ + +D E+ R + G+TA+ V E I ++N GDSRAV Sbjct: 200 ERSFSKMDEEVQAGNRALQNPNCRCELQTPQCDAVGSTAVVAVVTPEKIIVSNCGDSRAV 259 Query: 199 LATTLDDGSLVPVQLTVDFKPSLPQEAERIIQSNGRVFCLDDEPGVQRVWQPDGETPGLA 258 L G+ VP L+ D KP P E RI + GRV D P V V LA Sbjct: 260 LCRK---GAAVP--LSSDHKPDRPDELLRIEAAGGRVIYWDG-PRVLGV---------LA 304 Query: 259 MSRAFGDYCVKDFGLISVPEVSQRNITSRDQFVVLATDGV 298 MSRA GD +K + +IS PEV+ + T+ D+ ++LA+DG+ Sbjct: 305 MSRAIGDNYLKPY-VISEPEVTIMDRTAEDECLILASDGL 343 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27225 (424 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5029 430 e-123 >Contig5029 Length = 421 Score = 430 bits (1105), Expect = e-123, Method: Compositional matrix adjust. Identities = 239/439 (54%), Positives = 311/439 (70%), Gaps = 33/439 (7%) Query: 1 MEKKQVG-ELVSVTFTWKIEKFSRLRSQKHYSDGFNVGDFQWQIVVYPKGSSGTPGTHDL 59 ME ++ G EL+S+T+TW I+ FS+L+++KHYSDGF VGDF+W+IVVYPKGS+G L Sbjct: 1 MENQKEGHELISMTYTWTIDNFSKLKTRKHYSDGFVVGDFKWRIVVYPKGSNGR---QFL 57 Query: 60 SIYLNVADASALPSGWSRYAQFTLTVVNQVNYDKSITVETKHVFSARKSDWGFTSFMPLS 119 S+YLNVADAS LPSGWSRYA+FTLTVVNQ N DKSIT++T+H FSA+KSDWGFTSFMPL+ Sbjct: 58 SMYLNVADASKLPSGWSRYAEFTLTVVNQFNSDKSITIDTQHQFSAKKSDWGFTSFMPLN 117 Query: 120 ELCDFSQGFLVNDTCVLEAEVAVSQVDY-MAEVHETWFCP---PIQPSDHERQGHTDVDA 175 EL D ++G++V+D C++EAEVAVS+ D + + ET F Q SD + ++DV Sbjct: 118 ELYDQNEGYIVDDICIVEAEVAVSKADIKVLKDQETAFLEQELQSQSSDVDSVKYSDVST 177 Query: 176 VQLTAPTSEQVLAFQDASSSEQKQTNDFEQVLISSVAVTTPSSAQVLALWDGPSDGQVWT 235 T+ EQ+LA ++ + QTN + S+ + P S +VL + Sbjct: 178 TH-TSLCYEQMLALHNSLIPDPVQTN-VDSPQAPSLKI-IPRSDEVLPYQE--------- 225 Query: 236 GGNNSLVGSPIGK-----EHEQKPSAPVGELMNFRGLGQIDKAFVPFLEEVCLMHPSLIK 290 +S VG PI + E + PS PVGEL++FRGLG+IDKAFVP LEEVCL HPSLI Sbjct: 226 --TDSPVGPPIVEESILDESDDVPSTPVGELIDFRGLGKIDKAFVPLLEEVCLWHPSLIS 283 Query: 291 CQRKRSPMFTEWAFTALGRLLYFLKTTKGTDMNVDA-----CEHLRLSWEELESFRFDLA 345 CQRKRS MF+EWAFTALGR+L+FL TTK DM D+ CEHL++ WEE+E+F+FDL+ Sbjct: 284 CQRKRSRMFSEWAFTALGRVLHFLNTTKVRDMMEDSCEHDPCEHLQVLWEEVEAFKFDLS 343 Query: 346 WLEPHIQSALGMKKFVERELEVKDLRNNMDSLEIEVKRLKARLNVAELDFEDAKRDVGEA 405 WL+P +QSALGMKKF ERE +K L ++D+LE E++ L+ RL VAE+ AK D+ A Sbjct: 344 WLQPFVQSALGMKKFGEREGVLKKLGEDVDALETEMRGLRERLAVAEVAHRLAKGDLEIA 403 Query: 406 EESFVEINMDSELGYGGRH 424 EESF E NM+S+LGY GRH Sbjct: 404 EESFGEANMNSKLGY-GRH 421 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10583 (90 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28787 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28707 (375 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56163217 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22842 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28371 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1161 107 8e-26 >Contig1161 Length = 148 Score = 107 bits (267), Expect = 8e-26, Method: Compositional matrix adjust. Identities = 54/143 (37%), Positives = 79/143 (55%) Query: 13 KQLAKELKSLDESPPEGIQVGLNDDDFSIIYADIEGPAGTPYENGVFHMKLLLSRDFPHS 72 K++ KELK L + PP G +D A I GP +PY GVF + + D+P Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFK 63 Query: 73 PPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLIEPFPESALNEQA 132 PPK F TK+FHPNI +NG IC++ LK+ W+P+L + VL+ + LL +P P+ L + Sbjct: 64 PPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 123 Query: 133 GKMLLENYEEYARHARLYTGIHA 155 M + +Y AR +T +A Sbjct: 124 AHMYKTDRSKYETTARSWTQKYA 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18624 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1906 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8012 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3749 (131 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13481 (300 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25734 (346 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26993 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89557288 58 4e-11 >89557288 Length = 216 Score = 57.8 bits (138), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 30/107 (28%), Positives = 57/107 (53%) Query: 10 VGKYEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKLIK 69 V +++ IG G F +V+ R TG+ A+K L K ++L+ E +K E + + Sbjct: 110 VDDFQLLTIIGRGAFGEVRICREKSTGQVYAMKKLKKLEMLRRGQVEHVKAERNLLAEVD 169 Query: 70 HPNVVQLYEVMGSKTKIFIVMEFVTGGELFDKIVNNGRMKEDEARRY 116 +V+LY + ++++ME++ GG++ ++ + EDEAR Y Sbjct: 170 SAYIVKLYCSFQDEEFLYLIMEYLPGGDMMTLLMRKDILTEDEARFY 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22982 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20455 (117 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5466 175 8e-47 >Contig5466 Length = 121 Score = 175 bits (443), Expect = 8e-47, Method: Compositional matrix adjust. Identities = 85/115 (73%), Positives = 93/115 (80%) Query: 3 KSSFKLEHPLXXXXXXXXXXXXKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFV 62 KS FK +H L KYP+R+PVIVEKA +SD+PDIDKKKYLVPADLTVGQF Sbjct: 5 KSLFKKQHALERRKAEALRIREKYPERVPVIVEKAVKSDVPDIDKKKYLVPADLTVGQFG 64 Query: 63 YVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 117 YVVRKRIKL AEKAIF FV N+LPP AA+MSAIYE+NKDEDGFLYMTYSGEN FG Sbjct: 65 YVVRKRIKLGAEKAIFTFVNNVLPPQAALMSAIYEDNKDEDGFLYMTYSGENAFG 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14522 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040172 (141 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12845 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3499 78 4e-17 >Contig3499 Length = 148 Score = 78.2 bits (191), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 42/117 (35%), Positives = 61/117 (52%), Gaps = 9/117 (7%) Query: 8 KRLQKEYRALCKEPVSHIVARPHPNDILEWHYVLEGSEGTPFAGGYYYGKIKFPPEYPFK 67 KR+ KE + L K+P + A P D+ W + G +PFAGG + I FPP+YPFK Sbjct: 4 KRISKELKDLQKDPPASCSAGPVAEDMFHWQATIMGPGDSPFAGGVFLVSIHFPPDYPFK 63 Query: 68 PPGISMTT----PNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP 120 PP ++ T PN + ICL D E W+P ++S +L + S + D +P Sbjct: 64 PPKVAFRTKVYHPN--INSNGSICL---DILKEQWSPALTISKVLLSICSLLTDPNP 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30489 (199 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16733 (229 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11285 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226763976 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56430896 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26529 (148 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3499 300 2e-84 >Contig3499 Length = 148 Score = 300 bits (769), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 143/148 (96%), Positives = 146/148 (98%) Query: 1 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPGDSPFSGGVFLVSIHFPPDY 60 MASKRI+KELKDLQKDPPASCSAGPVA+DMFHWQATIMGPGDSPF+GGVFLVSIHFPPDY Sbjct: 1 MASKRISKELKDLQKDPPASCSAGPVAEDMFHWQATIMGPGDSPFAGGVFLVSIHFPPDY 60 Query: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRQKYEATARSWTQKYAMG 148 PEIAHMYKTDR KYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRVKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12264 (261 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21069 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12750 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3908 203 6e-55 >Contig3908 Length = 246 Score = 203 bits (517), Expect = 6e-55, Method: Compositional matrix adjust. Identities = 99/246 (40%), Positives = 145/246 (58%), Gaps = 1/246 (0%) Query: 1 MPEKITAEDLLNNIVGTLADKKQKXXXXXXXXXXXXXXTQFNFNRLFGRQKPVHHILGGG 60 M E++ AE L+ I + F R+FGR++PVHH+ GGG Sbjct: 1 MAEEVKAESLMEKIEDKILGHHDSPAPEVVHHDSPRSMQDKVF-RIFGRERPVHHVFGGG 59 Query: 61 KSADVLLWRNKKISASVLTAATIVWVLFEWLNYHFLTLVGFALILGMLAQFLWSNFSGMI 120 K AD+ LWR+KK+S +L AT++W+LFE L YH LTLV LI + FLWSN G I Sbjct: 60 KLADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWSNGLGFI 119 Query: 121 NRSPSKVPRLVLPKDLFVNIAISIGAEINRGLAFVQDVACEGNVKQFIVVVVSLLIAAMI 180 N+SP K+P + +P+ + I SI EINR L ++D+A ++KQF+ V+ L + +++ Sbjct: 120 NKSPPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDIASGKDLKQFLSVIAGLWVVSIL 179 Query: 181 GSWCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFVYQVLGQLQHNYRKLDTGVLSKIPKG 240 G CNFLT+LYI V ++PV YE+Y+ ++D + + +++ Y D VLSKIP+G Sbjct: 180 GKSCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKAMFEIKKQYAVFDAKVLSKIPRG 239 Query: 241 KLSWKK 246 L KK Sbjct: 240 ALKAKK 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12600 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6851 (169 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13659 (521 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23286 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226768534 (94 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26661 (146 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158371956 81 2e-18 >158371956 Length = 208 Score = 81.3 bits (199), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 47/115 (40%), Positives = 71/115 (61%), Gaps = 7/115 (6%) Query: 6 KRSLLVKETSAGEEETRVIDGEEELS----LKRRVWIEIKKMWLVAGPAIFTRVASFGTN 61 KRS V+ S+ EET EL L+R W+E+K ++ +A PA+ + + + Sbjct: 17 KRSSSVQPVSSELEETL---SNTELPYFHRLRRATWVELKILFRLAAPAVVVYLLNNVIS 73 Query: 62 VVSQAFIGHIGSLELAAFSLVFTVLVRFGNGILLGMASALETLCGQSHGAKQYNM 116 + +Q + GH+G+LELAA SL T + F G++LGM SA+ETLCGQ++GA +Y M Sbjct: 74 MSTQIYCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEM 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28295 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17149 (123 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 74 2e-16 >Contig2005 Length = 422 Score = 74.3 bits (181), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Query: 13 GDRYLKPWIIPEPEVMVVPRARDDECLILASDGLWDVMTNEEACDVARKRILLWHKKNGA 72 GD YLKP++I EPEV ++ R +DECLILASDGLWDV++N+ AC V R L K GA Sbjct: 310 GDNYLKPYVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTACGVVRM-CLRAQKTPGA 368 Query: 73 T 73 + Sbjct: 369 S 369 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30271 (75 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31982 (239 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11570 (633 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2190 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28687 (433 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17496 (197 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28727 (154 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17836 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91011528 (161 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25115 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775946 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5398 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig743 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6223 (295 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28758 (73 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28013 (107 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7367 (571 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16913 (54 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2376 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1188 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6233 (164 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91041825 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18919 (282 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 90 1e-20 >89552756 Length = 189 Score = 90.1 bits (222), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 70/207 (33%), Positives = 112/207 (54%), Gaps = 34/207 (16%) Query: 58 MHNGTLKEHLYGPLTHEQSINWIKRLEIAEDAAKGIEYLHTGCVPAIIHRDLKSSNILID 117 M NG+LK+ L +++I+ KRL IA DAA G+EYLH I+H DLK N+L++ Sbjct: 1 MVNGSLKQFLQ---KKDRTIDRRKRLIIAMDAAFGMEYLHGK---NIVHFDLKCENLLVN 54 Query: 118 ----KHMRAKVSDFGLSKLAVDGASHVSSIVRGTVGYLDPEYYI--SQQLTDKSDVYSFG 171 + K+ D GLSK V + VS VRGT+ ++ PE S +T+K DVYSFG Sbjct: 55 MRDPQRPVCKIGDLGLSK--VKQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFG 112 Query: 172 VILLELISGQEAISNENFGVNCRNIVQWAKLHIESGDIQGIIDPSLDGEYDIQSMWKIAE 231 +++ EL++G E ++ ++C +I+ G + + P + D + W Sbjct: 113 IVMWELLTGDEPYTD----MHCASII--------GGIVNNTLRPQIPTWCDPE--W---- 154 Query: 232 KALM--CVQAHGFMRPSMSEVLKEIQD 256 K+LM C + RPS SE+ +++++ Sbjct: 155 KSLMESCWGSEPAQRPSFSEISQKLRN 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226768527 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25470 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30395 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 95 4e-22 >Contig4694 Length = 351 Score = 95.1 bits (235), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 44/115 (38%), Positives = 73/115 (63%), Gaps = 3/115 (2%) Query: 118 KVSNYPPCPKPDLIKGLRAHSDAGGIILLFQDDKVSGLQLLK--DGEWVDVPPMHHSIVI 175 ++++YPPCP P+L G+ H D G + +L QD+ V GL++ + DGEW+ V P ++ +I Sbjct: 202 RLNHYPPCPSPELALGVGRHKDGGALTVLAQDE-VGGLEVKRKTDGEWIRVRPTPNAYII 260 Query: 176 NLGDQIEVITNGKYKSVMHRVIAQSDGTRMSIASFYNPGNDSFISPAPAVLEKKT 230 N+GD I+V +N +Y+SV HRV+ S+ R S+ F NP + + + P + K+ Sbjct: 261 NVGDVIQVWSNDEYESVEHRVMVNSEKERFSVLFFLNPAHYTEVKPLEELTNKQN 315 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31678 (529 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7066 (217 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27492 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752822 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31491 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31834 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158378709 74 4e-16 >158378709 Length = 115 Score = 74.3 bits (181), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Query: 81 WELWKKNAALELKDPTLGDSCNGNQLLRCIHISLLCVEENAADRPTMSDVISML-TNESM 139 W+LWK+ +E+ D ++ ++C ++ LRCIH+ LLCV+E ADRPTMS VI ML E+ Sbjct: 7 WQLWKEGRGMEVIDASVRETCRIHEALRCIHVGLLCVQEAPADRPTMSLVIHMLEAEEAT 66 Query: 140 ELPKPKKPA 148 LP K+P Sbjct: 67 SLPPSKEPC 75 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8613 (612 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3830 (92 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32140 (294 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91020211 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25516 (301 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22624 (280 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25883 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48388896 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30236 (185 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226766586 (181 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13408 (385 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595162 (76 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31441 (441 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12295 (403 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29128 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29772 (363 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8 (262 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226809872 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11638 (66 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48278324 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24234 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27882 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24436 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig839 268 1e-74 >Contig839 Length = 152 Score = 268 bits (684), Expect = 1e-74, Method: Compositional matrix adjust. Identities = 130/152 (85%), Positives = 135/152 (88%) Query: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 MSLVANEEFQHILRV+NTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVDMNKRAGELS Sbjct: 1 MSLVANEEFQHILRVMNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60 Query: 61 AAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 A E++ LM IVANPRQFKIPDWFLNRKKDYKDG+YSQVV+NALDMKLRDDLERLKKIRNH Sbjct: 61 AQEIENLMHIVANPRQFKIPDWFLNRKKDYKDGKYSQVVANALDMKLRDDLERLKKIRNH 120 Query: 121 RGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 152 RGLRHYWGLRVRGQH SKKR Sbjct: 121 RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48126970 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992020 (120 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7991 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226789991 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 129 9e-33 >89550571 Length = 226 Score = 129 bits (323), Expect = 9e-33, Method: Compositional matrix adjust. Identities = 72/109 (66%), Positives = 84/109 (77%), Gaps = 5/109 (4%) Query: 5 KIQIKKIDYLPARQVTFSKRRRGIFKKAGELSVLCDSEVAIIIFSQTGKLFDFSSSSTKD 64 KI+I+KID LPARQVT+SKRRRG+ KKA ELSVLCD E ++IIFS TGKL + SSSSTKD Sbjct: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSSTKD 67 Query: 65 VIARYNSRTGRE-NSDQPTLDQLQLEKKNKIRLSKELKDKSHKLRQMKG 112 VI RY S+TG E N DQ +LD LQ + I+LS E+ DKS LRQM G Sbjct: 68 VITRYESQTGDEGNLDQSSLD-LQ---HDCIKLSNEIADKSRVLRQMNG 112 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11079 (285 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20290 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32859 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761629 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55858404 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28657 (174 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18163 (236 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48280500 (162 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814092 (140 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18003 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18692 (209 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4147 375 e-107 >Contig4147 Length = 209 Score = 375 bits (963), Expect = e-107, Method: Compositional matrix adjust. Identities = 178/193 (92%), Positives = 188/193 (97%) Query: 17 PHYDVKLFNRWSFDDVQVSDISLADYVGVVPARHATYVPHTAGRYSVKRFRKAQCPIVER 76 PH DVKLFNRW+F+ V+V+D+SL DY+GV A+HATYVPHTAGRYSVKRFRKAQCPIVER Sbjct: 17 PHNDVKLFNRWTFEGVEVTDLSLQDYIGVNQAKHATYVPHTAGRYSVKRFRKAQCPIVER 76 Query: 77 LTNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDLNPVQVIVDAVVNSGPREDATRIGSA 136 LTNSLMMHGRNNGKKLMAVRI+RHAMEIIHLLTDLNP+QVIVDAVVNSGPREDATRIGSA Sbjct: 77 LTNSLMMHGRNNGKKLMAVRIVRHAMEIIHLLTDLNPIQVIVDAVVNSGPREDATRIGSA 136 Query: 137 GVVRRQAVDISPLRRVNQAIYLLTTGARESAFRNVKTIAECLADELINAAKGSSNSYAIK 196 GVVRRQAVDISPLRRVNQAIYLLTTGARESAFRN+KTIAECLADELINAAKGSSNSYAIK Sbjct: 137 GVVRRQAVDISPLRRVNQAIYLLTTGARESAFRNIKTIAECLADELINAAKGSSNSYAIK 196 Query: 197 KKDEIERVAKANR 209 KKDEIERVAKANR Sbjct: 197 KKDEIERVAKANR 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18802 (63 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746226 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29059 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28992 (832 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4628 106 5e-25 >Contig4628 Length = 524 Score = 106 bits (264), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 130/541 (24%), Positives = 218/541 (40%), Gaps = 63/541 (11%) Query: 287 LTYTQLLHNVCQLANYLXXXXXXXXXXXXXYLPMLMELPITMLACARIGAVHSVVFAGFS 346 LT+ +L V A+ L P +E + LA R A + + A ++ Sbjct: 31 LTHARLHELVEYAASQLLAAGVAPHDSIALTFPNSIEYVVMFLAVIRCRATAAPLNAAYT 90 Query: 347 AESLAQRIVDCKPKVEITCNAVKRGSKVIHLKDIVDAALIKSSESGVSVDICLTYENQSA 406 AE + D + K+ IT K +S VS L+ +A Sbjct: 91 AEEFEFYLSDSESKLLITSE--------------------KPIQSAVSAATKLSIPYVTA 130 Query: 407 MKRESTKWLEGRDVCWQDVIPKYPTTCAVEWV--DAEDPLFLLYTSGSTGKPKGVLHTTG 464 E G +VC P+ ++ D D L+TSG+T +PKGV T Sbjct: 131 ALSEG-----GGNVCLSSATVGEPSCDSISKFVNDPSDVALFLHTSGTTSRPKGVPLTQ- 184 Query: 465 GYMVYAATTFKYAFDYKSSDIYWCTADCGWITGHSYVTYGPLLNGATAVLYEGAP-NYPD 523 + A++ Y+ ++ +D I + +G L+ G + GA P Sbjct: 185 --LNLASSVRNIRSVYRLTE-----SDSTVIVLPLFHVHG-LIAGLLSSFTAGAAVTLPA 236 Query: 524 PGRC-----WDVVDKYKVSIFYTAPTLVRSLM-RDSDEYVTRYSRKSLRVLGSVGEPINP 577 GR W + KY + + PT+ + ++ R +++ Y + LR + S + P Sbjct: 237 AGRFSASTFWADMLKYNATWYTAVPTIHQIILDRHANKPEPAYPK--LRFIRSCSASLAP 294 Query: 578 SAWKWVFNVVGDSKCPISDTWWQTETGGFMIT-PLPGAWPQKPGSATFPFFGVQAVIVDE 636 S + G P+ + + TE M + PLP KPGS P G + I++E Sbjct: 295 SILARLEESFG---APVLEAYAMTEATHLMCSNPLPEDGAHKPGSVGKPV-GQELAILNE 350 Query: 637 KGVEIEGECSGYLCVKSSWPGAFRTLYGDHERYETTYFKPFPGYYFSGDGCSRDKDGYHW 696 GV + SG +C++ P + + E + + G++ +GD D DGY Sbjct: 351 NGVVQPSDVSGEVCIRG--PNVTKGYKNNPEANKAAFTF---GWFHTGDVGFLDSDGYLH 405 Query: 697 LTGRVDDVINVSGHRIGTAEVESALVSHPQCXXXXXXXXXXXXKGQGIYAFVTLVEGVPY 756 L GR+ ++IN G +I EV++ L+SHP+ G+ I + EG Sbjct: 406 LVGRIKELINRGGEKISPIEVDAVLLSHPEICQAVCFGVPDDKYGEEINCAIIPREGSSI 465 Query: 757 SEELRKSLILAVRKQIGPFAAPDKIHWAPGLPKTRSGKIMRRI-----LRKIASRQLDEL 811 E ++ +K + F P K+ +PKT +GKI RRI L +I++ ++ + Sbjct: 466 DE---AEVMRFCKKNLAAFKVPKKVFITDSVPKTATGKIQRRIVAEHFLAQISTAKVPKF 522 Query: 812 G 812 G Sbjct: 523 G 523 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22855 (237 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226756907 (114 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 77982401 104 2e-25 >77982401 Length = 185 Score = 104 bits (260), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 47/100 (47%), Positives = 71/100 (71%) Query: 15 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74 +KE+RILMVGLD +GKTTI+ ++ + PT+GFN++T+ Y+ + +WDVGGQ I Sbjct: 14 EKEIRILMVGLDNSGKTTIVLRINGEDTSVVSPTLGFNIKTLTYQKYTLNIWDVGGQKTI 73 Query: 75 RPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNED 114 R WR+YF+ T GL++VVDS+D R+ + + EL +L E+ Sbjct: 74 RSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEE 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4316 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7291 (257 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18083 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4694 337 6e-95 >Contig4694 Length = 351 Score = 337 bits (863), Expect = 6e-95, Method: Compositional matrix adjust. Identities = 153/298 (51%), Positives = 209/298 (70%) Query: 5 SNSKAVEELAAKIGEACRTWGFFTVINHGVPSDIRRRIMEASRKFFALPLEEKKKVSREA 64 S+ KA+E L +IG AC+ WGFF VINHGVP ++R ++ +RKFFA PLEEK+K+ R+ Sbjct: 41 SDPKAIEVLVREIGNACKNWGFFQVINHGVPLEMREKVETTARKFFAQPLEEKRKIRRDE 100 Query: 65 HNTAGFHNDEHSKDFKDWKEVYDFYVNDGMLMPASHEPDDPEIVPWYTPWPENLSKFRET 124 G+++ EH+K+ +DWKEVYDF V + L+P+S EPDD E W+ WPEN + RE Sbjct: 101 KCVVGYYDTEHTKNVRDWKEVYDFLVEEPTLVPSSTEPDDKEETQWFNQWPENPPELREV 160 Query: 125 CEEYGRACEKXXXXXXXXXXXXXXXPPTRLHGYFENQASFARLNYYAPCPKPDLVLGTGG 184 E+Y + EK P R GYF++Q SF RLN+Y PCP P+L LG G Sbjct: 161 MEDYSQEVEKLSLKLMGLIALSLGLPEDRFKGYFKDQTSFIRLNHYPPCPSPELALGVGR 220 Query: 185 HRDPSALTVLAQEDVEGLDVLRKSDGAWVRVKPVPDSFVINVGDVLQVWSNDLYESVEHR 244 H+D ALTVLAQ++V GL+V RK+DG W+RV+P P++++INVGDV+QVWSND YESVEHR Sbjct: 221 HKDGGALTVLAQDEVGGLEVKRKTDGEWIRVRPTPNAYIINVGDVIQVWSNDEYESVEHR 280 Query: 245 AMVHAETERYSIPIFFHPSHDITMKPLDELVDERSPAKYPEYKAGKWLNLRMFNNYKK 302 MV++E ER+S+ F +P+H +KPL+EL ++++PAKY Y GK+L LR +N+KK Sbjct: 281 VMVNSEKERFSVLFFLNPAHYTEVKPLEELTNKQNPAKYTPYSWGKFLTLRKLSNFKK 338 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30449 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31420 (330 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3203 298 3e-83 >Contig3203 Length = 204 Score = 298 bits (763), Expect = 3e-83, Method: Compositional matrix adjust. Identities = 145/182 (79%), Positives = 165/182 (90%), Gaps = 1/182 (0%) Query: 1 MKRLGSSDSLGAMISICPIIT-DEQSPRSNHVYSREFQSMLEGLDEDGCVEEAGRVSEKK 59 MKRLGSSDSLGA+ISICP T DE SPR+NHVYSR+FQSML+GLDE+GCVEE+G V+EKK Sbjct: 1 MKRLGSSDSLGALISICPTTTADEHSPRNNHVYSRDFQSMLDGLDEEGCVEESGHVAEKK 60 Query: 60 RRLNVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVSVWFQNRRARWKTKQLERDY 119 RRL+VEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQV+VWFQNRRARWKTKQLERDY Sbjct: 61 RRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDY 120 Query: 120 GVLKADYDSLKCSYDILQHDNEALLKEIKQLKAKFQENTESTNPSVKQEKLLGKDQSSYR 179 GVLKA+YDSLK S+D LQHDN+AL KEIK+LKAKFQE +N SVK+E++ ++SSY+ Sbjct: 121 GVLKANYDSLKISFDSLQHDNQALHKEIKELKAKFQEENTESNHSVKEEQMALANESSYK 180 Query: 180 AV 181 V Sbjct: 181 MV 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71812598 (122 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14009 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18371 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28458 (350 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25687 (244 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14838 (316 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22204 (302 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5247 (235 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24758 (354 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414076 (145 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3590 101 2e-24 >Contig3590 Length = 114 Score = 101 bits (252), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 2/116 (1%) Query: 30 MKVVAAYLLAVLGGKSSPSAADLKDILGSVGAEADGDKIELLLAEVKGKDITELIASGRE 89 MKV+AAYLLAVLGGK+SP+A D+K ILG+VGAEAD D+I+LLL EVKGKDITELIASGRE Sbjct: 1 MKVIAAYLLAVLGGKTSPTAEDIKTILGAVGAEADEDRIQLLLKEVKGKDITELIASGRE 60 Query: 90 KLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDDDMGFSLFD 145 KL SDDDMGFSLFD Sbjct: 61 KL--ASVPSGGGGAVAVAAPAGGAGGAAPAAAEAKKEEKVEEKEESDDDMGFSLFD 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31944 (143 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16162 (291 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226773227 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8554 (379 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27709 (155 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29757 (470 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48693757 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20292 (56 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3705 (158 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21457 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14295 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23013 (203 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16690 (243 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6201 (190 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4113 237 3e-65 >Contig4113 Length = 368 Score = 237 bits (605), Expect = 3e-65, Method: Compositional matrix adjust. Identities = 112/186 (60%), Positives = 136/186 (73%), Gaps = 3/186 (1%) Query: 3 SEPVNVNEYQELARQALPKMYYDYYTGGAEDQHTLKENVEAFRRITLRPRILVDVSRVDM 62 E NV+EY+ +A+Q LPKM YDYY G+EDQ TL EN AF +I RPRIL+DVS +DM Sbjct: 2 GEVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNIDM 61 Query: 63 STTVLGYKISAPIMLAPTAMHQLAHPEGEVXXXXXXXXCNTIMILSYMSTCTVEEVASSC 122 +TTVLG+KIS PIM+APTA ++AHPEGE TIM LS +T +VEEVAS+ Sbjct: 62 TTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTG 121 Query: 123 NAVRFFQIYVYKRRDISAQMVRRAEKNGYKAIVLTADTPRLGRREADIKNKMVAP---QL 179 +RFFQ+YVYK R + AQ+VRRAE+ G+KAI LT DTPRLGRREADIKN+ P L Sbjct: 122 PGIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTL 181 Query: 180 RNFEGL 185 +NFEGL Sbjct: 182 KNFEGL 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48413346 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29184 (255 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 111 4e-27 >89552756 Length = 189 Score = 111 bits (277), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 64/170 (37%), Positives = 95/170 (55%), Gaps = 9/170 (5%) Query: 32 GSLYRIIHRPHCQIDEKRRIKMALDVARGMNCLHASTPTIVHRDLKSPNLLVD----KNW 87 GSL + + + ID ++R+ +A+D A GM LH IVH DLK NLLV+ + Sbjct: 4 GSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKN--IVHFDLKCENLLVNMRDPQRP 61 Query: 88 NVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNENS--NEKCDVYSFGVILWELAT 145 K+ D GLS++K T +S GT WMAPE+L ++ EK DVYSFG+++WEL T Sbjct: 62 VCKIGDLGLSKVKQQTLVSG-GVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLT 120 Query: 146 LKLPWSGMNPMQVVGAVGFQNRRLEIPKELDPLVARIIWECWQTDPNLRP 195 P++ M+ ++G + R +IP DP ++ CW ++P RP Sbjct: 121 GDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRP 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32866 (129 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25664 (718 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6452 (283 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27375 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27515 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 57896440 76 1e-16 >57896440 Length = 244 Score = 75.9 bits (185), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 3/66 (4%) Query: 12 YYSVLGVGSDSSVEEIRRAYRKLAMKWHPDRWTRTPSLLGEAKRKFQQIQEAYSVLSDQR 71 YY +L V ++ +E+++AYRKLAMKWHPD + P+ EA+ KF+QI EAY VLSD + Sbjct: 5 YYKLLQVEKSATEDELKKAYRKLAMKWHPD---KNPTNKKEAETKFKQISEAYEVLSDPQ 61 Query: 72 KRSMYD 77 KR++YD Sbjct: 62 KRAIYD 67 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig661 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15534 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3000 (172 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5731 (329 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22090 (464 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226789661 (75 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46597440 (79 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25132 (319 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig258 231 5e-63 >Contig258 Length = 254 Score = 231 bits (588), Expect = 5e-63, Method: Compositional matrix adjust. Identities = 137/298 (45%), Positives = 169/298 (56%), Gaps = 71/298 (23%) Query: 25 LNLKATELRLGLPGSQSPERDXXXXXXXXVEEKATGFSVCGVKGLVSGAKRGFSDAIDGA 84 +N + TELRLGLPG+ +++ G C S KRGFS+ +D Sbjct: 21 INFEETELRLGLPGA--------------LKDGDQGVKSC------SSGKRGFSETVD-- 58 Query: 85 SGKWVFSGSGGSEVELGKGGNLLSPRGVNAGKALAAGCEPSNQPTGLAGSAVKDGVQQSP 144 L N +G +DG Sbjct: 59 ---------------------------------LKLNFSSENDDVSRSG---RDG----- 77 Query: 145 KPLHEKKPQGSAGSTAPAAKAQVVGWPPIRSFRKNSMASVPSKNGD-----DAEGKMGAG 199 + KK + ++ + AP AKAQVVGWPP+RSFRKN +A V K+ D + G Sbjct: 78 -QVEIKKEKDASAAPAPRAKAQVVGWPPVRSFRKNIVA-VQKKSTDQDQAAEKSGSTSTS 135 Query: 200 CLYVKVSMDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGSHGASRDGLSESRLM 259 +VKVSMDGAPYLRKVDLK Y SY +LS AL KMFS FTIG CGS G +D ++ES+L+ Sbjct: 136 AAFVKVSMDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGM-KDFMNESKLI 194 Query: 260 DLLHGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGLAPRAMQKCKN 317 DLL+G+EYV +YEDKDGDWMLVGDVPWEMF DSCKR+RIMK SEAIGLAPRA++K KN Sbjct: 195 DLLNGSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKN 252 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28932 (323 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158379466 330 6e-93 >158379466 Length = 226 Score = 330 bits (846), Expect = 6e-93, Method: Compositional matrix adjust. Identities = 157/222 (70%), Positives = 181/222 (81%) Query: 4 KFAIKNDVTELIGNTPLVYLNNVVDGCVARIAAKLESMEPCSSVKDRIAYSMIKDAEDKG 63 K I DVTELIG TPLVYLN++VDGCVARIAAKLE MEPCSSVKDRI YSMI DAE KG Sbjct: 5 KSGIAKDVTELIGKTPLVYLNHIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKG 64 Query: 64 LITPGKTVLIEATSGNTGIGLAFIAASRGYKVKLTMPSSMSIERRIVLLAFGAEVYLTDP 123 LITPG++VLIE TSGNTGIGLAF+AA++ Y++ +TMP+SMSIERRI+L AFGAE+ LTDP Sbjct: 65 LITPGQSVLIEPTSGNTGIGLAFMAAAKQYRLIITMPASMSIERRIILRAFGAELVLTDP 124 Query: 124 AKGIKGAFDKAEELLSDTPNGYILGQFENPANPKIHYETTGPEIWRDTGAKVDALVSXXX 183 AKG+KGA KAEE+L+ TPN Y+L QFENPANPK+HYETTGPEIW TG K+DA VS Sbjct: 125 AKGMKGAVQKAEEILAKTPNAYMLQQFENPANPKVHYETTGPEIWEGTGGKIDAFVSGIG 184 Query: 184 XXXXXXXXXKFLKEQNPEIKVYGVEPAESPVLNGGQAGKHLI 225 K+LKE+NP +K+YGVEP ESPVL GG+ G H I Sbjct: 185 TGGTITGAGKYLKEKNPSVKLYGVEPVESPVLTGGKPGPHKI 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8605 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46873003 (101 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10641 (343 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226799765 (77 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24216 (426 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5971 (318 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4390 534 e-154 >Contig4390 Length = 667 Score = 534 bits (1376), Expect = e-154, Method: Compositional matrix adjust. Identities = 268/317 (84%), Positives = 274/317 (86%) Query: 2 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 61 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS Sbjct: 351 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 410 Query: 62 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 121 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV Sbjct: 411 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 470 Query: 122 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRAEDKGTGKS 181 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNV+AEDKGTGKS Sbjct: 471 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKS 530 Query: 182 EKITITNDKGRLSQEEIDRMXXXXXXXXXXXXXXXXRIDARNSLETYVYNMKNQINDKDK 241 EKITITNDKGRLSQEEI+RM +IDARNSLETY YNMKNQINDKDK Sbjct: 531 EKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKEKIDARNSLETYTYNMKNQINDKDK 590 Query: 242 LADKLESDXXXXXXXXXXXXXXWLDDNQTAEKEDYDEKLKEVEAVCNPIISAVYQXXXXX 301 LADKLESD WLDDNQTAEKEDY+EKLKEVEAVCNPII+AVYQ Sbjct: 591 LADKLESDEKEKIETAVKEALEWLDDNQTAEKEDYEEKLKEVEAVCNPIITAVYQRSGGA 650 Query: 302 XXXXXXXEEDDESHDEL 318 EEDD+SHDEL Sbjct: 651 PGGESASEEDDDSHDEL 667 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13617 (359 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32239 (289 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3203 72 4e-15 >Contig3203 Length = 204 Score = 72.0 bits (175), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 39/77 (50%), Positives = 51/77 (66%) Query: 140 GSNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKL 199 G A KK RL+ EQ LE++F+ + L P++K LA++L L+PRQV VWFQNRRAR K Sbjct: 54 GHVAEKKRRLSVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKT 113 Query: 200 KQTEVDCEFLKKCCETL 216 KQ E D LK ++L Sbjct: 114 KQLERDYGVLKANYDSL 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19169 (175 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51097873 (70 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48938679 (124 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2703 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18533 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91011098 (133 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48384743 (152 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4436 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1803 68 1e-14 >Contig1803 Length = 76 Score = 67.8 bits (164), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 31/54 (57%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Query: 45 YPDLGYLENASTETLIAGVAPVKMFYERSEMNYGAENGCKYGSNCSYSSCGWQK 98 YPDL E+++T T+I+GV M++E SEM++GAENGCK GSNCS +SCG K Sbjct: 26 YPDL---ESSTTATIISGVPSTTMYFEESEMSFGAENGCKCGSNCSCTSCGCHK 76 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4423 (75 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7532 (295 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3762 363 e-103 >Contig3762 Length = 261 Score = 363 bits (932), Expect = e-103, Method: Compositional matrix adjust. Identities = 179/261 (68%), Positives = 202/261 (77%), Gaps = 2/261 (0%) Query: 8 MNMVFLLSLFTTSLMVMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKS 67 M ++ L+L +++ ASAGNF QDFDIT+GDGRAKILN QLLTL LDK SGSGFKS Sbjct: 1 MAKIYALALVMFFKILVAASAGNFNQDFDITWGDGRAKILNNAQLLTLALDKTSGSGFKS 60 Query: 68 KNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSEGPTHDEIDFEFLGNSTGEPYTLHTNVFS 127 +N+YLFG+IDMQIKLV GNSAGTVT+YYLSS G HDEIDFEFLGN +G+PYTLHTNVF+ Sbjct: 61 RNQYLFGKIDMQIKLVPGNSAGTVTSYYLSSLGSAHDEIDFEFLGNLSGDPYTLHTNVFT 120 Query: 128 QGKGNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPM 187 QGKGNREQQF+LWFDPTK FHTYSI+WN Q IIF VD PIR F NLES G+PFPKNQ M Sbjct: 121 QGKGNREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGTPIREFKNLESRGIPFPKNQAM 180 Query: 188 RIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKXXXXXXXXXXXXXXXXXXXXLTEQ 247 IYSSLWNADDWATRGGLVKTDW++APFTASYRNF E Sbjct: 181 WIYSSLWNADDWATRGGLVKTDWSKAPFTASYRNFNAQACIWSSGSSSCSSSPSGSSKE- 239 Query: 248 SAWKTQGLDAAGRNRLRWVQQ 268 AW TQ LDA G+ R++WVQ+ Sbjct: 240 -AWFTQSLDATGKGRMKWVQR 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226796664 (184 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7935 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22916 (286 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13092 (156 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22698 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1254 (121 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28706 (271 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32411 (183 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226762029 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11272 (412 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48274410 (186 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17635 (130 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8715 (275 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17769 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4398 233 8e-64 >Contig4398 Length = 192 Score = 233 bits (595), Expect = 8e-64, Method: Compositional matrix adjust. Identities = 116/214 (54%), Positives = 146/214 (68%), Gaps = 22/214 (10%) Query: 84 DEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFTNADKIHAAKALSRLGLEDIFEGI 143 D++HSFVHGRLPY +KPD VLR LLL+LP RK+IFTN+DK H L RLG+ED FE I Sbjct: 1 DDFHSFVHGRLPYNLLKPDHVLRGLLLSLPVRKVIFTNSDKNHTITVLKRLGIEDCFESI 60 Query: 144 ICFETLNPIHKNTVSDDEDDIEFVGLXXXXXXXXXXQIFDIIGHFATPNPTSKLPKTPIV 203 ICFETLNP + S D ++ +FV PN + P++P++ Sbjct: 61 ICFETLNPTNSADGSADAEETDFV---------------------QQPNTDAVTPRSPVI 99 Query: 204 CKPSEDAIERALKIANINPQRTLFFEDSVRNIQAGKRVGLQTVLVGTSQRVKGADYALES 263 CKP E+A A KIANINPQRTLFF+DS+RN++ K+VGLQTV VGTS R K D+ALES Sbjct: 100 CKPFENAYVEAFKIANINPQRTLFFDDSIRNLETAKQVGLQTVWVGTSHRTKDVDHALES 159 Query: 264 IHNLREAIPELWEADRKSKVGYSGKIAVETSVTA 297 IHN+REA+PELW A++ V YS ++A+ET V A Sbjct: 160 IHNMREALPELW-AEQSENVIYSREVAIETPVEA 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56200692 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20523 (311 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14799 (428 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2870 491 e-141 >Contig2870 Length = 408 Score = 491 bits (1263), Expect = e-141, Method: Compositional matrix adjust. Identities = 238/311 (76%), Positives = 264/311 (84%) Query: 114 FSEKFPFLITGFFFFMWYLLNVIFNILNKKVYNYFPYPYFVSVIHLLVGVVYCLVSWSVG 173 F K+P+L+TGFFFFMWY LNVIFNILNKK+YNYFPYPYFVSVIHL VGVVYCL+SW+VG Sbjct: 97 FLGKYPWLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLISWAVG 156 Query: 174 LPKRAPIDKEQLALLTPVAFCHALGHVMSNVSFAAVAVSFTHTIKALEPFFNASASQFVL 233 LPKRAP+D QL LL PVA CHALGHV SNVSFAAVAVSFTHTIKALEPFFNASASQF+L Sbjct: 157 LPKRAPMDSNQLKLLIPVAACHALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFIL 216 Query: 234 GHHIPLSLWLSLAPVVIGVSMASLTELSFNWLGFGSAMISNIAFTYRSIYSKKAMTGMDS 293 G IPLSLWLSLAPVV+GVSMASLTELSFNWLGF SAMISNI+FTYRSIYSKKAMT MDS Sbjct: 217 GQSIPLSLWLSLAPVVLGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDS 276 Query: 294 TNVYAYISIIALLVCIPPAILIEGPQLMQYGFKDAIAKVGLYKFVSDLFWIGMFYHLYNQ 353 TN+YAYISIIAL C+PPA+++EGPQL+++GF DAIAKVGL KF++DL W+G+FYHLYNQ Sbjct: 277 TNLYAYISIIALFFCLPPALILEGPQLLKHGFADAIAKVGLVKFITDLVWVGLFYHLYNQ 336 Query: 354 LATNTLERVAPLTHAVGNVLKRXXXXXXXXXXXXNKISXXXXXXXXXXXXXVAIYSLIKA 413 LATNTLERVAPLTHAVGNVLKR NKIS VAIYS +KA Sbjct: 337 LATNTLERVAPLTHAVGNVLKRVFVIGFSIVIFGNKISTQTGIGTAIAIAGVAIYSYLKA 396 Query: 414 NLEEQKRKAAA 424 +EE+KR+A A Sbjct: 397 KIEEEKRQAKA 407 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26123 (177 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2610 (253 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2810 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49633160 (95 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18031 (274 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14016 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9858 (377 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15521 (360 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26966 (442 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8633 (372 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27061 (297 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 59 4e-11 >Contig2005 Length = 422 Score = 58.9 bits (141), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 56/203 (27%), Positives = 91/203 (44%), Gaps = 25/203 (12%) Query: 25 IFDGHNGISAAIFTKENLLANVLSAIPQG-------------TSRDEWLQALPRALVAGF 71 ++DGH A+ K+ L V + + DE +QA RAL Sbjct: 162 VYDGHGCSHVALKCKDRLHEIVKQDLESQRVVQWKDTMERSFSKMDEEVQAGNRALQNPN 221 Query: 72 VKTDIEFQQKGETSGTTVTFVVIDDWTVTVASVGDSRCILDTQGGVVSLLTVDHXXXXXX 131 + +++ Q + G+T V+ + V++ GDSR +L +G V L + DH Sbjct: 222 CRCELQTPQ-CDAVGSTAVVAVVTPEKIIVSNCGDSRAVLCRKGAAVPL-SSDHKPDRPD 279 Query: 132 XXXXXVTASGGEVGRLNIFGGNEVGPLRCWPGGLCLSRSIGDTDVGEYIVPIPHVKQVKL 191 + A+GG R+ + G V G L +SR+IGD + Y++ P V + Sbjct: 280 ELLR-IEAAGG---RVIYWDGPRV------LGVLAMSRAIGDNYLKPYVISEPEVTIMDR 329 Query: 192 SNAGGRLIIASDGIWDALSSDMA 214 + LI+ASDG+WD +S+D A Sbjct: 330 TAEDECLILASDGLWDVVSNDTA 352 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7310 (583 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3826 64 2e-12 >Contig3826 Length = 597 Score = 64.3 bits (155), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 52/193 (26%), Positives = 83/193 (43%), Gaps = 14/193 (7%) Query: 200 KDKKEAMEPEADPERD-QRTVFAYQMPLKAAERDVYEFFSKAGKVRDVRLIMDRNSRRSK 258 K +K+A + A PE +T+FA + ++DV EFF G+V DVRL D + K Sbjct: 325 KSEKKAPKTPATPETSGSKTLFAGNLSYNIEQKDVVEFFKNVGQVVDVRLSSDADG-NFK 383 Query: 259 GVGYIEFYDAMSVPMAIALSGQLLLGQPVMVKPS--EAEKNLVQSNATSXXXXXXXXXXX 316 G G++EF A A+ L+G L G+P+ + + E+ ++ Sbjct: 384 GYGHVEFATAEEAQKAVGLNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG 443 Query: 317 XDRKLYVGNLHFNMTETHLREI----FEPFGPVELVQLPLDLETGQCKGFGFVQFAHLEH 372 + ++V E +R F G + V +P D +TG KG ++ F Sbjct: 444 QSQTIFVRGFDTTQGEDEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTD--- 500 Query: 373 AKAAQSLNGKLEI 385 A +LN LE Sbjct: 501 ---ADALNKALEF 510 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31898 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26657 (284 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761053 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4147 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48271147 (126 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4675 (194 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414951 (138 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22024 (301 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29068 (216 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550254 380 e-108 >89550254 Length = 219 Score = 380 bits (977), Expect = e-108, Method: Compositional matrix adjust. Identities = 182/208 (87%), Positives = 198/208 (95%) Query: 8 KLLEAGTKIVGVGRNYAAHAKELGNAVPKEPVLFLKPTSSYLKNGGTIEVPHPLLSLDHE 67 +LL+ GTKI+GVGRNYAAHAKELGNAVPKEPVLFLKPTSSYL+NGGTIE+PHPL SLDHE Sbjct: 4 RLLQVGTKIIGVGRNYAAHAKELGNAVPKEPVLFLKPTSSYLENGGTIEIPHPLESLDHE 63 Query: 68 VELAVIISQKARDVPQSTAMDYVAGYALALDMTAREIQASAKSAGLPWTIAKGQDTFTPI 127 VELAV+IS+KARDVPQ+ AM+YV GYALALDMTAREIQA+AKSAGLPWTIAKGQDTFTPI Sbjct: 64 VELAVVISKKARDVPQAKAMEYVGGYALALDMTAREIQATAKSAGLPWTIAKGQDTFTPI 123 Query: 128 SSALPKEMVPNPDDIELWLKVDGELKQKGSTKDMIFKLPFLISHISSIMTLLEGDVILTG 187 SS L VP+PDD+ELWLKVDGE++QKGSTKDMIFK+PFLISHISSIMTLLEGDVILTG Sbjct: 124 SSVLSLATVPDPDDLELWLKVDGEVRQKGSTKDMIFKIPFLISHISSIMTLLEGDVILTG 183 Query: 188 TPQGVGPVKIGQKITAGITNLVDVQFNV 215 TP+GVGPVK GQKITAGITNLVDVQFNV Sbjct: 184 TPKGVGPVKAGQKITAGITNLVDVQFNV 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48269463 (136 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27877 (427 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22374 (352 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8974 (206 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21132 (160 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6549 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2035 (132 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3744 135 1e-34 >Contig3744 Length = 265 Score = 135 bits (339), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 63/88 (71%), Positives = 72/88 (81%), Gaps = 2/88 (2%) Query: 3 EIRRTTVTDDLLVVLPSAKAVTDLQPQFDAIRQCPGSSGVIITGIAPPESGYDFYSRYFC 62 EI RT V D+L+VVLPS K+V DL PQ DAI +CPG GVI+TG+APPESG+DF SRYFC Sbjct: 179 EIMRT-VADNLIVVLPSGKSVADLLPQIDAIEKCPGF-GVIVTGVAPPESGFDFISRYFC 236 Query: 63 PKHGIDEDPVTGSAHCALASYWCKKLGK 90 PK GI+EDPV GSAHC LA YWCKK G+ Sbjct: 237 PKFGINEDPVCGSAHCGLAPYWCKKTGE 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20244 (208 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23077 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28724 (449 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824593 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2671 (187 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91012380 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21775 (551 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158350521 99 5e-23 >158350521 Length = 226 Score = 99.4 bits (246), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 70/215 (32%), Positives = 112/215 (52%), Gaps = 12/215 (5%) Query: 110 VLPYVGVACLGAILFGYHLGVVNGAL-----EYLSKDLGIAENAVLQGWVVSTLLAGATV 164 VLP++ LG +L+GY +G + A LS ++V G + S L GA + Sbjct: 12 VLPFL-FPALGGLLYGYDIGATSCATISVESATLSGVSWYDLSSVEIGLITSGSLYGALI 70 Query: 165 GSFTGGSLADKFGRTKTFQINAIPLAVGAFLCATAQSVQTMIVGRLLAGIGIGVTSAIVP 224 GS ++AD GR +AI +GA + A A + M++GR++ GIGIG+ P Sbjct: 71 GSVLAFNIADIIGRRWELISSAIVYLIGAIVTALAPDLPIMVIGRVVFGIGIGLAMHAAP 130 Query: 225 LYISEISPTEIRGALGSVNQLFICIGIXXXXXXXXXXXXXXXWWRTMFGIAVVPSVLLAL 284 +YI+E +P++IRG L S+ + FI +G+ WR M+G +V +V++ + Sbjct: 131 MYIAETAPSQIRGRLISLKEFFIVLGMVAGYGIGSLLVSIVGGWRYMYGASVPLAVIMGI 190 Query: 285 GMAVSPESPRWLFQ-----QGKISE-AEKAIKTLF 313 GM PESPRW+ +G +++ + AI LF Sbjct: 191 GMWWLPESPRWILLRAIQGKGNMNDLKQNAISCLF 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990835 (192 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89541379 66 2e-13 >89541379 Length = 113 Score = 65.9 bits (159), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Query: 106 MSTNLESAYHLCQLSHPLLKASGSANIVLLSSIAGVVSL-NIGTIYSATK 154 M TNLES+Y +CQL+HPLLKASG+ IVL+SSIAGVVS+ +IYSA+K Sbjct: 1 MGTNLESSYSMCQLAHPLLKASGAGKIVLISSIAGVVSVGGCDSIYSASK 50 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12116 (134 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3176 (234 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2922 156 1e-40 >Contig2922 Length = 223 Score = 156 bits (394), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 88/212 (41%), Positives = 126/212 (59%), Gaps = 7/212 (3%) Query: 4 SDVKVLGMAPSPFVMRARIALNLKSVDYEFLQE-TFGSKSELLLQSNPVHKKVPVLIHGD 62 S V VLG SP+V R AL LK VDYE+++E +KS+ LL+ NPVHKKVPVL+H Sbjct: 2 SQVTVLGAWSSPYVYRVIWALKLKGVDYEYVEEDVLHNKSDRLLKYNPVHKKVPVLVHAG 61 Query: 63 KPVCESLIIVEYIDEVWASGPSILPSDPYDRATARFWAAYISEKWYPSMKGIGLAQGEEA 122 KP+ ES +I+EYI+E W P +LP DP+ RA ARFW + +K + ++ G + +GE+ Sbjct: 62 KPIAESAVILEYIEETWPQNP-LLPKDPHQRALARFWIKFGEDK-FGALFGFFMTEGEQQ 119 Query: 123 KKAAIEQVTEGLALLEEAFEKSSKGNVFFGGDEIGYLDIAFGCFLGWLRVNEKLHGIKLL 182 KA E+ E L +LEE K FFGGDE+G D+ FG W+ V +L G+K + Sbjct: 120 VKATKER-QEQLTILEEQGLGDKK---FFGGDELGMADLEFGWLAWWMDVMSELAGVKGI 175 Query: 183 DQTKTPGLVKWADKFCAHAAVKDVMPETDKLV 214 + P L W +F +K+ +P+ ++ Sbjct: 176 EAETFPRLHAWIQRFKDIPTIKEHLPDRSAML 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13156 (265 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25214 (220 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91042114 (149 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8056 (418 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50886902 (102 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4974 137 1e-35 >Contig4974 Length = 423 Score = 137 bits (346), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 68/101 (67%), Positives = 72/101 (71%) Query: 2 KCPGCQGSGMKVSIRHLGPSMIQQMQHPCAECKGTGETINDKDRCTQCXXXXXXXXXXXX 61 KC GCQG+GMKV+IRHLGPSMIQQMQH C ECKGTGETI+DKDRC QC Sbjct: 167 KCGGCQGTGMKVTIRHLGPSMIQQMQHACNECKGTGETISDKDRCGQCKGEKVVHEKKVL 226 Query: 62 XXXXXXGMQNGQKITFPGEADEAPDTITGDIVXCPTTKGAP 102 GMQNGQKITFPGEADEAPDT+TGDIV K P Sbjct: 227 EVHVEKGMQNGQKITFPGEADEAPDTVTGDIVFIIQQKEHP 267 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22926 (251 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20635 (287 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5264 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8751 (325 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5776 202 3e-54 >Contig5776 Length = 289 Score = 202 bits (513), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 109/263 (41%), Positives = 153/263 (58%), Gaps = 5/263 (1%) Query: 22 PTSAQLKTNYYANICPNVESIVRDAVTKKFQQTFVTVPGTLRLFFHDCFVEGCDASVIVA 81 P L ++Y + CP ++SIVR + K F++ G LRL FHDCFV+GCD SV++ Sbjct: 31 PVVKGLSWSFYDSSCPKLDSIVRKQLKKVFKEDIGQAAGLLRLHFHDCFVQGCDGSVLLD 90 Query: 82 STANNKAEKDNPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIGLSG 141 +A+ +E+ P NLSL F + + V + +C VSCAD+ ALA RD + LSG Sbjct: 91 GSASGPSEQQAPPNLSLRAKAFQIINDLREIVHS--KCGRVVSCADLTALAARDAVFLSG 148 Query: 142 GPSYSVELGRLDGLS-STSTSVNGKLPKSTFNLNQLNSLFASHGLSQADMVALSGAHTLG 200 GP Y V LGR DGL+ +T LP T N +L + A L D+VALSG HT+G Sbjct: 149 GPEYEVPLGRKDGLNFATRNETLANLPAPTSNTTKLLTDLAKKNLDATDVVALSGGHTIG 208 Query: 201 FSHCNQFSNRIYSNPVDPTLNKTYATQLQQMCPKNVDPDIAIDMDPTTPRKFDNVYFQNL 260 HC F+ R+Y D +++KT+A L+Q+CP D + +D +P FDN Y+ +L Sbjct: 209 LGHCTSFTGRLYPTQ-DASMDKTFANDLKQVCPA-ADTNATTVLDIRSPDTFDNKYYVDL 266 Query: 261 VEGKGLFTSDQVLYTDSRSQPTV 283 + + LFTSDQ LYTD R++ V Sbjct: 267 MNRQCLFTSDQDLYTDKRTRDIV 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32010 (202 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89552756 149 1e-38 >89552756 Length = 189 Score = 149 bits (375), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 76/183 (41%), Positives = 106/183 (57%), Gaps = 6/183 (3%) Query: 1 MSKGSVYDFLHKHKGVFKLPSLLKVAIDVSKGMNYLHQNNIIHRDLKTANLLMD----EH 56 M GS+ FL K L +A+D + GM YLH NI+H DLK NLL++ + Sbjct: 1 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 60 Query: 57 EVVKVADFGVARVQTQSGVMTAETGTYRWMAPEVIEHKPY--DHKADVFSFGIVLWELLT 114 V K+ D G+++V+ Q+ V GT WMAPE++ K + K DV+SFGIV+WELLT Sbjct: 61 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSHMVTEKIDVYSFGIVMWELLT 120 Query: 115 GQIPYSSLTPLQAAVGVVQKSLRPTIPKTTHPRFAELLERCWQQDPTQRPPFSDIIEILQ 174 G PY+ + G+V +LRP IP P + L+E CW +P QRP FS+I + L+ Sbjct: 121 GDEPYTDMHCASIIGGIVNNTLRPQIPTWCDPEWKSLMESCWGSEPAQRPSFSEISQKLR 180 Query: 175 NLA 177 N+A Sbjct: 181 NMA 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31581 (128 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1835 263 2e-73 >Contig1835 Length = 128 Score = 263 bits (673), Expect = 2e-73, Method: Compositional matrix adjust. Identities = 128/128 (100%), Positives = 128/128 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGIIEPSLMALARKYNQEKMICRKCYARLHPRAVNCRKKKCGHSNQ 120 IQKESTLHLVLRLRGGIIEPSLMALARKYNQEKMICRKCYARLHPRAVNCRKKKCGHSNQ Sbjct: 61 IQKESTLHLVLRLRGGIIEPSLMALARKYNQEKMICRKCYARLHPRAVNCRKKKCGHSNQ 120 Query: 121 LRPKKKIK 128 LRPKKKIK Sbjct: 121 LRPKKKIK 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28288 (344 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21541 (520 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26818 (281 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 114 5e-28 >158372667 Length = 230 Score = 114 bits (286), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 86/244 (35%), Positives = 121/244 (49%), Gaps = 30/244 (12%) Query: 28 DAEELTKWSFYRALIAEFIATLLFLYITVLTVIGYKSQSEADQCGGVGILGIAW-AFGGM 86 E K +RALI EF+ T LF++ G S D+ G + + + A Sbjct: 8 STSEAAKPEVWRALIVEFVTTFLFIFA------GVGSAMATDKLGADTTVALFFIAITHA 61 Query: 87 IFVLVYCTAG-ISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKAFQKS 145 + V V +AG ISGGH+NPAVT GL ++L R+VLY I Q L A Sbjct: 62 LVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAA---------SC 112 Query: 146 YYMKYGGGA-----NELSAGYNKGTGLGAEIIGTFVLVYTVFSA-TDPKRNARDSHVPVL 199 Y +KY G + L++G G+ EII TF L++TV++ DPK+ + D L Sbjct: 113 YLLKYLTGGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDG----L 168 Query: 200 APLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAA 259 P GF V LA +G +NPARSFG A++ W D W++W+GP IG +A Sbjct: 169 GPTLTGFVVGANILAGGAFSGASMNPARSFGPALV---SWDWTDHWVYWVGPLIGGGLAG 225 Query: 260 FYHQ 263 F ++ Sbjct: 226 FIYE 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27340 (72 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24736 (340 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2204 556 e-161 >Contig2204 Length = 342 Score = 556 bits (1433), Expect = e-161, Method: Compositional matrix adjust. Identities = 269/338 (79%), Positives = 293/338 (86%), Gaps = 6/338 (1%) Query: 1 MKLGSQGLEVSAQGLGCMGMSAFYGAPKPDQDMISLIHHAINSGVTFLDTSDIYGPFTNE 60 +KLGSQGLEVSAQGLGCMGMSAFYG PKP+ DMI LIHHA++SGVTFLDTSDIYGP TNE Sbjct: 7 IKLGSQGLEVSAQGLGCMGMSAFYGPPKPEPDMIKLIHHAVDSGVTFLDTSDIYGPHTNE 66 Query: 61 ILLGKALKGGVRDKVELATKFGLRFVENKMEVGKNMEVQGDPAYVRAALESSLKRLGVDS 120 ILLGKAL GGVRDKVELATKFG+ F +NK EV +GDPAYVRAA E+SLKRLG++ Sbjct: 67 ILLGKALSGGVRDKVELATKFGISFADNKREV------RGDPAYVRAACEASLKRLGLNC 120 Query: 121 IDLYYQHRIDTSVPVEVTXXXXXXXXXXXXXXYIGLSEASASTIRRAHAVHPITAVQLEW 180 IDLYYQHRIDT +P+EVT YIGLSEASASTIRRAHAVHPITAVQLEW Sbjct: 121 IDLYYQHRIDTRLPIEVTVGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEW 180 Query: 181 SLWSRDVEQEIIPTCRELGIGIVAYSPLGRGFFASGAKFVENLAHGDSRKNLPRFQPENV 240 SLWSRDVE++IIPTCRELGIGIVAYSPLGRGF +SGAKFVENLA+ D RK LPRFQ EN+ Sbjct: 181 SLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFLSSGAKFVENLANDDFRKFLPRFQGENL 240 Query: 241 EHNKTLFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIPGTTKIANFDQNIAALSVKLT 300 EHNK++FERVSDLA RKGCT SQLALAWVHHQGNDVCPIPGTTKI NF+QNI ALSVKLT Sbjct: 241 EHNKSIFERVSDLATRKGCTSSQLALAWVHHQGNDVCPIPGTTKIENFNQNIGALSVKLT 300 Query: 301 PEELAELESYASVDAVKGERYPNYYSTWSNSETPPLSS 338 PEE AELES+A+ DAVKG+RY N +STW NSETPPLSS Sbjct: 301 PEEKAELESFATADAVKGDRYQNDFSTWKNSETPPLSS 338 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19569 (80 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6904 (421 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158365522 131 7e-33 >158365522 Length = 211 Score = 131 bits (329), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 68/181 (37%), Positives = 102/181 (56%), Gaps = 2/181 (1%) Query: 113 FGNSPELIRSATQILLEENIDQLDDLSCAVEIAYQVAGSEYEDDTLWGKKVGWVYGSVSE 172 FG SP I A+ ++ + + + ++ A V YED T WGK+VGW+YGSV+E Sbjct: 10 FGQSPVFI--ASSLMEDGGVPMGTSSASLLKEAIHVISCGYEDKTEWGKEVGWIYGSVTE 67 Query: 173 DVLTGMKIHARGWKSILCTPEPPGFLGTGPSTTHVMLIQRKRWITGLLEILFSKNCPIFA 232 D+LTG K+H GW+S+ C P+ P F G+ P L Q RW G +EIL S++CPI+ Sbjct: 68 DILTGFKMHCHGWRSVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWY 127 Query: 233 TLYAKPEFKQCLAYLRILIWGLLSDPDLCYALLPAYCIITNSHFLPKVEEPTLIIFAALF 292 + + +Y+ +++ L S P + Y LPA C++T +P++ IIF ALF Sbjct: 128 GYGCGLKSLERFSYINSVVYPLTSIPLIAYCSLPAVCLLTGKFIVPEISNYASIIFMALF 187 Query: 293 L 293 L Sbjct: 188 L 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28888 (401 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10714 (163 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27549 (173 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24188 (264 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158368865 228 3e-62 >158368865 Length = 226 Score = 228 bits (581), Expect = 3e-62, Method: Compositional matrix adjust. Identities = 128/197 (64%), Positives = 154/197 (78%), Gaps = 3/197 (1%) Query: 1 MAGREHPRQLVRLTPLSVNTTALEDRIALQNREIQSLLVDNQRLAAAHVALKQDLAAAQH 60 MAGRE PR L RL P VNTTALEDR+ LQ REIQSLL+DNQRLAA HVALKQDL +AQ Sbjct: 1 MAGRE-PRHLHRL-PQIVNTTALEDRVDLQQREIQSLLIDNQRLAATHVALKQDLTSAQS 58 Query: 61 DLRHLSVVAGKAKSERDAEVREVYERALKLDAEVRAIDSMGADLARTRADIQELGSSRQE 120 DLR+L VAG+ KSER+AEVREVY+R+LKLD E+R +D+M A+L+ DI++L +SR E Sbjct: 59 DLRNLKAVAGQIKSERNAEVREVYDRSLKLDDELRGLDAMKAELSVVLNDIEDLSASRME 118 Query: 121 LAEELNTIEGELARTQSEAKKVVDIKAD-IETFKQEIKKGRDAIDNEKKTRASNLEHRQG 179 LA EL TI+GE+ RT+S+ K + + D I+T K EI+KGR AI+ EKKTRASNL HRQ Sbjct: 119 LATELKTIQGEIERTRSDESKQFEARLDEIKTLKVEIEKGRAAIEIEKKTRASNLVHRQA 178 Query: 180 MEKTMAALAREMDKLHG 196 ME MAALA E+ KLHG Sbjct: 179 MEDYMAALALEIKKLHG 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71814181 (125 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19020 (188 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32374 (96 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig651 (233 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4544 (232 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 90997873 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5235 (166 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380738 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26701 (179 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4713 (252 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3814 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10310 (65 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10321 (269 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414632 (167 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24364 (347 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18203 (221 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig198 233 5e-64 >Contig198 Length = 160 Score = 233 bits (595), Expect = 5e-64, Method: Compositional matrix adjust. Identities = 114/161 (70%), Positives = 134/161 (83%), Gaps = 1/161 (0%) Query: 61 MGVFTYETEFISVIPPPRLFKAFILDADNLIPKLAPQAVKGIEILEGNGGVGTIKKVTFG 120 MGV+TYE EF S IP P+LFKAF+LDADNLIPK+APQAVK EILEG+GG GTIKK+TFG Sbjct: 1 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60 Query: 121 EGSQLGFVKHRIDGIDKDNFVYSYTLIEGDGLLSDKIEKVAYETKLVASPDGGSIVKSTS 180 EGS G+VKH+I IDK+N YSY+LIEGD LSD IEK+ YETKLV++P GG+++K+TS Sbjct: 61 EGSHYGYVKHKIHSIDKENHTYSYSLIEGDA-LSDNIEKIDYETKLVSAPHGGTVIKTTS 119 Query: 181 HYHAKGDVEIKEEQVKAGKEQASGLFKLVESYLLANPDAYN 221 YH KGDVEIKEE VKAGKE+AS LFKL+E YL +P YN Sbjct: 120 KYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22639 (298 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig1245 119 2e-29 >Contig1245 Length = 358 Score = 119 bits (299), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 80/224 (35%), Positives = 105/224 (46%), Gaps = 28/224 (12%) Query: 51 WPQCNTIGRILDQGHCGSCWAFAAVEALSDRFCVHYGMNISLSVNDLLACCGFMCGAGCN 110 W + + DQGHCGSCW F+ AL + +G ISLS L+ C G GC+ Sbjct: 147 WRDEGIVTPVKDQGHCGSCWTFSTTGALEAAYAQAFGKQISLSEQQLVDCAGAFNNFGCS 206 Query: 111 GGYPIYAWRYFIHHG-VVTEECDPYFDSTGCSHPGCEPAYPTPKCVKKCVDGNQIWKNSK 169 GG P A+ Y ++G + TEE PY G C+ + + + +D I Sbjct: 207 GGLPSQAFEYVKYNGGLDTEEGYPYTAKDGA----CK--FSSENVGVQVLDSVNI----- 255 Query: 170 RYSISAYRINSDPHSIMAEVYRNGPVEVAFTVYEDFAHYKSGVYK-----HVKGDVLGGH 224 D + V PV +AF V DF YKSGVY + DV H Sbjct: 256 --------TLGDEEGLKHAVAFVRPVSIAFQVVSDFRLYKSGVYTSETCGNTPMDV--NH 305 Query: 225 AVKLIGWGTTNDGEDYWLLANQWNRSWGDDGYFKIRRGTNECGI 268 AV +G+G N G YWL+ N W +SWGD+GYFK+ G N CGI Sbjct: 306 AVLAVGYGVEN-GVPYWLIKNSWGQSWGDNGYFKMEYGKNMCGI 348 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7976 (241 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2427 266 7e-74 >Contig2427 Length = 260 Score = 266 bits (681), Expect = 7e-74, Method: Compositional matrix adjust. Identities = 142/258 (55%), Positives = 166/258 (64%), Gaps = 19/258 (7%) Query: 1 MASLGILVIGFLSLVS-------SVNGYYGG--WSNAHATFYXXXXXXXXXXXXXXYGNL 51 MASL + ++ SL S + G Y G W AHATFY YGNL Sbjct: 1 MASLHLRLLCIASLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNL 60 Query: 52 YSQGYGTNTAALSTALFNNGLTCGACYQIRCVNDPQWCLPG--SIIVTATNFCPP----- 104 YSQGYG NTAALSTALFNNGL+CGAC++I+C +DP+WC G SI VTATNFCPP Sbjct: 61 YSQGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQP 120 Query: 105 ---GGWCDPPQQHFDLSQPVFLRIAQYKAGXXXXXXXXXXXXXXXXXXXXXNGHSYFNLV 161 GGWC+PP+ HFDL+ P+FL+IA+YKAG NGH YFNLV Sbjct: 121 SDNGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLV 180 Query: 162 LVTNVGGAGDVQSVAIKGSRTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSY 221 LVTNV GAGD+ SV++KG+ T W MSRNWGQNWQSNS L GQ+LSF V SD R +Y Sbjct: 181 LVTNVAGAGDIVSVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTTY 240 Query: 222 NVAPPNWSFGQTYTGRQF 239 NVAP NW FGQTY+G+ F Sbjct: 241 NVAPANWQFGQTYSGKNF 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6388 (317 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5162 112 3e-27 >Contig5162 Length = 448 Score = 112 bits (279), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 81/232 (34%), Positives = 112/232 (48%), Gaps = 35/232 (15%) Query: 62 GLSPTSFLESPVLLSNMKAEPSPTTGSFLKPQMLYGSLSSTTYSATTVCSDFNT-----S 116 SPT FL SP+ L+N PSPTT G+ SS + + + N+ Sbjct: 69 AFSPTDFLSSPMFLANSNTLPSPTT----------GAFSSQIFDWMSSSKENNSQQGAEK 118 Query: 117 DERNSGSFEFKP---HARSNMVTTDYNHHRNEQPVQVPGQAEPQSHASPTLAKNEMAVSS 173 +++ F F+P + + + + + Q + + T + E Sbjct: 119 EQKMFTDFSFQPATSSSSFSHQQQSSSSMVSSVEESLKSQQQQTWGFNKTSRQEETVAEK 178 Query: 174 NEL-SLSAPVHTGGASAPVEDDSGDLTQREHPHPGVQTSQGDNKGNGPSVISSDDGYNWR 232 E+ S APV + A AP + E+ + ++Q + SDDGYNWR Sbjct: 179 TEVKSEVAPVQSFNA-AP---------KSEYTNCSTHSTQYVREQ------KSDDGYNWR 222 Query: 233 KYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSHDGQITEIIYKGTHDHPKP 284 KYGQK VKGSE PRSYYKCT PNC KK ERS DGQIT+I+YKG+H+H KP Sbjct: 223 KYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSLDGQITQIVYKGSHNHAKP 274 Score = 73.6 bits (179), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 35/60 (58%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Query: 226 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFER-SHDGQITEIIYKGTHDHPKP 284 DDGY WRKYGQK VKG+ PRSYYKCT C V+K ER SHD + Y+G H+H P Sbjct: 384 DDGYRWRKYGQKVVKGNPNPRSYYKCTSTGCPVRKHVERASHDMRAVITTYEGKHNHDVP 443 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13086 (87 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16962 (60 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1073 (86 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4725 157 8e-42 >Contig4725 Length = 393 Score = 157 bits (398), Expect = 8e-42, Method: Compositional matrix adjust. Identities = 72/81 (88%), Positives = 77/81 (95%) Query: 6 PSPCSVFVDSYGTGKIPDKEILKIVKETFDFRPGMISINLDLKRGGNGRFLKTAAYGHFG 65 P P SVFV++YGTGKIPDKEILKIVKE FDFRPGMI+INLDLKRGGN RFLKTAAYGHFG Sbjct: 313 PEPLSVFVETYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNKRFLKTAAYGHFG 372 Query: 66 RDDPDFTWEVVKPLKWDKPQA 86 RDDPDFTWEVVKPLKW+KPQ+ Sbjct: 373 RDDPDFTWEVVKPLKWEKPQS 393 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21210 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21059 (153 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7755 (332 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig3920 515 e-148 >Contig3920 Length = 552 Score = 515 bits (1326), Expect = e-148, Method: Compositional matrix adjust. Identities = 261/327 (79%), Positives = 280/327 (85%), Gaps = 1/327 (0%) Query: 1 MKTDKVEIVQRRVNLMTEEGVNFVVNANIGNDPLYSLERLREENNAIVLAVGATKPRDLP 60 MK DKV++VQRRVNLM EEGVNFVVNAN+GND YS +RLREENNAI+LAVGATKPRDLP Sbjct: 224 MKADKVDVVQRRVNLMAEEGVNFVVNANVGNDSSYSFDRLREENNAIILAVGATKPRDLP 283 Query: 61 VPGRELSGVHFAMEFLRANTKSLLDSNLEDGNYISAXXXXXXXXXXXXXXXXXXXXSVRH 120 VPGRELSGVHFAMEFL ANTKSLLDSNLE+GNYISA SVRH Sbjct: 284 VPGRELSGVHFAMEFLHANTKSLLDSNLENGNYISAKGKKVVVIGGGDTGTDCIGTSVRH 343 Query: 121 GCTSIINLELLPEPPRTRAPGNPWPQWPRVFRVDYGHQEVAAKFGKDPRTYEVLTKRFVG 180 GCT I+NLELLP+PP+TRAPGNPWPQWPR+FRVDYGH EVAAKFGKDPRTYEVLTKRFVG Sbjct: 344 GCTDIVNLELLPQPPQTRAPGNPWPQWPRIFRVDYGHAEVAAKFGKDPRTYEVLTKRFVG 403 Query: 181 DENGAVKGLEVVRVKWEKDETGRFQFKEIEGSEEILEADLVLLAMGFLGPEATVAEKLGL 240 DENG VKG+EVVRVKWEKD TG+FQFKEIEGSEEI+EADLVLLAMGFLGPEA +AEKLGL Sbjct: 404 DENGVVKGIEVVRVKWEKDATGKFQFKEIEGSEEIIEADLVLLAMGFLGPEAAIAEKLGL 463 Query: 241 ERDQRSNYKADYGRFSTNVDGVFAAGDCRRGQSLVVWAISEGRQAAAQVDKYLSNEEEDR 300 E D RSN+KADYGRFSTNVDGVFAAGDCRRGQSLVVWAISEGRQAAAQVD YL EEED Sbjct: 464 ECDNRSNFKADYGRFSTNVDGVFAAGDCRRGQSLVVWAISEGRQAAAQVDNYLCKEEEDH 523 Query: 301 TISNGS-HPDLSKRHQDLSKRNPTGSS 326 T SN S DL KRHQ+++K T +S Sbjct: 524 TDSNSSPESDLLKRHQEITKSQKTVAS 550 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71813923 (97 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig4660 98 1e-23 >Contig4660 Length = 151 Score = 97.8 bits (242), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 47/62 (75%), Positives = 51/62 (82%), Gaps = 1/62 (1%) Query: 1 MDVISRS-ATTSSNLNPNAPMFVPLAYRTVEDFSAEWWALVQSSPWFQDYWLRERFQDPQ 59 MD+ISR S+LNPNAPMFVP AYR VEDFS EWWALVQSSPWF+DYWL+E F DPQ Sbjct: 1 MDIISRQQPPQQSSLNPNAPMFVPSAYRAVEDFSTEWWALVQSSPWFRDYWLQENFHDPQ 60 Query: 60 ND 61 ND Sbjct: 61 ND 62 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783584 (106 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31507 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5841 (211 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig5016 178 2e-47 >Contig5016 Length = 200 Score = 178 bits (451), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 108/211 (51%), Positives = 124/211 (58%), Gaps = 11/211 (5%) Query: 1 MAEKTQQAYPAAPANHGYQRSDAESLLSADELKRKKRIKLXXXXXXXXXXXXXXXXXXSL 60 MA+K QQ YP AP+N GY RSD ESL S DELKRKKRIK L Sbjct: 1 MADKHQQVYPLAPSN-GYTRSDGESL-SEDELKRKKRIKCFAYIGIFIVFQMAVGAVFGL 58 Query: 61 TVMKVKTPKVRLGNINVQELNSIPATPSFDTKFTTQINVKNTNWGPYKFDASSVTFLYKG 120 TV+KVKTPKVRL + +T SF + F TQI VKNTNWGPYKFD VTF Y+G Sbjct: 59 TVLKVKTPKVRL-DTTSTLSGVTSSTTSFSSTFNTQIRVKNTNWGPYKFDEGVVTFKYQG 117 Query: 121 ATVGQVSIPKSKAGMLSTKKITVEVXXXXXXXXXXXXXXXXXXXVLTLNSAAKLNGKVEL 180 VG ++PK KAGM TKKI V LTL S AKL GKV L Sbjct: 118 TPVGTFTVPKGKAGMRGTKKIDASVSLNTAALNSSGE--------LTLTSEAKLTGKVTL 169 Query: 181 MLIMKKKKSSTMDCTIAFDLSSKTLKSLRCK 211 M IMKKKKS++M+CTI D+S +T+KS+ CK Sbjct: 170 MFIMKKKKSASMNCTIQIDVSGQTVKSVVCK 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9611 (337 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89549845 243 1e-66 >89549845 Length = 194 Score = 243 bits (620), Expect = 1e-66, Method: Compositional matrix adjust. Identities = 107/170 (62%), Positives = 134/170 (78%) Query: 26 SVPFVVFHGISDKCSNRGVALFTELLSNWSGSQGHCIEIGDGSWDSWTMPLSEQTAIACE 85 SVPF+V HGI D+C+NRGV FTE L ++SG++G+CIE+G G+WDSW +PL EQT I CE Sbjct: 25 SVPFIVLHGIGDQCANRGVKQFTEQLRDFSGAEGYCIEVGAGTWDSWFVPLEEQTRIVCE 84 Query: 86 KVKNMSELSDGYNMVGLSQGNVIGRGVIQFCDGAPPVKNLISLAGPHAGTASIPFCKCEW 145 KVK M EL GYN+VGLSQGN+IGRGV++FC+ P VKN +SL GPHAG AS+P C Sbjct: 85 KVKEMEELRQGYNIVGLSQGNLIGRGVVEFCNNGPLVKNFVSLGGPHAGIASVPLCGSGI 144 Query: 146 ICVLLDDLIQSEIYSDFIQEHLAPSGYLKIPTDIDGYLKGCRFLPKLNNE 195 C++++ LI+ EIYSD+IQ HLAPSGY+K+P + YL CRFLPKLNNE Sbjct: 145 FCIIVNKLIKGEIYSDYIQAHLAPSGYIKLPNAMTDYLGRCRFLPKLNNE 194 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71924193 (157 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10934 (353 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21070 (165 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6614 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9008 (248 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20723 (369 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10275 (245 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3200 (104 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2542 (204 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig2005 119 2e-29 >Contig2005 Length = 422 Score = 119 bits (297), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 6/118 (5%) Query: 37 GSTASTAVLVGNHLYVANVGDSRTVISKAGKAIALSEDHKPNRSDERKRIENAGG-VVMW 95 GSTA AV+ + V+N GDSR V+ + G A+ LS DHKP+R DE RIE AGG V+ W Sbjct: 235 GSTAVVAVVTPEKIIVSNCGDSRAVLCRKGAAVPLSSDHKPDRPDELLRIEAAGGRVIYW 294 Query: 96 AGTWRVGGVLAMSRAFGNRMLKQYVVAEPE--IQDQVVDDDFEFLVLATDGVWDVLTN 151 G RV GVLAMSRA G+ LK YV++EPE I D+ +D E L+LA+DG+WDV++N Sbjct: 295 DGP-RVLGVLAMSRAIGDNYLKPYVISEPEVTIMDRTAED--ECLILASDGLWDVVSN 349 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27931 (137 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91038482 (150 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10305 (196 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89550571 78 3e-17 >89550571 Length = 226 Score = 78.2 bits (191), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 53/163 (32%), Positives = 82/163 (50%), Gaps = 43/163 (26%) Query: 5 RVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS---- 60 ++++++I+N RQVT++KRR GLLKKA ELSVLCD E ++IIFS+ GKL E SS Sbjct: 8 KIKIEKIDNLPARQVTYSKRRRGLLKKARELSVLCDCEFSVIIFSATGKLCESSSSSTKD 67 Query: 61 ---------------------------------------FRNLLGEDLSHLNTKELEHLE 81 R + GEDL LN EL+ LE Sbjct: 68 VITRYESQTGDEGNLDQSSLDLQHDCIKLSNEIADKSRVLRQMNGEDLEGLNIDELQRLE 127 Query: 82 HQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKALKRKL 124 +++ SL ++ K + I+ ++ L+ + L AN L++++ Sbjct: 128 TKIDGSLNRVLQTKEENIIGEILALEAKGAELELANNQLRQEI 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13373 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26517 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226758534 (147 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24208 (81 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8595 (98 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23179 (307 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2796 (227 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7160 (279 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8160 (389 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50353317 (85 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48273282 (88 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14404 (116 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48405783 (112 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10695 (225 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 158372667 203 6e-55 >158372667 Length = 230 Score = 203 bits (517), Expect = 6e-55, Method: Compositional matrix adjust. Identities = 111/232 (47%), Positives = 139/232 (59%), Gaps = 28/232 (12%) Query: 3 IRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVAAA 62 + IA G E P+ RA + EF++T +F+FAG GS MA KL D T L A Sbjct: 1 MAKIAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKLGAD---TTVALFFIA 57 Query: 63 LAHAFI-------------------------GGNISLLRGLLYWIAQLLGATVACGLLKL 97 + HA + GG+I+L R +LYWI QLL A +C LLK Sbjct: 58 ITHALVVAVMISAGHISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLKY 117 Query: 98 VTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIGFIV 157 +T G TT SL+ GVG ++EI++TF L++TVYAT +DPKKGS+ + P GF+V Sbjct: 118 LTGGLTTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGFVV 177 Query: 158 GANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLISAGIPGVIHH 209 GANILAGGAF GASMNPA SFGPALVSW W +HWVYW GPLI G+ G I+ Sbjct: 178 GANILAGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYE 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22927 (304 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48401035 (119 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764053 (127 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46598328 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5417 (142 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8059 (222 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25701 (180 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91029556 (47 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10658 (189 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50890345 (105 letters) Database: strawberry.as.orf 444 sequences; 104,044 total letters Searching..................................................done ***** No hits found ****** Database: strawberry.as.orf Posted date: Mar 27, 2017 5:37 AM Number of letters in database: 104,044 Number of sequences in database: 444 Lambda K H 0.313 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 444 Number of Hits to DB: 68,233,373 Number of extensions: 2863814 Number of successful extensions: 8798 Number of sequences better than 1.0e-10: 425 Number of HSP's gapped: 8186 Number of HSP's successfully gapped: 506 Length of database: 104,044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 6.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.6 bits) S2: 130 (54.7 bits)